3A40X

Crystal structure of the human vdr ligand binding domain bound to the synthetic agonist compound 2alpha-methyl-amcr277b(c23r)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
255
structure length
255
Chain Sequence
DSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function relationships and crystal structures of the vitamin D receptor bound 2 alpha-methyl-(20S,23S)- and 2 alpha-methyl-(20S,23R)-epoxymethano-1 alpha,25-dihydroxyvitamin D3
pubmed doi rcsb
molecule keywords Vitamin D3 receptor
molecule tags Gene regulation
source organism Homo sapiens
total genus 103
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2009-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3a40X00
1R20A 2Q60A 1YOWA 3H52A 5H1EA 5HJPA 2QA8A 2XYXA 1XB7A 3HC6A 1DKFA 1L2IA 5DRMA 4IW6A 5DXMA 5C4TA 5DX3B 4ZNTA 3IXPA 3TX7B 1RDTA 1P93A 4OJBA 4HEEX 3ADVA 1BSXA 2NV7A 3D5FA 3D90A 1EXXA 3PO9A 5DWIA 4CI4A 3UP0A 1UPVA 4PLDA 1NQ7A 3AZ1A 3A2IA 4MGCA 2FSZA 4YT1A 5DZIA 3N00A 5E15A 3G9EA 2J7XA 4UDCA 5GICA 1NQ2A 3W0JA 3GD2A 4WVDA 4MGDA 4YPQA 3L03A 3HQ5A 5DYDA 3B67A 1X78A 3SP6A 1PK5A 2AA5A 2HWQA 3ET3A 3B5RA 3X1IA 3JZCA 1XPCA 2ZVTA 3WTQA 3R8DA 2AA6A 3H0AA 2B23A 2VV1B 5DMCA 5HJSA 2GWXA 4EM9A 1S0XA 4A4VA 1GWXA 2HB7A 2Q6RA 1P8DA 5L7EA 5KCWA 4KZJA 3DZYD 2ZMIA 1I37A 4E4KA 2P7GA 1S19A 2Z4BA 1ILHA 5AYGA 2QXMA 3WT6A 5CJ6A 4S0SA 3SP9A 5HJPB 2QA8B 3UU7A 3OLFA 4OH6A 1XP9A 4R2UA 4M8EA 5E0WA 3VN2A 3WFFA 2HASA 3OKIA 1H9UA 2GPUA 3OKHA 2Q61A 5DXRA 5DUEA 3OS9A 5EGVA 2HAMA 5FQVA 2IOGA 4OILA 3ZQTA 4MG7A 4DOSA 3UUAA 2QGTA 2IHQA 2AX6A 4IA3A 4QE6A 4MGDB 3G0WA 3AUQA 3JZBA 5DVVA 3VRUA 1YA3A 4MG6A 5DZ3A 1KKQA 1N46A 3PBAA 5DVCA 5AWJA 2PRGA 2YFEA 2AB2A 4G2IA 4G1DA 2Q6JA 4L96A 5AAUA 3VT9A 3VT5A 2ZFXA 5KRKA 2AWHA 3HO0A 2BJ4B 4OKBA 2GTKA 1LBDA 3DCTA 3ZRAA 1T7TA 2G0HA 3CDPA 4UDDA 3IPQA 1SR7A 4K4JA 2JFAA 3GWXA 4XUHA 2YJAB 5KRFA 4YNKA 3RY9A 5E0XA 5AAVA 3VI8A 3HM1A 1YUCA 3DZYA 3P8XA 4RUPA 3AX8A 5E7VA 2VV4A 4PWLA 3B3KA 4LBDA 4OZTE 4WPFA 4DM8A 1WM0X 2R6YA 4OK1A 1XQCA 2I4JA 4ZOMA 1U3SA 4MG7B 3UUAB 1KNUA 3CS6A 1NAVA 3ADWA 3E00A 5KYAA 2GPVA 5AK2A 1PRGA 5HYKA 4PP6A 5DUHA 3CLDA 2ZLCA 3DCUA 4DORA 3OZ0A 2QR9A 5GT4A 2Q70A 3R29A 2QTUA 3U9QA 3KDTA 4Q13A 5GIDA 4JYHA 1FM9D 1RKGA 5DX3A 3B68A 3AZ2A 3P89A 4OZRE 1TXIA 2OCFA 4XHDA 2Q1VA 2ZNQA 3R2AA 3BQDA 5KCEA 2QE4A 2ZK6A 5G45A 1PZLA 2POBA 3HZFA 2ZNPA 2HBHA 4RZGA 3OMKA 2JFAB 4OLMA 1XLSE 1X7BA 4G20A 3VJIA 5KCTA 1T5ZA 3DY6A 1XZXX 2R40D 4L98A 5AAVB 3PCUA 1XDKA 4FN9A 2AYRA 2QH6A 1R1KD 3FURA 3B1MA 5DP0A 2AO6A 5E14A 3O1DA 4RMDA 2I0GA 5HCVA 1U3RA 3KDUA 1T73A 3AURA 5EI1A 5EJVA 5ACCA 5DL4A 4RUJA 4KZMA 4ZNVA 4DM6A 4X1FA 1FD0A 3MNOA 5EC9A 1QKNA 1QKUA 1X76A 3R5NA 4XI3A 4POJA 3K22A 3D57A 3L3XA 4MGBA 2ZK2A 4S15A 3FS1A 4JAZA 4N73A 5DIDA 2VV2A 2EWPA 1N4HA 1SQNA 2Q7LA 4S0TA 4E2JA 4J5WC 3IA6A 3KWYA 4OEZA 2V7CA 3MNEA 1E3GA 3GYTA 5KCCA 4HLWA 2YATA 4J5WA 5E1CA 3VT4A 3VTBA 4O8FA 1XP1A 3BEJA 4POHA 3A9EA 2YLOA 5G42A 3ERDA 2ZXZA 5DXGA 3VHVA 4DMAA 1RKHA 3CDSA 4FHHA 3X1HA 4OFRA 1YOKA 4RMEA 2V0VA 3AN4A 3NSPA 3OOFA 3W0CA 5DYBA 3VJTA 2B1ZA 3OMQA 5AVLA 3AN3A 4JYIA 1XDKB 2REWA 1ZDTA 4PLEA 4QJRA 4ONIA 3DT3A 1YJEA 2ATHA 3ET1A 1FM6D 3CS8A 1NHZA 3LMPA 1T7RA 4ZNUA 3NOAA 3R5MA 4OARA 4Y29A 5DXBA 3ERTA 4ZJWA 2GL8A 2ZK4A 3OS8A 1M13A 1KV6A 3DZUD 5APHA 1R5KA 3KFCA 3VRWA 3UUCA 4MGBB 5DIEA 4MG9A 2PNUA 3WT7A 2XYWA 2BJ4A 2FAIA 3V3QA 2J4AA 3VTCA 3AFRA 2AXAA 1YP0A 4QM0A 3V9YA 5B5BA 5APKA 5LWPA 1OSHA 1ZAFA 1SKXA 2HCDA 5KRLA 3OMPA 4PPPA 2GIUA 2ZMJA 3A9EB 5B41A 5GIEA 2ACLA 3VHWA 1S0ZA 2ZXMA 3ZRBA 3PLZA 5KCDA 1FCYA 3W5TA 1YY4A 2ZNOA 3RUUA 1T79A 4IA1A 3KPZA 3B0WA 2ZK3A 1UPWA 3CS4A 5AZVA 5DWGA 4NY9A 3DZUA 4K7AA 5DXPA 2AX9A 5DXBB 3A3ZX 4IWCA 1K7LA 4G1ZA 4NQAB 3NSQA 2I4PA 4N5GA 2ZLAA 4TUZB 3AZ3A 4MG9B 3V4AA 2JF9A 3WJ4A 5DKGA 1XP6A 3CWDA 3VJSA 3CQVA 3MNPA 3WJ5A 1HJ1A 2QXSA 3GN8A 1GS4A 4XLDA 4ZO1X 5K13A 5SYZA 5G43A 2P1TA 2YHDA 2PIOA 3IMYA 4IV4A 2AA7A 1FBYA 3ADSA 3X36A 5IXKA 1X7EA 5DXQA 1Z5XU 1M2ZA 2G0GA 3OAPA 3VT3A 5KRCA 2XKWA 2ACLB 4S14A 1ZGYA 3K8SA 5DMFA 5FQSA 2FVJA 2PIPL 1XAPA 2QMVA 4OJ9A 5DY8A 5APJA 5ICKA 3OGTA 3W0GA 1T74A 4IW8A 4DK7A 2PINA 2POGA 4OEYA 3WMHA 4XUMA 5FQPA 5L7GA 4WLBA 4OKXA 5DZ1A 2ZASA 3OOKA 3VT6A 3W5PA 3GWSX 1A52A 3HLVA 4UDAA 1GWQA 3TKCA 1I38A 2R6WA 2YLQA 2H79A 1UHLB 3E7CA 5DRJA 4OC7A 4RWVA 2PIUA 2P54A 4ZJRA 1XVPA 3V3EA 3B66A 3TKMA 1XLSA 3IPUA 3L0JA 4LTWA 4MG5A 5KRMA 2Q1HA 2Q8SA 4RFWA 5DIGA 5JJMA 4OGHA 1PCGA 1K74D 3K6PA 1ERRA 1R20D 1XNXA 3L0EA 4OIUA 1DB1A 2F4BA 3W0IA 1Y9RA 1MVCA 3WGPA 2YJDA 1FCZA 3SZ1A 2QZOA 2P7ZA 2ZNNA 2NXXE 2I4ZA 3IXPD 1U9EA 3FALA 1RDTD 3K23A 4NB6A 4XTAA 3UVVA 5KR9A 3GBKA 5KYJA 1ZH7A 2Z4JA 3WFGA 3W0YA 5JI0D 4A4WA 5I4VA 2Q59A 1G1UA 5DWLA 1RK3A 2XHSA 3RLLA 2QGWA 1I7GA 2P4YA 1YYEA 2ZMHA 3IPSA 3M7RA 3X31A 1SJ0A 1FCXA 3A40X 5F9BA 4APUA 3WT5A 3F5CA 2HB8A 4ZI1A 2HWRA 4FHIA 5G5WA 2ABIA 2AM9A 3ADUA 2J14A 4REEA 4RUOX 5DUGA 3PRGA 1G2NA 4OHAA 3A2JA 4TV1A 4F9MA 3B0TA 2P7AA 3HVLA 4IQRA 1XVPB 5C4SA 4N8RA 3L1BA 4PVUA 4P6XA 4WHGA 2O4JA 5E19A 3KYTA 1U3QA 3L0LA 4P6WA 3FLIA 2NW4A 4DK8A 2ZK0A 4IA2A 3P0UA 5ETHA 5AVIA 4DQMA 2OUZA 1ILGA 4XAOA 5C4OA 1FM9A 1Y0XX 4OH5A 3VTDA 5KRJA 2Q6SA 2QZOB 4LNXA 2HC4A 4REFA 3OS8C 5IZ0A 3V9TA 3FALB 2VV3A 3UVVB 1ZUCA 4ZNHA 1TFCA 4B7WA 1UOMA 5G3JA 1PQCA 4PP5A 4OIVA 5EITA 2R40A 1T63A 2Q59B 5DZHA 5M96A 4NIEA 1ZDUA 1R1KA 4TUZA 1XJ7A 4JL4A 3BC5A 4PXMA 4RE8A 3CTBA 4OZRU 3VSOA 3D6DA 4IVYA 1Z95A 2QA6A 5KD9A 2Q3YA 2OVMA 3B0QA 1NYXA 4R06A 2J7YA 3FEIA 3F5CB 5DV3A 2ZKCA 5DV6A 3CJWA 3R8IA 2GPPA 4XT9A 4RZFA 4PRGA 1K4WA 1PQ9A 4G1YA 1Q4XA 3W5QA 4IS8A 4TV1B 3UUDA 1Z5XE 5AZTA 3TY0A 2E2RA 3ET2A 3V9VA 1G50A 3QT0A 3VHUA 3AUNA 2QNVA 4IU7A 1XV9A 5DKBA 2PIVA 2Q7KA 2PIRA 3RLJA 5DK9A 5KRHA 1EREA 5KCUA 4ZN9A 2PITA 1ZEOA 4OEAA 2AAXA 2A3IA 2AMAA 4OJ4A 1MZNA 4J26A 2Q5SA 2AX8A 2Q5PA 3LBDA 4IA7A 2P1VA 2HARA 4FGYA 1R6GA 1X7JA 4MGAA 5DKEA 2I0JA 4NUFA 1MV9A 4EMAA 4RAKA 1OSVA 1UHLA 1T76A 4IVWA 1YIMA 5DTVA 4E4QA 1DKFB 5KCFA 5DXEA 1VJBA 1I7IA 3KMZA 1OVLA 3OLSA 1L2JA 2GPOA 3DR1A 5DKSA 5G44A 3VT8A 3E00D 1FM6A 2LBDA 1NAXA 3B65A 5LGAA 2HVCA 3VJHA 3Q95A 1E3KA 1XNNA 1YINA 3FC6A 4N1YA 2JJ3A 4R6SA 5G46A 5JJMB 3R8AA 5AWKA 1RJKA 2W8YA 5DXKA 5DWEA 3OMOA 3P88A 1YMTA 1IE8A 3VRTA 1XIUA 4JYGA 3VRVA 2G44A 5DWJA 5KRAA 3UUDB 4MG8A 2O4RA 3KBAA 3O1EA 1PQ6A 1XV9B 5EHJA 2P15A 3W0HA 3G8IA 3S9SA 2HFPA 4J5XC 2ZK5A 4IUIA 4IWFA 4OFUA 2YLPA 3A78A 4ITFA 3L3ZA 4OKTA 3W5RA 1NQ1A 1LV2A 4UDBA 2ZY0A 2PJLA 1ZKYA 2QABA 1T7MA 4J5XA 2Q5GA 2VV0A 