4OARA

Progesterone receptor with bound ulipristal acetate and a peptide from the co-repressor smrt
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
250
structure length
241
Chain Sequence
QLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRMSEVIAAQLPKILAGMVKPLLFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular determinants of the recognition of ulipristal acetate by oxo-steroid receptors.
pubmed doi rcsb
molecule keywords Progesterone receptor
molecule tags Transcription/peptide
source organism Homo sapiens
total genus 94
structure length 241
sequence length 250
ec nomenclature
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4oarA00
3ERTA 4N1YA 5LWPA 5DZ0A 5KRHA 3CDPA 1ZEOA 3ADSA 2ZNNA 4OJBA 5AVLA 4WPFA 3BC5A 4WQPA 5E1CA 1U3SA 4HLWA 4ZJWA 1XLSE 2Z4BA 4OZTU 3U9QA 5G3JA 1Z5XU 4MGDA 3RUTA 3W0CA 2OAXA 3GWXA 2J7YA 3KBAA 3WT7A 5KCEA 2GPVA 1XJ7A 2I4PA 3UVVA 3R8IA 4J5WA 3H0AA 4IW8A 3UP3A 3UUDB 2FAIA 3FALA 3V3QA 4FGYA 3X31A 3FLIA 4IA2A 4ITFA 4RMCA 1NQ1A 5DV8A 4G2HA 2HFPA 3DZYD 3MNPA 4S14A 1QKUA 2H79A 2OVMA 3X1HA 4A4WA 3FURA 3HVLA 3P8XA 3W0HA 5GICA 1NQ7A 5EC9A 3SZ1A 1T79A 3UUAA 5KRCA 1ZAFA 1U3RA 1XOWA 3KMGA 5I4VA 1FM6D 2FVJA 2Q1HA 4ITEA 3VN2A 3VJSA 1T65A 3IA6A 4K4JA 3GN8A 3WMHA 5DI7A 2F4BA 3KDTA 1XAPA 1RDTA 3IXPD 1XPCA 4QJRA 2GWXA 3ILZA 3UU7A 2B23A 2NW4A 4P6WA 3V3EA 4ZOMA 4QE6A 5DMCA 5E19A 3VSOA 2PINA 1G2NA 5E0XA 4MG8A 4MG7A 2B50A 3NSPA 1T7TA 1NDEA 4IA3A 4TV1B 3WGPA 2HB8A 3ADXA 3HODA 1UPWA 2XHSA 1XQCA 3B0TA 2VSTA 3M7RA 5JY3A 5IXKA 2ZK0A 3IPSA 1VJBA 2V7CA 4QL8A 5DWJA 5G44A 5KCUA 5G42A 5LGAA 1QKMA 5A86A 3W5PA 1OSHA 1XP6A 2HASA 1EREA 3AN3A 4OFRA 1T63A 4G1ZA 3TKMA 5KRIA 1X7EA 4L98A 2QZOA 3OKHA 3CDSA 4ZJRA 2Q5SA 1K4WA