2P1UA 1X7RA 2ZL9A 3GZ9A 1Y0SA 4KZIA 4MGAB 4WHFA 3WWRA 3OLLA 2PIWA 1XQ3A 4LSJA 2QSEA 4K6IA 5FQTA 2NPAA 3UU7B 2H77A 3KMGA 1OVLB 3F7DA 3UP3A 2PKLA 3A2HA 3B0RA 5DV8A 3RVFA 3VSPA 4BCRA 4QL8A 3Q95B 3OZJA 3ADXA 1NQ0A 3FC6B 4ITEA 3FXVA 3OSAA 3D24A 3KMRA 4RZEA 5DU5A 5L11A 1G5YA 2NXXA 1T7FA 4J24A 5DSHA 1N83A 1GWRA 2ZK1A 3RUTA 2B50A 3VT7A 4MG8B 4X1GA 2AX7A 2PIXA 3FEJA 3T03A 2PIQA 1A28A 4G21A 2IOKA 3G8OA 1NUOA 3HC5A 2VSTA 4OEDA 4ZO1B 4YMQA 2AMBA 3OSWA 4LNWA 4OKWA 2VSRA 1M7WA 3GYUA 3OMMA 4PP3A 4FNEA 4WQPA 5DLRA 3W0AA 1OT7A 4IV2A 5C4UA 5KROA 4PPSA 3EYBA 1NDEA 5FQRA 5A86A 2AA2A 4G2HA 3HODA 2OZ7A 1HG4A 5DI7A 5L7HA 1S9QA 4CSJA 5JY3A 2QPYA 3H0AD 1T65A 5HZCA 3ADTA 3ZR7A 4CI5A 1XOWA 3PEQA 2Q7JA 4ZNSA 5KRIA 5DVSA 2Q7IA 4ZNWA 2O9IA 4RMCA 4ZN7A 2VV4B 5HYRA 2B1VA 3V49A 4JGVA 2OAXA 1IE9A 4OZTU 2OM9A 1QKMA 2QW4A 2VV1A 1S9PA 5DZ0A 4MDDA 4M8HA 5IAWA 3FUGA 2XYJA 2YLYA 1PDUA 2ZBSA 4QE8A 1NRLA 1QKTA 2G5OA 1EXAA 2BAWA 2GP7A 3ET0A 3OSIA 4A2JA 4Q50A 4Q0AC 4PF3A 3ILZA 3E94A 2ZXNA 4QK4A 2OVHA 1K74A
chains in the Genus database with same CATH superfamily
1R20A 2Q60A 1YOWA 3H52A 5H1EA 5HJPA 2QA8A 2XYXA 1XB7A 3HC6A 1DKFA 1L2IA 5DRMA 4IW6A 5DXMA 5C4TA 5DX3B 4ZNTA 3IXPA 3TX7B 1RDTA 1P93A 4OJBA 4HEEX 3ADVA 1BSXA 2NV7A 3D5FA 3D90A 1EXXA 3PO9A 5DWIA 4CI4A 3UP0A 1UPVA 4PLDA 1NQ7A 3AZ1A 3A2IA 4MGCA 2FSZA 4YT1A 5DZIA 3N00A 5E15A 3G9EA 2J7XA 4UDCA 5GICA 1NQ2A 3W0JA 3GD2A 4WVDA 4MGDA 4YPQA 3L03A 3HQ5A 5DYDA 3B67A 1X78A 3SP6A 1PK5A 2AA5A 2HWQA 3ET3A 3B5RA 3X1IA 3JZCA 1XPCA 2ZVTA 3WTQA 3R8DA 2AA6A 3H0AA 2B23A 2VV1B 5DMCA 5HJSA 2GWXA 4EM9A 1S0XA 4A4VA 1GWXA 2HB7A 2Q6RA 1P8DA 5L7EA 5KCWA 4KZJA 3DZYD 2ZMIA 1I37A 4E4KA 2P7GA 1S19A 2Z4BA 1ILHA 5AYGA 2QXMA 3WT6A 5CJ6A 4S0SA 3SP9A 5HJPB 2QA8B 3UU7A 3OLFA 4OH6A 1XP9A 4R2UA 4M8EA 5E0WA 3VN2A 3WFFA 2HASA 3OKIA 1H9UA 2GPUA 3OKHA 2Q61A 5DXRA 5DUEA 3OS9A 5EGVA 2HAMA 5FQVA 2IOGA 4OILA 3ZQTA 4MG7A 4DOSA 3UUAA 2QGTA 2IHQA 2AX6A 4IA3A 4QE6A 4MGDB 3G0WA 3AUQA 3JZBA 5DVVA 3VRUA 1YA3A 4MG6A 5DZ3A 1KKQA 1N46A 3PBAA 5DVCA 5AWJA 2PRGA 2YFEA 2AB2A 4G2IA 4G1DA 2Q6JA 4L96A 5AAUA 3VT9A 3VT5A 2ZFXA 5KRKA 2AWHA 3HO0A 2BJ4B 4OKBA 2GTKA 1LBDA 3DCTA 3ZRAA 1T7TA 2G0HA 3CDPA 4UDDA 3IPQA 1SR7A 4K4JA 2JFAA 3GWXA 4XUHA 2YJAB 5KRFA 4YNKA 3RY9A 5E0XA 5AAVA 3VI8A 3HM1A 1YUCA 3DZYA 3P8XA 4RUPA 3AX8A 5E7VA 2VV4A 4PWLA 3B3KA 4LBDA 4OZTE 4WPFA 4DM8A 1WM0X 2R6YA 4OK1A 1XQCA 2I4JA 4ZOMA 1U3SA 4MG7B 3UUAB 1KNUA 3CS6A 1NAVA 3ADWA 3E00A 5KYAA 2GPVA 5AK2A 1PRGA 5HYKA 4PP6A 5DUHA 3CLDA 2ZLCA 3DCUA 4DORA 3OZ0A 2QR9A 5GT4A 2Q70A 3R29A 2QTUA 3U9QA 3KDTA 4Q13A 5GIDA 4JYHA 1FM9D 1RKGA 5DX3A 3B68A 3AZ2A 3P89A 4OZRE 1TXIA 2OCFA 4XHDA 2Q1VA 2ZNQA 3R2AA 3BQDA 5KCEA 2QE4A 2ZK6A 5G45A 1PZLA 2POBA 3HZFA 2ZNPA 2HBHA 4RZGA 3OMKA 2JFAB 4OLMA 1XLSE 1X7BA 4G20A 3VJIA 5KCTA 1T5ZA 3DY6A 1XZXX 2R40D 4L98A 5AAVB 3PCUA 1XDKA 4FN9A 2AYRA 2QH6A 1R1KD 3FURA 3B1MA 5DP0A 2AO6A 5E14A 3O1DA 4RMDA 2I0GA 5HCVA 1U3RA 3KDUA 1T73A 3AURA 5EI1A 5EJVA 5ACCA 5DL4A 4RUJA 4KZMA 4ZNVA 4DM6A 4X1FA 1FD0A 3MNOA 5EC9A 1QKNA 1QKUA 1X76A 3R5NA 4XI3A 4POJA 3K22A 3D57A 3L3XA 4MGBA 2ZK2A 4S15A 3FS1A 4JAZA 4N73A 5DIDA 2VV2A 2EWPA 1N4HA 1SQNA 2Q7LA 4S0TA 4E2JA 4J5WC 3IA6A 3KWYA 4OEZA 2V7CA 3MNEA 1E3GA 3GYTA 5KCCA 4HLWA 2YATA 4J5WA 5E1CA 3VT4A 3VTBA 4O8FA 1XP1A 3BEJA 4POHA 3A9EA 2YLOA 5G42A 3ERDA 2ZXZA 5DXGA 3VHVA 4DMAA 1RKHA 3CDSA 4FHHA 3X1HA 4OFRA 1YOKA 4RMEA 2V0VA 3AN4A 3NSPA 3OOFA 3W0CA 5DYBA 3VJTA 2B1ZA 3OMQA 5AVLA 3AN3A 4JYIA 1XDKB 2REWA 1ZDTA 4PLEA 4QJRA 4ONIA 3DT3A 1YJEA 2ATHA 3ET1A 1FM6D 3CS8A 1NHZA 3LMPA 1T7RA 4ZNUA 3NOAA 3R5MA 4OARA 4Y29A 5DXBA 3ERTA 4ZJWA 2GL8A 2ZK4A 3OS8A 1M13A 1KV6A 3DZUD 5APHA 1R5KA 3KFCA 3VRWA 3UUCA 4MGBB 5DIEA 4MG9A 2PNUA 3WT7A 2XYWA 2BJ4A 2FAIA 3V3QA 2J4AA 3VTCA 3AFRA 2AXAA 1YP0A 4QM0A 3V9YA 5B5BA 5APKA 5LWPA 1OSHA 1ZAFA 1SKXA 2HCDA 5KRLA 3OMPA 4PPPA 2GIUA 2ZMJA 3A9EB 5B41A 5GIEA 2ACLA 3VHWA 1S0ZA 2ZXMA 3ZRBA 3PLZA 5KCDA 1FCYA 3W5TA 1YY4A 2ZNOA 3RUUA 1T79A 4IA1A 3KPZA 3B0WA 2ZK3A 1UPWA 3CS4A 5AZVA 5DWGA 4NY9A 3DZUA 4K7AA 5DXPA 2AX9A 5DXBB 3A3ZX 4IWCA 1K7LA 4G1ZA 4NQAB 3NSQA 2I4PA 4N5GA 2ZLAA 4TUZB 3AZ3A 4MG9B 3V4AA 2JF9A 3WJ4A 5DKGA 1XP6A 3CWDA 3VJSA 3CQVA 3MNPA 3WJ5A 1HJ1A 2QXSA 3GN8A 1GS4A 4XLDA 4ZO1X 5K13A 5SYZA 5G43A 2P1TA 2YHDA 2PIOA 3IMYA 4IV4A 2AA7A 1FBYA 3ADSA 3X36A 5IXKA 1X7EA 5DXQA 1Z5XU 1M2ZA 2G0GA 3OAPA 3VT3A 5KRCA 2XKWA 2ACLB 4S14A 1ZGYA 3K8SA 5DMFA 5FQSA 2FVJA 2PIPL 1XAPA 2QMVA 4OJ9A 5DY8A 5APJA 5ICKA 3OGTA 3W0GA 1T74A 4IW8A 4DK7A 2PINA 2POGA 4OEYA 3WMHA 4XUMA 5FQPA 5L7GA 4WLBA 4OKXA 5DZ1A 2ZASA 3OOKA 3VT6A 3W5PA 3GWSX 1A52A 3HLVA 4UDAA 1GWQA 3TKCA 1I38A 2R6WA 2YLQA 2H79A 1UHLB 3E7CA 5DRJA 4OC7A 4RWVA 2PIUA 2P54A 4ZJRA 1XVPA 3V3EA 3B66A 3TKMA 1XLSA 3IPUA 3L0JA 4LTWA 4MG5A 5KRMA 2Q1HA 2Q8SA 4RFWA 5DIGA 5JJMA 4OGHA 1PCGA 1K74D 3K6PA 1ERRA 1R20D 1XNXA 3L0EA 4OIUA 1DB1A 2F4BA 3W0IA 1Y9RA 1MVCA 3WGPA 2YJDA 1FCZA 3SZ1A 2QZOA 2P7ZA 2ZNNA 2NXXE 2I4ZA 3IXPD 1U9EA 3FALA 1RDTD 3K23A 4NB6A 4XTAA 3UVVA 5KR9A 3GBKA 5KYJA 1ZH7A 2Z4JA 3WFGA 3W0YA 5JI0D 4A4WA 5I4VA 2Q59A 1G1UA 5DWLA 1RK3A 2XHSA 3RLLA 2QGWA 1I7GA 2P4YA 1YYEA 2ZMHA 3IPSA 3M7RA 3X31A 1SJ0A 1FCXA 3A40X 5F9BA 4APUA 3WT5A 3F5CA 2HB8A 4ZI1A 2HWRA 4FHIA 5G5WA 2ABIA 2AM9A 3ADUA 2J14A 4REEA 4RUOX 5DUGA 3PRGA 1G2NA 4OHAA 3A2JA 4TV1A 4F9MA 3B0TA 2P7AA 3HVLA 4IQRA 1XVPB 5C4SA 4N8RA 3L1BA 4PVUA 4P6XA 4WHGA 2O4JA 5E19A 3KYTA 1U3QA 3L0LA 4P6WA 3FLIA 2NW4A 4DK8A 2ZK0A 4IA2A 3P0UA 5ETHA 5AVIA 4DQMA 2OUZA 1ILGA 4XAOA 5C4OA 1FM9A 1Y0XX 4OH5A 3VTDA 5KRJA 2Q6SA 2QZOB 4LNXA 2HC4A 4REFA 3OS8C 5IZ0A 3V9TA 3FALB 2VV3A 3UVVB 1ZUCA 4ZNHA 1TFCA 4B7WA 1UOMA 5G3JA 1PQCA 4PP5A 4OIVA 5EITA 2R40A 1T63A 2Q59B 5DZHA 5M96A 4NIEA 1ZDUA 1R1KA 4TUZA 1XJ7A 4JL4A 3BC5A 4PXMA 4RE8A 3CTBA 4OZRU 3VSOA 3D6DA 4IVYA 1Z95A 2QA6A 5KD9A 2Q3YA 2OVMA 3B0QA 1NYXA 4R06A 2J7YA 3FEIA 3F5CB 5DV3A 2ZKCA 5DV6A 3CJWA 3R8IA 2GPPA 4XT9A 4RZFA 4PRGA 1K4WA 1PQ9A 4G1YA 1Q4XA 3W5QA 4IS8A 4TV1B 3UUDA 1Z5XE 5AZTA 3TY0A 2E2RA 3ET2A 3V9VA 1G50A 3QT0A 3VHUA 3AUNA 2QNVA 4IU7A 1XV9A 5DKBA 2PIVA 2Q7KA 2PIRA 3RLJA 5DK9A 5KRHA 1EREA 5KCUA 4ZN9A 2PITA 1ZEOA 4OEAA 2AAXA 2A3IA 2AMAA 4OJ4A 1MZNA 4J26A 2Q5SA 2AX8A 2Q5PA 3LBDA 4IA7A 2P1VA 2HARA 4FGYA 1R6GA 1X7JA 4MGAA 5DKEA 2I0JA 4NUFA 1MV9A 4EMAA 4RAKA 1OSVA 1UHLA 1T76A 4IVWA 1YIMA 5DTVA 4E4QA 1DKFB 5KCFA 5DXEA 1VJBA 1I7IA 3KMZA 1OVLA 3OLSA 1L2JA 2GPOA 3DR1A 5DKSA 5G44A 3VT8A 3E00D 1FM6A 2LBDA 1NAXA 3B65A 5LGAA 2HVCA 3VJHA 3Q95A 1E3KA 1XNNA 1YINA 3FC6A 4N1YA 2JJ3A 4R6SA 5G46A 5JJMB 3R8AA 5AWKA 1RJKA 2W8YA 5DXKA 5DWEA 3OMOA 3P88A 1YMTA 1IE8A 3VRTA 1XIUA 4JYGA 3VRVA 2G44A 5DWJA 5KRAA 3UUDB 4MG8A 2O4RA 3KBAA 3O1EA 1PQ6A 1XV9B 5EHJA 2P15A 3W0HA 3G8IA 3S9SA 2HFPA 4J5XC 2ZK5A 4IUIA 4IWFA 4OFUA 2YLPA 3A78A 4ITFA 3L3ZA 4OKTA 3W5RA 1NQ1A 1LV2A 4UDBA 2ZY0A 2PJLA 1ZKYA 2QABA 1T7MA 4J5XA 2Q5GA 2VV0A 2P1UA 1X7RA 2ZL9A 3GZ9A 1Y0SA 4KZIA 4MGAB 4WHFA 3WWRA 3OLLA 2PIWA 1XQ3A 4LSJA 2QSEA 4K6IA 5FQTA 2NPAA 3UU7B 2H77A 3KMGA 1OVLB 3F7DA 3UP3A 2PKLA 3A2HA 3B0RA 5DV8A 3RVFA 3VSPA 4BCRA 4QL8A 3Q95B 3OZJA 3ADXA 1NQ0A 3FC6B 4ITEA 3FXVA 3OSAA 3D24A 3KMRA 4RZEA 5DU5A 5L11A 1G5YA 2NXXA 1T7FA 4J24A 5DSHA 1N83A 1GWRA 2ZK1A 3RUTA 2B50A 3VT7A 4MG8B 4X1GA 2AX7A 2PIXA 3FEJA 3T03A 2PIQA 1A28A 4G21A 2IOKA 3G8OA 1NUOA 3HC5A 2VSTA 4OEDA 4ZO1B 4YMQA 2AMBA 3OSWA 4LNWA 4OKWA 2VSRA 1M7WA 3GYUA 3OMMA 4PP3A 4FNEA 4WQPA 5DLRA 3W0AA 1OT7A 4IV2A 5C4UA 5KROA 4PPSA 3EYBA 1NDEA 5FQRA 5A86A 2AA2A 4G2HA 3HODA 2OZ7A 1HG4A 5DI7A 5L7HA 1S9QA 4CSJA 5JY3A 2QPYA 3H0AD 1T65A 5HZCA 3ADTA 3ZR7A 4CI5A 1XOWA 3PEQA 2Q7JA 4ZNSA 5KRIA 5DVSA 2Q7IA 4ZNWA 2O9IA 4RMCA 4ZN7A 2VV4B 5HYRA 2B1VA 3V49A 4JGVA 2OAXA 1IE9A 4OZTU 2OM9A 1QKMA 2QW4A 2VV1A 1S9PA 5DZ0A 4MDDA 4M8HA 5IAWA 3FUGA 2XYJA 2YLYA 1PDUA 2ZBSA 4QE8A 1NRLA 1QKTA 2G5OA 1EXAA 2BAWA 2GP7A 3ET0A 3OSIA 4A2JA 4Q50A 4Q0AC 4PF3A 3ILZA 3E94A 2ZXNA 4QK4A 2OVHA 1K74A
chains in the Genus database with same CATH topology
1R20A 2Q60A 1YOWA 3H52A 5H1EA 5HJPA 2QA8A 2XYXA 1XB7A 3HC6A 1DKFA 1L2IA 5DRMA 4IW6A 5DXMA 5C4TA 5DX3B 4ZNTA 3IXPA 3TX7B 1RDTA 1P93A 4OJBA 4HEEX 3ADVA 1BSXA 2NV7A 3D5FA 3D90A 1EXXA 3PO9A 5DWIA 4CI4A 3UP0A 1UPVA 4PLDA 1NQ7A 3AZ1A 3A2IA 4MGCA 2FSZA 4YT1A 5DZIA 3N00A 5E15A 3G9EA 2J7XA 4UDCA 5GICA 1NQ2A 3W0JA 3GD2A 4WVDA 4MGDA 4YPQA 3L03A 3HQ5A 5DYDA 3B67A 1X78A 3SP6A 1PK5A 2AA5A 2HWQA 3ET3A 3B5RA 3X1IA 3JZCA 1XPCA 2ZVTA 3WTQA 3R8DA 2AA6A 3H0AA 2B23A 2VV1B 5DMCA 5HJSA 2GWXA 4EM9A 1S0XA 4A4VA 1GWXA 2HB7A 2Q6RA 1P8DA 5L7EA 5KCWA 4KZJA 3DZYD 2ZMIA 1I37A 4E4KA 2P7GA 1S19A 2Z4BA 1ILHA 5AYGA 2QXMA 3WT6A 5CJ6A 4S0SA 3SP9A 5HJPB 2QA8B 3UU7A 3OLFA 4OH6A 1XP9A 4R2UA 4M8EA 5E0WA 3VN2A 3WFFA 2HASA 3OKIA 1H9UA 2GPUA 3OKHA 2Q61A 5DXRA 5DUEA 3OS9A 5EGVA 2HAMA 5FQVA 2IOGA 4OILA 3ZQTA 4MG7A 4DOSA 3UUAA 2QGTA 2IHQA 2AX6A 4IA3A 4QE6A 4MGDB 3G0WA 3AUQA 3JZBA 5DVVA 3VRUA 1YA3A 4MG6A 5DZ3A 1KKQA 1N46A 3PBAA 5DVCA 5AWJA 2PRGA 2YFEA 2AB2A 4G2IA 4G1DA 2Q6JA 4L96A 5AAUA 3VT9A 3VT5A 2ZFXA 5KRKA 2AWHA 3HO0A 2BJ4B 4OKBA 2GTKA 1LBDA 3DCTA 3ZRAA 1T7TA 2G0HA 3CDPA 4UDDA 3IPQA 1SR7A 4K4JA 2JFAA 3GWXA 4XUHA 2YJAB 5KRFA 4YNKA 3RY9A 5E0XA 5AAVA 3VI8A 3HM1A 1YUCA 3DZYA 3P8XA 4RUPA 3AX8A 5E7VA 2VV4A 4PWLA 3B3KA 4LBDA 4OZTE 4WPFA 4DM8A 1WM0X 2R6YA 4OK1A 1XQCA 2I4JA 4ZOMA 1U3SA 4MG7B 3UUAB 1KNUA 3CS6A 1NAVA 3ADWA 3E00A 5KYAA 2GPVA 5AK2A 1PRGA 5HYKA 4PP6A 5DUHA 3CLDA 2ZLCA 3DCUA 4DORA 3OZ0A 2QR9A 5GT4A 2Q70A 3R29A 2QTUA 3U9QA 3KDTA 4Q13A 5GIDA 4JYHA 1FM9D 1RKGA 5DX3A 3B68A 3AZ2A 3P89A 4OZRE 1TXIA 2OCFA 4XHDA 2Q1VA 2ZNQA 3R2AA 3BQDA 5KCEA 2QE4A 2ZK6A 5G45A 1PZLA 2POBA 3HZFA 2ZNPA 2HBHA 4RZGA 3OMKA 2JFAB 4OLMA 1XLSE 1X7BA 4G20A 3VJIA 5KCTA 1T5ZA 3DY6A 1XZXX 2R40D 4L98A 5AAVB 3PCUA 1XDKA 4FN9A 2AYRA 2QH6A 1R1KD 3FURA 3B1MA 5DP0A 2AO6A 5E14A 3O1DA 4RMDA 2I0GA 5HCVA 1U3RA 3KDUA 1T73A 3AURA 5EI1A 5EJVA 5ACCA 5DL4A 4RUJA 4KZMA 4ZNVA 4DM6A 4X1FA 1FD0A 3MNOA 5EC9A 1QKNA 1QKUA 1X76A 3R5NA 4XI3A 4POJA 3K22A 3D57A 3L3XA 4MGBA 2ZK2A 4S15A 3FS1A 4JAZA 4N73A 5DIDA 2VV2A 2EWPA 1N4HA 1SQNA 2Q7LA 4S0TA 4E2JA 4J5WC 3IA6A 3KWYA 4OEZA 2V7CA 3MNEA 1E3GA 3GYTA 5KCCA 4HLWA 2YATA 4J5WA 5E1CA 3VT4A 3VTBA 4O8FA 1XP1A 3BEJA 4POHA 3A9EA 2YLOA 5G42A 3ERDA 2ZXZA 5DXGA 3VHVA 4DMAA 1RKHA 3CDSA 4FHHA 3X1HA 4OFRA 1YOKA 4RMEA 2V0VA 3AN4A 3NSPA 3OOFA 3W0CA 5DYBA 3VJTA 2B1ZA 3OMQA 5AVLA 3AN3A 4JYIA 1XDKB 2REWA 1ZDTA 4PLEA 4QJRA 4ONIA 3DT3A 1YJEA 2ATHA 3ET1A 1FM6D 3CS8A 1NHZA 3LMPA 1T7RA 4ZNUA 3NOAA 3R5MA 4OARA 4Y29A 5DXBA 3ERTA 4ZJWA 2GL8A 2ZK4A 3OS8A 1M13A 1KV6A 3DZUD 5APHA 1R5KA 3KFCA 3VRWA 3UUCA 4MGBB 5DIEA 4MG9A 2PNUA 3WT7A 2XYWA 2BJ4A 2FAIA 3V3QA 2J4AA 3VTCA 3AFRA 2AXAA 1YP0A 4QM0A 3V9YA 5B5BA 5APKA 5LWPA 1OSHA 1ZAFA 1SKXA 2HCDA 5KRLA 3OMPA 4PPPA 2GIUA 2ZMJA 3A9EB 5B41A 5GIEA 2ACLA 3VHWA 1S0ZA 2ZXMA 3ZRBA 3PLZA 5KCDA 1FCYA 3W5TA 1YY4A 2ZNOA 3RUUA 1T79A 4IA1A 3KPZA 3B0WA 2ZK3A 1UPWA 3CS4A 5AZVA 5DWGA 4NY9A 3DZUA 4K7AA 5DXPA 2AX9A 5DXBB 3A3ZX 4IWCA 1K7LA 4G1ZA 4NQAB 3NSQA 2I4PA 4N5GA 2ZLAA 4TUZB 3AZ3A 4MG9B 3V4AA 2JF9A 3WJ4A 5DKGA 1XP6A 3CWDA 3VJSA 3CQVA 3MNPA 3WJ5A 1HJ1A 2QXSA 3GN8A 1GS4A 4XLDA 4ZO1X 5K13A 5SYZA 5G43A 2P1TA 2YHDA 2PIOA 3IMYA 4IV4A 2AA7A 1FBYA 3ADSA 3X36A 5IXKA 1X7EA 5DXQA 1Z5XU 1M2ZA 2G0GA 3OAPA 3VT3A 5KRCA 2XKWA 2ACLB 4S14A 1ZGYA 3K8SA 5DMFA 5FQSA 2FVJA 2PIPL 1XAPA 2QMVA 4OJ9A 5DY8A 5APJA 5ICKA 3OGTA 3W0GA 1T74A 4IW8A 4DK7A 2PINA 2POGA 4OEYA 3WMHA 4XUMA 5FQPA 5L7GA 4WLBA 4OKXA 5DZ1A 2ZASA 3OOKA 3VT6A 3W5PA 3GWSX 1A52A 3HLVA 4UDAA 1GWQA 3TKCA 1I38A 2R6WA 2YLQA 2H79A 1UHLB 3E7CA 5DRJA 4OC7A 4RWVA 2PIUA 2P54A 4ZJRA 1XVPA 3V3EA 3B66A 3TKMA 1XLSA 3IPUA 3L0JA 4LTWA 4MG5A 5KRMA 2Q1HA 2Q8SA 4RFWA 5DIGA 5JJMA 4OGHA 1PCGA 1K74D 3K6PA 1ERRA 1R20D 1XNXA 3L0EA 4OIUA 1DB1A 2F4BA 3W0IA 1Y9RA 1MVCA 3WGPA 2YJDA 1FCZA 3SZ1A 2QZOA 2P7ZA 2ZNNA 2NXXE 2I4ZA 3IXPD 1U9EA 3FALA 1RDTD 3K23A 4NB6A 4XTAA 3UVVA 5KR9A 3GBKA 5KYJA 1ZH7A 2Z4JA 3WFGA 3W0YA 5JI0D 4A4WA 5I4VA 2Q59A 1G1UA 5DWLA 1RK3A 2XHSA 3RLLA 2QGWA 1I7GA 2P4YA 1YYEA 2ZMHA 3IPSA 3M7RA 3X31A 1SJ0A 1FCXA 3A40X 5F9BA 4APUA 3WT5A 3F5CA 2HB8A 4ZI1A 2HWRA 4FHIA 5G5WA 2ABIA 2AM9A 3ADUA 2J14A 4REEA 4RUOX 5DUGA 3PRGA 1G2NA 4OHAA 3A2JA 4TV1A 4F9MA 3B0TA 2P7AA 3HVLA 4IQRA 1XVPB 5C4SA 4N8RA 3L1BA 4PVUA 4P6XA 4WHGA 2O4JA 5E19A 3KYTA 1U3QA 3L0LA 4P6WA 3FLIA 2NW4A 4DK8A 2ZK0A 4IA2A 3P0UA 5ETHA 5AVIA 4DQMA 2OUZA 1ILGA 4XAOA 5C4OA 1FM9A 1Y0XX 4OH5A 3VTDA 5KRJA 2Q6SA 2QZOB 4LNXA 2HC4A 4REFA 3OS8C 5IZ0A 3V9TA 3FALB 2VV3A 3UVVB 1ZUCA 4ZNHA 1TFCA 4B7WA 1UOMA 5G3JA 1PQCA 4PP5A 4OIVA 5EITA 2R40A 1T63A 2Q59B 5DZHA 5M96A 4NIEA 1ZDUA 1R1KA 4TUZA 1XJ7A 4JL4A 3BC5A 4PXMA 4RE8A 3CTBA 4OZRU 3VSOA 3D6DA 4IVYA 1Z95A 2QA6A 5KD9A 2Q3YA 2OVMA 3B0QA 1NYXA 4R06A 2J7YA 3FEIA 3F5CB 5DV3A 2ZKCA 5DV6A 3CJWA 3R8IA 2GPPA 4XT9A 4RZFA 4PRGA 1K4WA 1PQ9A 4G1YA 1Q4XA 3W5QA 4IS8A 4TV1B 3UUDA 1Z5XE 5AZTA 3TY0A 2E2RA 3ET2A 3V9VA 1G50A 3QT0A 3VHUA 3AUNA 2QNVA 4IU7A 1XV9A 5DKBA 2PIVA 2Q7KA 2PIRA 3RLJA 5DK9A 5KRHA 1EREA 5KCUA 4ZN9A 2PITA 1ZEOA 4OEAA 2AAXA 2A3IA 2AMAA 4OJ4A 1MZNA 4J26A 2Q5SA 2AX8A 2Q5PA 3LBDA 4IA7A 2P1VA 2HARA 4FGYA 1R6GA 1X7JA 4MGAA 5DKEA 2I0JA 4NUFA 1MV9A 4EMAA 4RAKA 1OSVA 1UHLA 1T76A 4IVWA 1YIMA 5DTVA 4E4QA 1DKFB 5KCFA 5DXEA 1VJBA 1I7IA 3KMZA 1OVLA 3OLSA 1L2JA 2GPOA 3DR1A 5DKSA 5G44A 3VT8A 3E00D 1FM6A 2LBDA 1NAXA 3B65A 5LGAA 2HVCA 3VJHA 3Q95A 1E3KA 1XNNA 1YINA 3FC6A 4N1YA 2JJ3A 4R6SA 5G46A 5JJMB 3R8AA 5AWKA 1RJKA 2W8YA 5DXKA 5DWEA 3OMOA 3P88A 1YMTA 1IE8A 3VRTA 1XIUA 4JYGA 3VRVA 2G44A 5DWJA 5KRAA 3UUDB 4MG8A 2O4RA 3KBAA 3O1EA 1PQ6A 1XV9B 5EHJA 2P15A 3W0HA 3G8IA 3S9SA 2HFPA 4J5XC 2ZK5A 4IUIA 4IWFA 4OFUA 2YLPA 3A78A 4ITFA 3L3ZA 4OKTA 3W5RA 1NQ1A 1LV2A 4UDBA 2ZY0A 2PJLA 1ZKYA 2QABA 1T7MA 4J5XA 2Q5GA 2VV0A 2P1UA 1X7RA 2ZL9A 3GZ9A 1Y0SA 4KZIA 4MGAB 4WHFA 3WWRA 3OLLA 2PIWA 1XQ3A 4LSJA 2QSEA 4K6IA 5FQTA 2NPAA 3UU7B 2H77A 3KMGA 1OVLB 3F7DA 3UP3A 2PKLA 3A2HA 3B0RA 5DV8A 3RVFA 3VSPA 4BCRA 4QL8A 3Q95B 3OZJA 3ADXA 1NQ0A 3FC6B 4ITEA 3FXVA 3OSAA 3D24A 3KMRA 4RZEA 5DU5A 5L11A 1G5YA 2NXXA 1T7FA 4J24A 5DSHA 1N83A 1GWRA 2ZK1A 3RUTA 2B50A 3VT7A 4MG8B 4X1GA 2AX7A 2PIXA 3FEJA 3T03A 2PIQA 1A28A 4G21A 2IOKA 3G8OA 1NUOA 3HC5A 2VSTA 4OEDA 4ZO1B 4YMQA 2AMBA 3OSWA 4LNWA 4OKWA 2VSRA 1M7WA 3GYUA 3OMMA 4PP3A 4FNEA 4WQPA 5DLRA 3W0AA 1OT7A 4IV2A 5C4UA 5KROA 4PPSA 3EYBA 1NDEA 5FQRA 5A86A 2AA2A 4G2HA 3HODA 2OZ7A 1HG4A 5DI7A 5L7HA 1S9QA 4CSJA 5JY3A 2QPYA 3H0AD 1T65A 5HZCA 3ADTA 3ZR7A 4CI5A 1XOWA 3PEQA 2Q7JA 4ZNSA 5KRIA 5DVSA 2Q7IA 4ZNWA 2O9IA 4RMCA 4ZN7A 2VV4B 5HYRA 2B1VA 3V49A 4JGVA 2OAXA 1IE9A 4OZTU 2OM9A 1QKMA 2QW4A 2VV1A 1S9PA 5DZ0A 4MDDA 4M8HA 5IAWA 3FUGA 2XYJA 2YLYA 1PDUA 2ZBSA 4QE8A 1NRLA 1QKTA 2G5OA 1EXAA 2BAWA 2GP7A 3ET0A 3OSIA 4A2JA 4Q50A 4Q0AC 4PF3A 3ILZA 3E94A 2ZXNA 4QK4A 2OVHA 1K74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R20 A;  2Q60 A;  1YOW A;  3H52 A;  5H1E A;  5HJP A;  2QA8 A;  2XYX A;  1XB7 A;  3HC6 A;  1DKF A;  1L2I A;  5DRM A;  4IW6 A;  5DXM A;  5C4T A;  5DX3 B;  4ZNT A;  3IXP A;  3TX7 B;  1RDT A;  1P93 A;  4OJB A;  4HEE X;  3ADV A;  1BSX A;  2NV7 A;  3D5F A;  3D90 A;  1EXX A;  3PO9 A;  5DWI A;  4CI4 A;  3UP0 A;  1UPV A;  4PLD A;  1NQ7 A;  3AZ1 A;  3A2I A;  4MGC A;  2FSZ A;  4YT1 A;  5DZI A;  3N00 A;  5E15 A;  3G9E A;  2J7X A;  4UDC A;  5GIC A;  1NQ2 A;  3W0J A;  3GD2 A;  4WVD A;  4MGD A;  4YPQ A;  3L03 A;  3HQ5 A;  5DYD A;  3B67 A;  1X78 A;  3SP6 A;  1PK5 A;  2AA5 A;  2HWQ A;  3ET3 A;  3B5R A;  3X1I A;  3JZC A;  1XPC A;  2ZVT A;  3WTQ A;  3R8D A;  2AA6 A;  3H0A A;  2B23 A;  2VV1 B;  5DMC A;  5HJS A;  2GWX A;  4EM9 A;  1S0X A;  4A4V A;  1GWX A;  2HB7 A;  2Q6R A;  1P8D A;  5L7E A;  5KCW A;  4KZJ A;  3DZY D;  2ZMI A;  1I37 A;  4E4K A;  2P7G A;  1S19 A;  2Z4B A;  1ILH A;  5AYG A;  2QXM A;  3WT6 A;  5CJ6 A;  4S0S A;  3SP9 A;  5HJP B;  2QA8 B;  3UU7 A;  3OLF A;  4OH6 A;  1XP9 A;  4R2U A;  4M8E A;  5E0W A;  3VN2 A;  3WFF A;  2HAS A;  3OKI A;  1H9U A;  2GPU A;  3OKH A;  2Q61 A;  5DXR A;  5DUE A;  3OS9 A;  5EGV A;  2HAM A;  5FQV A;  2IOG A;  4OIL A;  3ZQT A;  4MG7 A;  4DOS A;  3UUA A;  2QGT A;  2IHQ A;  2AX6 A;  4IA3 A;  4QE6 A;  4MGD B;  3G0W A;  3AUQ A;  3JZB A;  5DVV A;  3VRU A;  1YA3 A;  4MG6 A;  5DZ3 A;  1KKQ A;  1N46 A;  3PBA A;  5DVC A;  5AWJ A;  2PRG A;  2YFE A;  2AB2 A;  4G2I A;  4G1D A;  2Q6J A;  4L96 A;  5AAU A;  3VT9 A;  3VT5 A;  2ZFX A;  5KRK A;  2AWH A;  3HO0 A;  2BJ4 B;  4OKB A;  2GTK A;  1LBD A;  3DCT A;  3ZRA A;  1T7T A;  2G0H A;  3CDP A;  4UDD A;  3IPQ A;  1SR7 A;  4K4J A;  2JFA A;  3GWX A;  4XUH A;  2YJA B;  5KRF A;  4YNK A;  3RY9 A;  5E0X A;  5AAV A;  3VI8 A;  3HM1 A;  1YUC A;  3DZY A;  3P8X A;  4RUP A;  3AX8 A;  5E7V A;  2VV4 A;  4PWL A;  3B3K A;  4LBD A;  4OZT E;  4WPF A;  4DM8 A;  1WM0 X;  2R6Y A;  4OK1 A;  1XQC A;  2I4J A;  4ZOM A;  1U3S A;  4MG7 B;  3UUA B;  1KNU A;  3CS6 A;  1NAV A;  3ADW A;  3E00 A;  5KYA A;  2GPV A;  5AK2 A;  1PRG A;  5HYK A;  4PP6 A;  5DUH A;  3CLD A;  2ZLC A;  3DCU A;  4DOR A;  3OZ0 A;  2QR9 A;  5GT4 A;  2Q70 A;  3R29 A;  2QTU A;  3U9Q A;  3KDT A;  4Q13 A;  5GID A;  4JYH A;  1FM9 D;  1RKG A;  5DX3 A;  3B68 A;  3AZ2 A;  3P89 A;  4OZR E;  1TXI A;  2OCF A;  4XHD A;  2Q1V A;  2ZNQ A;  3R2A A;  3BQD A;  5KCE A;  2QE4 A;  2ZK6 A;  5G45 A;  1PZL A;  2POB A;  3HZF A;  2ZNP A;  2HBH A;  4RZG A;  3OMK A;  2JFA B;  4OLM A;  1XLS E;  1X7B A;  4G20 A;  3VJI A;  5KCT A;  1T5Z A;  3DY6 A;  1XZX X;  2R40 D;  4L98 A;  5AAV B;  3PCU A;  1XDK A;  4FN9 A;  2AYR A;  2QH6 A;  1R1K D;  3FUR A;  3B1M A;  5DP0 A;  2AO6 A;  5E14 A;  3O1D A;  4RMD A;  2I0G A;  5HCV A;  1U3R A;  3KDU A;  1T73 A;  3AUR A;  5EI1 A;  5EJV A;  5ACC A;  5DL4 A;  4RUJ A;  4KZM A;  4ZNV A;  4DM6 A;  4X1F A;  1FD0 A;  3MNO A;  5EC9 A;  1QKN A;  1QKU A;  1X76 A;  3R5N A;  4XI3 A;  4POJ A;  3K22 A;  3D57 A;  3L3X A;  4MGB A;  2ZK2 A;  4S15 A;  3FS1 A;  4JAZ A;  4N73 A;  5DID A;  2VV2 A;  2EWP A;  1N4H A;  1SQN A;  2Q7L A;  4S0T A;  4E2J A;  4J5W C;  3IA6 A;  3KWY A;  4OEZ A;  2V7C A;  3MNE A;  1E3G A;  3GYT A;  5KCC A;  4HLW A;  2YAT A;  4J5W A;  5E1C A;  3VT4 A;  3VTB A;  4O8F A;  1XP1 A;  3BEJ A;  4POH A;  3A9E A;  2YLO A;  5G42 A;  3ERD A;  2ZXZ A;  5DXG A;  3VHV A;  4DMA A;  1RKH A;  3CDS A;  4FHH A;  3X1H A;  4OFR A;  1YOK A;  4RME A;  2V0V A;  3AN4 A;  3NSP A;  3OOF A;  3W0C A;  5DYB A;  3VJT A;  2B1Z A;  3OMQ A;  5AVL A;  3AN3 A;  4JYI A;  1XDK B;  2REW A;  1ZDT A;  4PLE A;  4QJR A;  4ONI A;  3DT3 A;  1YJE A;  2ATH A;  3ET1 A;  1FM6 D;  3CS8 A;  1NHZ A;  3LMP A;  1T7R A;  4ZNU A;  3NOA A;  3R5M A;  4OAR A;  4Y29 A;  5DXB A;  3ERT A;  4ZJW A;  2GL8 A;  2ZK4 A;  3OS8 A;  1M13 A;  1KV6 A;  3DZU D;  5APH A;  1R5K A;  3KFC A;  3VRW A;  3UUC A;  4MGB B;  5DIE A;  4MG9 A;  2PNU A;  3WT7 A;  2XYW A;  2BJ4 A;  2FAI A;  3V3Q A;  2J4A A;  3VTC A;  3AFR A;  2AXA A;  1YP0 A;  4QM0 A;  3V9Y A;  5B5B A;  5APK A;  5LWP A;  1OSH A;  1ZAF A;  1SKX A;  2HCD A;  5KRL A;  3OMP A;  4PPP A;  2GIU A;  2ZMJ A;  3A9E B;  5B41 A;  5GIE A;  2ACL A;  3VHW A;  1S0Z A;  2ZXM A;  3ZRB A;  3PLZ A;  5KCD A;  1FCY A;  3W5T A;  1YY4 A;  2ZNO A;  3RUU A;  1T79 A;  4IA1 A;  3KPZ A;  3B0W A;  2ZK3 A;  1UPW A;  3CS4 A;  5AZV A;  5DWG A;  4NY9 A;  3DZU A;  4K7A A;  5DXP A;  2AX9 A;  5DXB B;  3A3Z X;  4IWC A;  1K7L A;  4G1Z A;  4NQA B;  3NSQ A;  2I4P A;  4N5G A;  2ZLA A;  4TUZ B;  3AZ3 A;  4MG9 B;  3V4A A;  2JF9 A;  3WJ4 A;  5DKG A;  1XP6 A;  3CWD A;  3VJS A;  3CQV A;  3MNP A;  3WJ5 A;  1HJ1 A;  2QXS A;  3GN8 A;  1GS4 A;  4XLD A;  4ZO1 X;  5K13 A;  5SYZ A;  5G43 A;  2P1T A;  2YHD A;  2PIO A;  3IMY A;  4IV4 A;  2AA7 A;  1FBY A;  3ADS A;  3X36 A;  5IXK A;  1X7E A;  5DXQ A;  1Z5X U;  1M2Z A;  2G0G A;  3OAP A;  3VT3 A;  5KRC A;  2XKW A;  2ACL B;  4S14 A;  1ZGY A;  3K8S A;  5DMF A;  5FQS A;  2FVJ A;  2PIP L;  1XAP A;  2QMV A;  4OJ9 A;  5DY8 A;  5APJ A;  5ICK A;  3OGT A;  3W0G A;  1T74 A;  4IW8 A;  4DK7 A;  2PIN A;  2POG A;  4OEY A;  3WMH A;  4XUM A;  5FQP A;  5L7G A;  4WLB A;  4OKX A;  5DZ1 A;  2ZAS A;  3OOK A;  3VT6 A;  3W5P A;  3GWS X;  1A52 A;  3HLV A;  4UDA A;  1GWQ A;  3TKC A;  1I38 A;  2R6W A;  2YLQ A;  2H79 A;  1UHL B;  3E7C A;  5DRJ A;  4OC7 A;  4RWV A;  2PIU A;  2P54 A;  4ZJR A;  1XVP A;  3V3E A;  3B66 A;  3TKM A;  1XLS A;  3IPU A;  3L0J A;  4LTW A;  4MG5 A;  5KRM A;  2Q1H A;  2Q8S A;  4RFW A;  5DIG A;  5JJM A;  4OGH A;  1PCG A;  1K74 D;  3K6P A;  1ERR A;  1R20 D;  1XNX A;  3L0E A;  4OIU A;  1DB1 A;  2F4B A;  3W0I A;  1Y9R A;  1MVC A;  3WGP A;  2YJD A;  1FCZ A;  3SZ1 A;  2QZO A;  2P7Z A;  2ZNN A;  2NXX E;  2I4Z A;  3IXP D;  1U9E A;  3FAL A;  1RDT D;  3K23 A;  4NB6 A;  4XTA A;  3UVV A;  5KR9 A;  3GBK A;  5KYJ A;  1ZH7 A;  2Z4J A;  3WFG A;  3W0Y A;  5JI0 D;  4A4W A;  5I4V A;  2Q59 A;  1G1U A;  5DWL A;  1RK3 A;  2XHS A;  3RLL A;  2QGW A;  1I7G A;  2P4Y A;  1YYE A;  2ZMH A;  3IPS A;  3M7R A;  3X31 A;  1SJ0 A;  1FCX A;  3A40 X;  5F9B A;  4APU A;  3WT5 A;  3F5C A;  2HB8 A;  4ZI1 A;  2HWR A;  4FHI A;  5G5W A;  2ABI A;  2AM9 A;  3ADU A;  2J14 A;  4REE A;  4RUO X;  5DUG A;  3PRG A;  1G2N A;  4OHA A;  3A2J A;  4TV1 A;  4F9M A;  3B0T A;  2P7A A;  3HVL A;  4IQR A;  1XVP B;  5C4S A;  4N8R A;  3L1B A;  4PVU A;  4P6X A;  4WHG A;  2O4J A;  5E19 A;  3KYT A;  1U3Q A;  3L0L A;  4P6W A;  3FLI A;  2NW4 A;  4DK8 A;  2ZK0 A;  4IA2 A;  3P0U A;  5ETH A;  5AVI A;  4DQM A;  2OUZ A;  1ILG A;  4XAO A;  5C4O A;  1FM9 A;  1Y0X X;  4OH5 A;  3VTD A;  5KRJ A;  2Q6S A;  2QZO B;  4LNX A;  2HC4 A;  4REF A;  3OS8 C;  5IZ0 A;  3V9T A;  3FAL B;  2VV3 A;  3UVV B;  1ZUC A;  4ZNH A;  1TFC A;  4B7W A;  1UOM A;  5G3J A;  1PQC A;  4PP5 A;  4OIV A;  5EIT A;  2R40 A;  1T63 A;  2Q59 B;  5DZH A;  5M96 A;  4NIE A;  1ZDU A;  1R1K A;  4TUZ A;  1XJ7 A;  4JL4 A;  3BC5 A;  4PXM A;  4RE8 A;  3CTB A;  4OZR U;  3VSO A;  3D6D A;  4IVY A;  1Z95 A;  2QA6 A;  5KD9 A;  2Q3Y A;  2OVM A;  3B0Q A;  1NYX A;  4R06 A;  2J7Y A;  3FEI A;  3F5C B;  5DV3 A;  2ZKC A;  5DV6 A;  3CJW A;  3R8I A;  2GPP A;  4XT9 A;  4RZF A;  4PRG A;  1K4W A;  1PQ9 A;  4G1Y A;  1Q4X A;  3W5Q A;  4IS8 A;  4TV1 B;  3UUD A;  1Z5X E;  5AZT A;  3TY0 A;  2E2R A;  3ET2 A;  3V9V A;  1G50 A;  3QT0 A;  3VHU A;  3AUN A;  2QNV A;  4IU7 A;  1XV9 A;  5DKB A;  2PIV A;  2Q7K A;  2PIR A;  3RLJ A;  5DK9 A;  5KRH A;  1ERE A;  5KCU A;  4ZN9 A;  2PIT A;  1ZEO A;  4OEA A;  2AAX A;  2A3I A;  2AMA A;  4OJ4 A;  1MZN A;  4J26 A;  2Q5S A;  2AX8 A;  2Q5P A;  3LBD A;  4IA7 A;  2P1V A;  2HAR A;  4FGY A;  1R6G A;  1X7J A;  4MGA A;  5DKE A;  2I0J A;  4NUF A;  1MV9 A;  4EMA A;  4RAK A;  1OSV A;  1UHL A;  1T76 A;  4IVW A;  1YIM A;  5DTV A;  4E4Q A;  1DKF B;  5KCF A;  5DXE A;  1VJB A;  1I7I A;  3KMZ A;  1OVL A;  3OLS A;  1L2J A;  2GPO A;  3DR1 A;  5DKS A;  5G44 A;  3VT8 A;  3E00 D;  1FM6 A;  2LBD A;  1NAX A;  3B65 A;  5LGA A;  2HVC A;  3VJH A;  3Q95 A;  1E3K A;  1XNN A;  1YIN A;  3FC6 A;  4N1Y A;  2JJ3 A;  4R6S A;  5G46 A;  5JJM B;  3R8A A;  5AWK A;  1RJK A;  2W8Y A;  5DXK A;  5DWE A;  3OMO A;  3P88 A;  1YMT A;  1IE8 A;  3VRT A;  1XIU A;  4JYG A;  3VRV A;  2G44 A;  5DWJ A;  5KRA A;  3UUD B;  4MG8 A;  2O4R A;  3KBA A;  3O1E A;  1PQ6 A;  1XV9 B;  5EHJ A;  2P15 A;  3W0H A;  3G8I A;  3S9S A;  2HFP A;  4J5X C;  2ZK5 A;  4IUI A;  4IWF A;  4OFU A;  2YLP A;  3A78 A;  4ITF A;  3L3Z A;  4OKT A;  3W5R A;  1NQ1 A;  1LV2 A;  4UDB A;  2ZY0 A;  2PJL A;  1ZKY A;  2QAB A;  1T7M A;  4J5X A;  2Q5G A;  2VV0 A;  2P1U A;  1X7R A;  2ZL9 A;  3GZ9 A;  1Y0S A;  4KZI A;  4MGA B;  4WHF A;  3WWR A;  3OLL A;  2PIW A;  1XQ3 A;  4LSJ A;  2QSE A;  4K6I A;  5FQT A;  2NPA A;  3UU7 B;  2H77 A;  3KMG A;  1OVL B;  3F7D A;  3UP3 A;  2PKL A;  3A2H A;  3B0R A;  5DV8 A;  3RVF A;  3VSP A;  4BCR A;  4QL8 A;  3Q95 B;  3OZJ A;  3ADX A;  1NQ0 A;  3FC6 B;  4ITE A;  3FXV A;  3OSA A;  3D24 A;  3KMR A;  4RZE A;  5DU5 A;  5L11 A;  1G5Y A;  2NXX A;  1T7F A;  4J24 A;  5DSH A;  1N83 A;  1GWR A;  2ZK1 A;  3RUT A;  2B50 A;  3VT7 A;  4MG8 B;  4X1G A;  2AX7 A;  2PIX A;  3FEJ A;  3T03 A;  2PIQ A;  1A28 A;  4G21 A;  2IOK A;  3G8O A;  1NUO A;  3HC5 A;  2VST A;  4OED A;  4ZO1 B;  4YMQ A;  2AMB A;  3OSW A;  4LNW A;  4OKW A;  2VSR A;  1M7W A;  3GYU A;  3OMM A;  4PP3 A;  4FNE A;  4WQP A;  5DLR A;  3W0A A;  1OT7 A;  4IV2 A;  5C4U A;  5KRO A;  4PPS A;  3EYB A;  1NDE A;  5FQR A;  5A86 A;  2AA2 A;  4G2H A;  3HOD A;  2OZ7 A;  1HG4 A;  5DI7 A;  5L7H A;  1S9Q A;  4CSJ A;  5JY3 A;  2QPY A;  3H0A D;  1T65 A;  5HZC A;  3ADT A;  3ZR7 A;  4CI5 A;  1XOW A;  3PEQ A;  2Q7J A;  4ZNS A;  5KRI A;  5DVS A;  2Q7I A;  4ZNW A;  2O9I A;  4RMC A;  4ZN7 A;  2VV4 B;  5HYR A;  2B1V A;  3V49 A;  4JGV A;  2OAX A;  1IE9 A;  4OZT U;  2OM9 A;  1QKM A;  2QW4 A;  2VV1 A;  1S9P A;  5DZ0 A;  4MDD A;  4M8H A;  5IAW A;  3FUG A;  2XYJ A;  2YLY A;  1PDU A;  2ZBS A;  4QE8 A;  1NRL A;  1QKT A;  2G5O A;  1EXA A;  2BAW A;  2GP7 A;  3ET0 A;  3OSI A;  4A2J A;  4Q50 A;  4Q0A C;  4PF3 A;  3ILZ A;  3E94 A;  2ZXN A;  4QK4 A;  2OVH A;  1K74 A; 
#chains in the Genus database with same CATH topology
 1R20 A;  2Q60 A;  1YOW A;  3H52 A;  5H1E A;  5HJP A;  2QA8 A;  2XYX A;  1XB7 A;  3HC6 A;  1DKF A;  1L2I A;  5DRM A;  4IW6 A;  5DXM A;  5C4T A;  5DX3 B;  4ZNT A;  3IXP A;  3TX7 B;  1RDT A;  1P93 A;  4OJB A;  4HEE X;  3ADV A;  1BSX A;  2NV7 A;  3D5F A;  3D90 A;  1EXX A;  3PO9 A;  5DWI A;  4CI4 A;  3UP0 A;  1UPV A;  4PLD A;  1NQ7 A;  3AZ1 A;  3A2I A;  4MGC A;  2FSZ A;  4YT1 A;  5DZI A;  3N00 A;  5E15 A;  3G9E A;  2J7X A;  4UDC A;  5GIC A;  1NQ2 A;  3W0J A;  3GD2 A;  4WVD A;  4MGD A;  4YPQ A;  3L03 A;  3HQ5 A;  5DYD A;  3B67 A;  1X78 A;  3SP6 A;  1PK5 A;  2AA5 A;  2HWQ A;  3ET3 A;  3B5R A;  3X1I A;  3JZC A;  1XPC A;  2ZVT A;  3WTQ A;  3R8D A;  2AA6 A;  3H0A A;  2B23 A;  2VV1 B;  5DMC A;  5HJS A;  2GWX A;  4EM9 A;  1S0X A;  4A4V A;  1GWX A;  2HB7 A;  2Q6R A;  1P8D A;  5L7E A;  5KCW A;  4KZJ A;  3DZY D;  2ZMI A;  1I37 A;  4E4K A;  2P7G A;  1S19 A;  2Z4B A;  1ILH A;  5AYG A;  2QXM A;  3WT6 A;  5CJ6 A;  4S0S A;  3SP9 A;  5HJP B;  2QA8 B;  3UU7 A;  3OLF A;  4OH6 A;  1XP9 A;  4R2U A;  4M8E A;  5E0W A;  3VN2 A;  3WFF A;  2HAS A;  3OKI A;  1H9U A;  2GPU A;  3OKH A;  2Q61 A;  5DXR A;  5DUE A;  3OS9 A;  5EGV A;  2HAM A;  5FQV A;  2IOG A;  4OIL A;  3ZQT A;  4MG7 A;  4DOS A;  3UUA A;  2QGT A;  2IHQ A;  2AX6 A;  4IA3 A;  4QE6 A;  4MGD B;  3G0W A;  3AUQ A;  3JZB A;  5DVV A;  3VRU A;  1YA3 A;  4MG6 A;  5DZ3 A;  1KKQ A;  1N46 A;  3PBA A;  5DVC A;  5AWJ A;  2PRG A;  2YFE A;  2AB2 A;  4G2I A;  4G1D A;  2Q6J A;  4L96 A;  5AAU A;  3VT9 A;  3VT5 A;  2ZFX A;  5KRK A;  2AWH A;  3HO0 A;  2BJ4 B;  4OKB A;  2GTK A;  1LBD A;  3DCT A;  3ZRA A;  1T7T A;  2G0H A;  3CDP A;  4UDD A;  3IPQ A;  1SR7 A;  4K4J A;  2JFA A;  3GWX A;  4XUH A;  2YJA B;  5KRF A;  4YNK A;  3RY9 A;  5E0X A;  5AAV A;  3VI8 A;  3HM1 A;  1YUC A;  3DZY A;  3P8X A;  4RUP A;  3AX8 A;  5E7V A;  2VV4 A;  4PWL A;  3B3K A;  4LBD A;  4OZT E;  4WPF A;  4DM8 A;  1WM0 X;  2R6Y A;  4OK1 A;  1XQC A;  2I4J A;  4ZOM A;  1U3S A;  4MG7 B;  3UUA B;  1KNU A;  3CS6 A;  1NAV A;  3ADW A;  3E00 A;  5KYA A;  2GPV A;  5AK2 A;  1PRG A;  5HYK A;  4PP6 A;  5DUH A;  3CLD A;  2ZLC A;  3DCU A;  4DOR A;  3OZ0 A;  2QR9 A;  5GT4 A;  2Q70 A;  3R29 A;  2QTU A;  3U9Q A;  3KDT A;  4Q13 A;  5GID A;  4JYH A;  1FM9 D;  1RKG A;  5DX3 A;  3B68 A;  3AZ2 A;  3P89 A;  4OZR E;  1TXI A;  2OCF A;  4XHD A;  2Q1V A;  2ZNQ A;  3R2A A;  3BQD A;  5KCE A;  2QE4 A;  2ZK6 A;  5G45 A;  1PZL A;  2POB A;  3HZF A;  2ZNP A;  2HBH A;  4RZG A;  3OMK A;  2JFA B;  4OLM A;  1XLS E;  1X7B A;  4G20 A;  3VJI A;  5KCT A;  1T5Z A;  3DY6 A;  1XZX X;  2R40 D;  4L98 A;  5AAV B;  3PCU A;  1XDK A;  4FN9 A;  2AYR A;  2QH6 A;  1R1K D;  3FUR A;  3B1M A;  5DP0 A;  2AO6 A;  5E14 A;  3O1D A;  4RMD A;  2I0G A;  5HCV A;  1U3R A;  3KDU A;  1T73 A;  3AUR A;  5EI1 A;  5EJV A;  5ACC A;  5DL4 A;  4RUJ A;  4KZM A;  4ZNV A;  4DM6 A;  4X1F A;  1FD0 A;  3MNO A;  5EC9 A;  1QKN A;  1QKU A;  1X76 A;  3R5N A;  4XI3 A;  4POJ A;  3K22 A;  3D57 A;  3L3X A;  4MGB A;  2ZK2 A;  4S15 A;  3FS1 A;  4JAZ A;  4N73 A;  5DID A;  2VV2 A;  2EWP A;  1N4H A;  1SQN A;  2Q7L A;  4S0T A;  4E2J A;  4J5W C;  3IA6 A;  3KWY A;  4OEZ A;  2V7C A;  3MNE A;  1E3G A;  3GYT A;  5KCC A;  4HLW A;  2YAT A;  4J5W A;  5E1C A;  3VT4 A;  3VTB A;  4O8F A;  1XP1 A;  3BEJ A;  4POH A;  3A9E A;  2YLO A;  5G42 A;  3ERD A;  2ZXZ A;  5DXG A;  3VHV A;  4DMA A;  1RKH A;  3CDS A;  4FHH A;  3X1H A;  4OFR A;  1YOK A;  4RME A;  2V0V A;  3AN4 A;  3NSP A;  3OOF A;  3W0C A;  5DYB A;  3VJT A;  2B1Z A;  3OMQ A;  5AVL A;  3AN3 A;  4JYI A;  1XDK B;  2REW A;  1ZDT A;  4PLE A;  4QJR A;  4ONI A;  3DT3 A;  1YJE A;  2ATH A;  3ET1 A;  1FM6 D;  3CS8 A;  1NHZ A;  3LMP A;  1T7R A;  4ZNU A;  3NOA A;  3R5M A;  4OAR A;  4Y29 A;  5DXB A;  3ERT A;  4ZJW A;  2GL8 A;  2ZK4 A;  3OS8 A;  1M13 A;  1KV6 A;  3DZU D;  5APH A;  1R5K A;  3KFC A;  3VRW A;  3UUC A;  4MGB B;  5DIE A;  4MG9 A;  2PNU A;  3WT7 A;  2XYW A;  2BJ4 A;  2FAI A;  3V3Q A;  2J4A A;  3VTC A;  3AFR A;  2AXA A;  1YP0 A;  4QM0 A;  3V9Y A;  5B5B A;  5APK A;  5LWP A;  1OSH A;  1ZAF A;  1SKX A;  2HCD A;  5KRL A;  3OMP A;  4PPP A;  2GIU A;  2ZMJ A;  3A9E B;  5B41 A;  5GIE A;  2ACL A;  3VHW A;  1S0Z A;  2ZXM A;  3ZRB A;  3PLZ A;  5KCD A;  1FCY A;  3W5T A;  1YY4 A;  2ZNO A;  3RUU A;  1T79 A;  4IA1 A;  3KPZ A;  3B0W A;  2ZK3 A;  1UPW A;  3CS4 A;  5AZV A;  5DWG A;  4NY9 A;  3DZU A;  4K7A A;  5DXP A;  2AX9 A;  5DXB B;  3A3Z X;  4IWC A;  1K7L A;  4G1Z A;  4NQA B;  3NSQ A;  2I4P A;  4N5G A;  2ZLA A;  4TUZ B;  3AZ3 A;  4MG9 B;  3V4A A;  2JF9 A;  3WJ4 A;  5DKG A;  1XP6 A;  3CWD A;  3VJS A;  3CQV A;  3MNP A;  3WJ5 A;  1HJ1 A;  2QXS A;  3GN8 A;  1GS4 A;  4XLD A;  4ZO1 X;  5K13 A;  5SYZ A;  5G43 A;  2P1T A;  2YHD A;  2PIO A;  3IMY A;  4IV4 A;  2AA7 A;  1FBY A;  3ADS A;  3X36 A;  5IXK A;  1X7E A;  5DXQ A;  1Z5X U;  1M2Z A;  2G0G A;  3OAP A;  3VT3 A;  5KRC A;  2XKW A;  2ACL B;  4S14 A;  1ZGY A;  3K8S A;  5DMF A;  5FQS A;  2FVJ A;  2PIP L;  1XAP A;  2QMV A;  4OJ9 A;  5DY8 A;  5APJ A;  5ICK A;  3OGT A;  3W0G A;  1T74 A;  4IW8 A;  4DK7 A;  2PIN A;  2POG A;  4OEY A;  3WMH A;  4XUM A;  5FQP A;  5L7G A;  4WLB A;  4OKX A;  5DZ1 A;  2ZAS A;  3OOK A;  3VT6 A;  3W5P A;  3GWS X;  1A52 A;  3HLV A;  4UDA A;  1GWQ A;  3TKC A;  1I38 A;  2R6W A;  2YLQ A;  2H79 A;  1UHL B;  3E7C A;  5DRJ A;  4OC7 A;  4RWV A;  2PIU A;  2P54 A;  4ZJR A;  1XVP A;  3V3E A;  3B66 A;  3TKM A;  1XLS A;  3IPU A;  3L0J A;  4LTW A;  4MG5 A;  5KRM A;  2Q1H A;  2Q8S A;  4RFW A;  5DIG A;  5JJM A;  4OGH A;  1PCG A;  1K74 D;  3K6P A;  1ERR A;  1R20 D;  1XNX A;  3L0E A;  4OIU A;  1DB1 A;  2F4B A;  3W0I A;  1Y9R A;  1MVC A;  3WGP A;  2YJD A;  1FCZ A;  3SZ1 A;  2QZO A;  2P7Z A;  2ZNN A;  2NXX E;  2I4Z A;  3IXP D;  1U9E A;  3FAL A;  1RDT D;  3K23 A;  4NB6 A;  4XTA A;  3UVV A;  5KR9 A;  3GBK A;  5KYJ A;  1ZH7 A;  2Z4J A;  3WFG A;  3W0Y A;  5JI0 D;  4A4W A;  5I4V A;  2Q59 A;  1G1U A;  5DWL A;  1RK3 A;  2XHS A;  3RLL A;  2QGW A;  1I7G A;  2P4Y A;  1YYE A;  2ZMH A;  3IPS A;  3M7R A;  3X31 A;  1SJ0 A;  1FCX A;  3A40 X;  5F9B A;  4APU A;  3WT5 A;  3F5C A;  2HB8 A;  4ZI1 A;  2HWR A;  4FHI A;  5G5W A;  2ABI A;  2AM9 A;  3ADU A;  2J14 A;  4REE A;  4RUO X;  5DUG A;  3PRG A;  1G2N A;  4OHA A;  3A2J A;  4TV1 A;  4F9M A;  3B0T A;  2P7A A;  3HVL A;  4IQR A;  1XVP B;  5C4S A;  4N8R A;  3L1B A;  4PVU A;  4P6X A;  4WHG A;  2O4J A;  5E19 A;  3KYT A;  1U3Q A;  3L0L A;  4P6W A;  3FLI A;  2NW4 A;  4DK8 A;  2ZK0 A;  4IA2 A;  3P0U A;  5ETH A;  5AVI A;  4DQM A;  2OUZ A;  1ILG A;  4XAO A;  5C4O A;  1FM9 A;  1Y0X X;  4OH5 A;  3VTD A;  5KRJ A;  2Q6S A;  2QZO B;  4LNX A;  2HC4 A;  4REF A;  3OS8 C;  5IZ0 A;  3V9T A;  3FAL B;  2VV3 A;  3UVV B;  1ZUC A;  4ZNH A;  1TFC A;  4B7W A;  1UOM A;  5G3J A;  1PQC A;  4PP5 A;  4OIV A;  5EIT A;  2R40 A;  1T63 A;  2Q59 B;  5DZH A;  5M96 A;  4NIE A;  1ZDU A;  1R1K A;  4TUZ A;  1XJ7 A;  4JL4 A;  3BC5 A;  4PXM A;  4RE8 A;  3CTB A;  4OZR U;  3VSO A;  3D6D A;  4IVY A;  1Z95 A;  2QA6 A;  5KD9 A;  2Q3Y A;  2OVM A;  3B0Q A;  1NYX A;  4R06 A;  2J7Y A;  3FEI A;  3F5C B;  5DV3 A;  2ZKC A;  5DV6 A;  3CJW A;  3R8I A;  2GPP A;  4XT9 A;  4RZF A;  4PRG A;  1K4W A;  1PQ9 A;  4G1Y A;  1Q4X A;  3W5Q A;  4IS8 A;  4TV1 B;  3UUD A;  1Z5X E;  5AZT A;  3TY0 A;  2E2R A;  3ET2 A;  3V9V A;  1G50 A;  3QT0 A;  3VHU A;  3AUN A;  2QNV A;  4IU7 A;  1XV9 A;  5DKB A;  2PIV A;  2Q7K A;  2PIR A;  3RLJ A;  5DK9 A;  5KRH A;  1ERE A;  5KCU A;  4ZN9 A;  2PIT A;  1ZEO A;  4OEA A;  2AAX A;  2A3I A;  2AMA A;  4OJ4 A;  1MZN A;  4J26 A;  2Q5S A;  2AX8 A;  2Q5P A;  3LBD A;  4IA7 A;  2P1V A;  2HAR A;  4FGY A;  1R6G A;  1X7J A;  4MGA A;  5DKE A;  2I0J A;  4NUF A;  1MV9 A;  4EMA A;  4RAK A;  1OSV A;  1UHL A;  1T76 A;  4IVW A;  1YIM A;  5DTV A;  4E4Q A;  1DKF B;  5KCF A;  5DXE A;  1VJB A;  1I7I A;  3KMZ A;  1OVL A;  3OLS A;  1L2J A;  2GPO A;  3DR1 A;  5DKS A;  5G44 A;  3VT8 A;  3E00 D;  1FM6 A;  2LBD A;  1NAX A;  3B65 A;  5LGA A;  2HVC A;  3VJH A;  3Q95 A;  1E3K A;  1XNN A;  1YIN A;  3FC6 A;  4N1Y A;  2JJ3 A;  4R6S A;  5G46 A;  5JJM B;  3R8A A;  5AWK A;  1RJK A;  2W8Y A;  5DXK A;  5DWE A;  3OMO A;  3P88 A;  1YMT A;  1IE8 A;  3VRT A;  1XIU A;  4JYG A;  3VRV A;  2G44 A;  5DWJ A;  5KRA A;  3UUD B;  4MG8 A;  2O4R A;  3KBA A;  3O1E A;  1PQ6 A;  1XV9 B;  5EHJ A;  2P15 A;  3W0H A;  3G8I A;  3S9S A;  2HFP A;  4J5X C;  2ZK5 A;  4IUI A;  4IWF A;  4OFU A;  2YLP A;  3A78 A;  4ITF A;  3L3Z A;  4OKT A;  3W5R A;  1NQ1 A;  1LV2 A;  4UDB A;  2ZY0 A;  2PJL A;  1ZKY A;  2QAB A;  1T7M A;  4J5X A;  2Q5G A;  2VV0 A;  2P1U A;  1X7R A;  2ZL9 A;  3GZ9 A;  1Y0S A;  4KZI A;  4MGA B;  4WHF A;  3WWR A;  3OLL A;  2PIW A;  1XQ3 A;  4LSJ A;  2QSE A;  4K6I A;  5FQT A;  2NPA A;  3UU7 B;  2H77 A;  3KMG A;  1OVL B;  3F7D A;  3UP3 A;  2PKL A;  3A2H A;  3B0R A;  5DV8 A;  3RVF A;  3VSP A;  4BCR A;  4QL8 A;  3Q95 B;  3OZJ A;  3ADX A;  1NQ0 A;  3FC6 B;  4ITE A;  3FXV A;  3OSA A;  3D24 A;  3KMR A;  4RZE A;  5DU5 A;  5L11 A;  1G5Y A;  2NXX A;  1T7F A;  4J24 A;  5DSH A;  1N83 A;  1GWR A;  2ZK1 A;  3RUT A;  2B50 A;  3VT7 A;  4MG8 B;  4X1G A;  2AX7 A;  2PIX A;  3FEJ A;  3T03 A;  2PIQ A;  1A28 A;  4G21 A;  2IOK A;  3G8O A;  1NUO A;  3HC5 A;  2VST A;  4OED A;  4ZO1 B;  4YMQ A;  2AMB A;  3OSW A;  4LNW A;  4OKW A;  2VSR A;  1M7W A;  3GYU A;  3OMM A;  4PP3 A;  4FNE A;  4WQP A;  5DLR A;  3W0A A;  1OT7 A;  4IV2 A;  5C4U A;  5KRO A;  4PPS A;  3EYB A;  1NDE A;  5FQR A;  5A86 A;  2AA2 A;  4G2H A;  3HOD A;  2OZ7 A;  1HG4 A;  5DI7 A;  5L7H A;  1S9Q A;  4CSJ A;  5JY3 A;  2QPY A;  3H0A D;  1T65 A;  5HZC A;  3ADT A;  3ZR7 A;  4CI5 A;  1XOW A;  3PEQ A;  2Q7J A;  4ZNS A;  5KRI A;  5DVS A;  2Q7I A;  4ZNW A;  2O9I A;  4RMC A;  4ZN7 A;  2VV4 B;  5HYR A;  2B1V A;  3V49 A;  4JGV A;  2OAX A;  1IE9 A;  4OZT U;  2OM9 A;  1QKM A;  2QW4 A;  2VV1 A;  1S9P A;  5DZ0 A;  4MDD A;  4M8H A;  5IAW A;  3FUG A;  2XYJ A;  2YLY A;  1PDU A;  2ZBS A;  4QE8 A;  1NRL A;  1QKT A;  2G5O A;  1EXA A;  2BAW A;  2GP7 A;  3ET0 A;  3OSI A;  4A2J A;  4Q50 A;  4Q0A C;  4PF3 A;  3ILZ A;  3E94 A;  2ZXN A;  4QK4 A;  2OVH A;  1K74 A; 
#chains in the Genus database with same CATH homology
 1R20 A;  2Q60 A;  1YOW A;  3H52 A;  5H1E A;  5HJP A;  2QA8 A;  2XYX A;  1XB7 A;  3HC6 A;  1DKF A;  1L2I A;  5DRM A;  4IW6 A;  5DXM A;  5C4T A;  5DX3 B;  4ZNT A;  3IXP A;  3TX7 B;  1RDT A;  1P93 A;  4OJB A;  4HEE X;  3ADV A;  1BSX A;  2NV7 A;  3D5F A;  3D90 A;  1EXX A;  3PO9 A;  5DWI A;  4CI4 A;  3UP0 A;  1UPV A;  4PLD A;  1NQ7 A;  3AZ1 A;  3A2I A;  4MGC A;  2FSZ A;  4YT1 A;  5DZI A;  3N00 A;  5E15 A;  3G9E A;  2J7X A;  4UDC A;  5GIC A;  1NQ2 A;  3W0J A;  3GD2 A;  4WVD A;  4MGD A;  4YPQ A;  3L03 A;  3HQ5 A;  5DYD A;  3B67 A;  1X78 A;  3SP6 A;  1PK5 A;  2AA5 A;  2HWQ A;  3ET3 A;  3B5R A;  3X1I A;  3JZC A;  1XPC A;  2ZVT A;  3WTQ A;  3R8D A;  2AA6 A;  3H0A A;  2B23 A;  2VV1 B;  5DMC A;  5HJS A;  2GWX A;  4EM9 A;  1S0X A;  4A4V A;  1GWX A;  2HB7 A;  2Q6R A;  1P8D A;  5L7E A;  5KCW A;  4KZJ A;  3DZY D;  2ZMI A;  1I37 A;  4E4K A;  2P7G A;  1S19 A;  2Z4B A;  1ILH A;  5AYG A;  2QXM A;  3WT6 A;  5CJ6 A;  4S0S A;  3SP9 A;  5HJP B;  2QA8 B;  3UU7 A;  3OLF A;  4OH6 A;  1XP9 A;  4R2U A;  4M8E A;  5E0W A;  3VN2 A;  3WFF A;  2HAS A;  3OKI A;  1H9U A;  2GPU A;  3OKH A;  2Q61 A;  5DXR A;  5DUE A;  3OS9 A;  5EGV A;  2HAM A;  5FQV A;  2IOG A;  4OIL A;  3ZQT A;  4MG7 A;  4DOS A;  3UUA A;  2QGT A;  2IHQ A;  2AX6 A;  4IA3 A;  4QE6 A;  4MGD B;  3G0W A;  3AUQ A;  3JZB A;  5DVV A;  3VRU A;  1YA3 A;  4MG6 A;  5DZ3 A;  1KKQ A;  1N46 A;  3PBA A;  5DVC A;  5AWJ A;  2PRG A;  2YFE A;  2AB2 A;  4G2I A;  4G1D A;  2Q6J A;  4L96 A;  5AAU A;  3VT9 A;  3VT5 A;  2ZFX A;  5KRK A;  2AWH A;  3HO0 A;  2BJ4 B;  4OKB A;  2GTK A;  1LBD A;  3DCT A;  3ZRA A;  1T7T A;  2G0H A;  3CDP A;  4UDD A;  3IPQ A;  1SR7 A;  4K4J A;  2JFA A;  3GWX A;  4XUH A;  2YJA B;  5KRF A;  4YNK A;  3RY9 A;  5E0X A;  5AAV A;  3VI8 A;  3HM1 A;  1YUC A;  3DZY A;  3P8X A;  4RUP A;  3AX8 A;  5E7V A;  2VV4 A;  4PWL A;  3B3K A;  4LBD A;  4OZT E;  4WPF A;  4DM8 A;  1WM0 X;  2R6Y A;  4OK1 A;  1XQC A;  2I4J A;  4ZOM A;  1U3S A;  4MG7 B;  3UUA B;  1KNU A;  3CS6 A;  1NAV A;  3ADW A;  3E00 A;  5KYA A;  2GPV A;  5AK2 A;  1PRG A;  5HYK A;  4PP6 A;  5DUH A;  3CLD A;  2ZLC A;  3DCU A;  4DOR A;  3OZ0 A;  2QR9 A;  5GT4 A;  2Q70 A;  3R29 A;  2QTU A;  3U9Q A;  3KDT A;  4Q13 A;  5GID A;  4JYH A;  1FM9 D;  1RKG A;  5DX3 A;  3B68 A;  3AZ2 A;  3P89 A;  4OZR E;  1TXI A;  2OCF A;  4XHD A;  2Q1V A;  2ZNQ A;  3R2A A;  3BQD A;  5KCE A;  2QE4 A;  2ZK6 A;  5G45 A;  1PZL A;  2POB A;  3HZF A;  2ZNP A;  2HBH A;  4RZG A;  3OMK A;  2JFA B;  4OLM A;  1XLS E;  1X7B A;  4G20 A;  3VJI A;  5KCT A;  1T5Z A;  3DY6 A;  1XZX X;  2R40 D;  4L98 A;  5AAV B;  3PCU A;  1XDK A;  4FN9 A;  2AYR A;  2QH6 A;  1R1K D;  3FUR A;  3B1M A;  5DP0 A;  2AO6 A;  5E14 A;  3O1D A;  4RMD A;  2I0G A;  5HCV A;  1U3R A;  3KDU A;  1T73 A;  3AUR A;  5EI1 A;  5EJV A;  5ACC A;  5DL4 A;  4RUJ A;  4KZM A;  4ZNV A;  4DM6 A;  4X1F A;  1FD0 A;  3MNO A;  5EC9 A;  1QKN A;  1QKU A;  1X76 A;  3R5N A;  4XI3 A;  4POJ A;  3K22 A;  3D57 A;  3L3X A;  4MGB A;  2ZK2 A;  4S15 A;  3FS1 A;  4JAZ A;  4N73 A;  5DID A;  2VV2 A;  2EWP A;  1N4H A;  1SQN A;  2Q7L A;  4S0T A;  4E2J A;  4J5W C;  3IA6 A;  3KWY A;  4OEZ A;  2V7C A;  3MNE A;  1E3G A;  3GYT A;  5KCC A;  4HLW A;  2YAT A;  4J5W A;  5E1C A;  3VT4 A;  3VTB A;  4O8F A;  1XP1 A;  3BEJ A;  4POH A;  3A9E A;  2YLO A;  5G42 A;  3ERD A;  2ZXZ A;  5DXG A;  3VHV A;  4DMA A;  1RKH A;  3CDS A;  4FHH A;  3X1H A;  4OFR A;  1YOK A;  4RME A;  2V0V A;  3AN4 A;  3NSP A;  3OOF A;  3W0C A;  5DYB A;  3VJT A;  2B1Z A;  3OMQ A;  5AVL A;  3AN3 A;  4JYI A;  1XDK B;  2REW A;  1ZDT A;  4PLE A;  4QJR A;  4ONI A;  3DT3 A;  1YJE A;  2ATH A;  3ET1 A;  1FM6 D;  3CS8 A;  1NHZ A;  3LMP A;  1T7R A;  4ZNU A;  3NOA A;  3R5M A;  4OAR A;  4Y29 A;  5DXB A;  3ERT A;  4ZJW A;  2GL8 A;  2ZK4 A;  3OS8 A;  1M13 A;  1KV6 A;  3DZU D;  5APH A;  1R5K A;  3KFC A;  3VRW A;  3UUC A;  4MGB B;  5DIE A;  4MG9 A;  2PNU A;  3WT7 A;  2XYW A;  2BJ4 A;  2FAI A;  3V3Q A;  2J4A A;  3VTC A;  3AFR A;  2AXA A;  1YP0 A;  4QM0 A;  3V9Y A;  5B5B A;  5APK A;  5LWP A;  1OSH A;  1ZAF A;  1SKX A;  2HCD A;  5KRL A;  3OMP A;  4PPP A;  2GIU A;  2ZMJ A;  3A9E B;  5B41 A;  5GIE A;  2ACL A;  3VHW A;  1S0Z A;  2ZXM A;  3ZRB A;  3PLZ A;  5KCD A;  1FCY A;  3W5T A;  1YY4 A;  2ZNO A;  3RUU A;  1T79 A;  4IA1 A;  3KPZ A;  3B0W A;  2ZK3 A;  1UPW A;  3CS4 A;  5AZV A;  5DWG A;  4NY9 A;  3DZU A;  4K7A A;  5DXP A;  2AX9 A;  5DXB B;  3A3Z X;  4IWC A;  1K7L A;  4G1Z A;  4NQA B;  3NSQ A;  2I4P A;  4N5G A;  2ZLA A;  4TUZ B;  3AZ3 A;  4MG9 B;  3V4A A;  2JF9 A;  3WJ4 A;  5DKG A;  1XP6 A;  3CWD A;  3VJS A;  3CQV A;  3MNP A;  3WJ5 A;  1HJ1 A;  2QXS A;  3GN8 A;  1GS4 A;  4XLD A;  4ZO1 X;  5K13 A;  5SYZ A;  5G43 A;  2P1T A;  2YHD A;  2PIO A;  3IMY A;  4IV4 A;  2AA7 A;  1FBY A;  3ADS A;  3X36 A;  5IXK A;  1X7E A;  5DXQ A;  1Z5X U;  1M2Z A;  2G0G A;  3OAP A;  3VT3 A;  5KRC A;  2XKW A;  2ACL B;  4S14 A;  1ZGY A;  3K8S A;  5DMF A;  5FQS A;  2FVJ A;  2PIP L;  1XAP A;  2QMV A;  4OJ9 A;  5DY8 A;  5APJ A;  5ICK A;  3OGT A;  3W0G A;  1T74 A;  4IW8 A;  4DK7 A;  2PIN A;  2POG A;  4OEY A;  3WMH A;  4XUM A;  5FQP A;  5L7G A;  4WLB A;  4OKX A;  5DZ1 A;  2ZAS A;  3OOK A;  3VT6 A;  3W5P A;  3GWS X;  1A52 A;  3HLV A;  4UDA A;  1GWQ A;  3TKC A;  1I38 A;  2R6W A;  2YLQ A;  2H79 A;  1UHL B;  3E7C A;  5DRJ A;  4OC7 A;  4RWV A;  2PIU A;  2P54 A;  4ZJR A;  1XVP A;  3V3E A;  3B66 A;  3TKM A;  1XLS A;  3IPU A;  3L0J A;  4LTW A;  4MG5 A;  5KRM A;  2Q1H A;  2Q8S A;  4RFW A;  5DIG A;  5JJM A;  4OGH A;  1PCG A;  1K74 D;  3K6P A;  1ERR A;  1R20 D;  1XNX A;  3L0E A;  4OIU A;  1DB1 A;  2F4B A;  3W0I A;  1Y9R A;  1MVC A;  3WGP A;  2YJD A;  1FCZ A;  3SZ1 A;  2QZO A;  2P7Z A;  2ZNN A;  2NXX E;  2I4Z A;  3IXP D;  1U9E A;  3FAL A;  1RDT D;  3K23 A;  4NB6 A;  4XTA A;  3UVV A;  5KR9 A;  3GBK A;  5KYJ A;  1ZH7 A;  2Z4J A;  3WFG A;  3W0Y A;  5JI0 D;  4A4W A;  5I4V A;  2Q59 A;  1G1U A;  5DWL A;  1RK3 A;  2XHS A;  3RLL A;  2QGW A;  1I7G A;  2P4Y A;  1YYE A;  2ZMH A;  3IPS A;  3M7R A;  3X31 A;  1SJ0 A;  1FCX A;  3A40 X;  5F9B A;  4APU A;  3WT5 A;  3F5C A;  2HB8 A;  4ZI1 A;  2HWR A;  4FHI A;  5G5W A;  2ABI A;  2AM9 A;  3ADU A;  2J14 A;  4REE A;  4RUO X;  5DUG A;  3PRG A;  1G2N A;  4OHA A;  3A2J A;  4TV1 A;  4F9M A;  3B0T A;  2P7A A;  3HVL A;  4IQR A;  1XVP B;  5C4S A;  4N8R A;  3L1B A;  4PVU A;  4P6X A;  4WHG A;  2O4J A;  5E19 A;  3KYT A;  1U3Q A;  3L0L A;  4P6W A;  3FLI A;  2NW4 A;  4DK8 A;  2ZK0 A;  4IA2 A;  3P0U A;  5ETH A;  5AVI A;  4DQM A;  2OUZ A;  1ILG A;  4XAO A;  5C4O A;  1FM9 A;  1Y0X X;  4OH5 A;  3VTD A;  5KRJ A;  2Q6S A;  2QZO B;  4LNX A;  2HC4 A;  4REF A;  3OS8 C;  5IZ0 A;  3V9T A;  3FAL B;  2VV3 A;  3UVV B;  1ZUC A;  4ZNH A;  1TFC A;  4B7W A;  1UOM A;  5G3J A;  1PQC A;  4PP5 A;  4OIV A;  5EIT A;  2R40 A;  1T63 A;  2Q59 B;  5DZH A;  5M96 A;  4NIE A;  1ZDU A;  1R1K A;  4TUZ A;  1XJ7 A;  4JL4 A;  3BC5 A;  4PXM A;  4RE8 A;  3CTB A;  4OZR U;  3VSO A;  3D6D A;  4IVY A;  1Z95 A;  2QA6 A;  5KD9 A;  2Q3Y A;  2OVM A;  3B0Q A;  1NYX A;  4R06 A;  2J7Y A;  3FEI A;  3F5C B;  5DV3 A;  2ZKC A;  5DV6 A;  3CJW A;  3R8I A;  2GPP A;  4XT9 A;  4RZF A;  4PRG A;  1K4W A;  1PQ9 A;  4G1Y A;  1Q4X A;  3W5Q A;  4IS8 A;  4TV1 B;  3UUD A;  1Z5X E;  5AZT A;  3TY0 A;  2E2R A;  3ET2 A;  3V9V A;  1G50 A;  3QT0 A;  3VHU A;  3AUN A;  2QNV A;  4IU7 A;  1XV9 A;  5DKB A;  2PIV A;  2Q7K A;  2PIR A;  3RLJ A;  5DK9 A;  5KRH A;  1ERE A;  5KCU A;  4ZN9 A;  2PIT A;  1ZEO A;  4OEA A;  2AAX A;  2A3I A;  2AMA A;  4OJ4 A;  1MZN A;  4J26 A;  2Q5S A;  2AX8 A;  2Q5P A;  3LBD A;  4IA7 A;  2P1V A;  2HAR A;  4FGY A;  1R6G A;  1X7J A;  4MGA A;  5DKE A;  2I0J A;  4NUF A;  1MV9 A;  4EMA A;  4RAK A;  1OSV A;  1UHL A;  1T76 A;  4IVW A;  1YIM A;  5DTV A;  4E4Q A;  1DKF B;  5KCF A;  5DXE A;  1VJB A;  1I7I A;  3KMZ A;  1OVL A;  3OLS A;  1L2J A;  2GPO A;  3DR1 A;  5DKS A;  5G44 A;  3VT8 A;  3E00 D;  1FM6 A;  2LBD A;  1NAX A;  3B65 A;  5LGA A;  2HVC A;  3VJH A;  3Q95 A;  1E3K A;  1XNN A;  1YIN A;  3FC6 A;  4N1Y A;  2JJ3 A;  4R6S A;  5G46 A;  5JJM B;  3R8A A;  5AWK A;  1RJK A;  2W8Y A;  5DXK A;  5DWE A;  3OMO A;  3P88 A;  1YMT A;  1IE8 A;  3VRT A;  1XIU A;  4JYG A;  3VRV A;  2G44 A;  5DWJ A;  5KRA A;  3UUD B;  4MG8 A;  2O4R A;  3KBA A;  3O1E A;  1PQ6 A;  1XV9 B;  5EHJ A;  2P15 A;  3W0H A;  3G8I A;  3S9S A;  2HFP A;  4J5X C;  2ZK5 A;  4IUI A;  4IWF A;  4OFU A;  2YLP A;  3A78 A;  4ITF A;  3L3Z A;  4OKT A;  3W5R A;  1NQ1 A;  1LV2 A;  4UDB A;  2ZY0 A;  2PJL A;  1ZKY A;  2QAB A;  1T7M A;  4J5X A;  2Q5G A;  2VV0 A;  2P1U A;  1X7R A;  2ZL9 A;  3GZ9 A;  1Y0S A;  4KZI A;  4MGA B;  4WHF A;  3WWR A;  3OLL A;  2PIW A;  1XQ3 A;  4LSJ A;  2QSE A;  4K6I A;  5FQT A;  2NPA A;  3UU7 B;  2H77 A;  3KMG A;  1OVL B;  3F7D A;  3UP3 A;  2PKL A;  3A2H A;  3B0R A;  5DV8 A;  3RVF A;  3VSP A;  4BCR A;  4QL8 A;  3Q95 B;  3OZJ A;  3ADX A;  1NQ0 A;  3FC6 B;  4ITE A;  3FXV A;  3OSA A;  3D24 A;  3KMR A;  4RZE A;  5DU5 A;  5L11 A;  1G5Y A;  2NXX A;  1T7F A;  4J24 A;  5DSH A;  1N83 A;  1GWR A;  2ZK1 A;  3RUT A;  2B50 A;  3VT7 A;  4MG8 B;  4X1G A;  2AX7 A;  2PIX A;  3FEJ A;  3T03 A;  2PIQ A;  1A28 A;  4G21 A;  2IOK A;  3G8O A;  1NUO A;  3HC5 A;  2VST A;  4OED A;  4ZO1 B;  4YMQ A;  2AMB A;  3OSW A;  4LNW A;  4OKW A;  2VSR A;  1M7W A;  3GYU A;  3OMM A;  4PP3 A;  4FNE A;  4WQP A;  5DLR A;  3W0A A;  1OT7 A;  4IV2 A;  5C4U A;  5KRO A;  4PPS A;  3EYB A;  1NDE A;  5FQR A;  5A86 A;  2AA2 A;  4G2H A;  3HOD A;  2OZ7 A;  1HG4 A;  5DI7 A;  5L7H A;  1S9Q A;  4CSJ A;  5JY3 A;  2QPY A;  3H0A D;  1T65 A;  5HZC A;  3ADT A;  3ZR7 A;  4CI5 A;  1XOW A;  3PEQ A;  2Q7J A;  4ZNS A;  5KRI A;  5DVS A;  2Q7I A;  4ZNW A;  2O9I A;  4RMC A;  4ZN7 A;  2VV4 B;  5HYR A;  2B1V A;  3V49 A;  4JGV A;  2OAX A;  1IE9 A;  4OZT U;  2OM9 A;  1QKM A;  2QW4 A;  2VV1 A;  1S9P A;  5DZ0 A;  4MDD A;  4M8H A;  5IAW A;  3FUG A;  2XYJ A;  2YLY A;  1PDU A;  2ZBS A;  4QE8 A;  1NRL A;  1QKT A;  2G5O A;  1EXA A;  2BAW A;  2GP7 A;  3ET0 A;  3OSI A;  4A2J A;  4Q50 A;  4Q0A C;  4PF3 A;  3ILZ A;  3E94 A;  2ZXN A;  4QK4 A;  2OVH A;  1K74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...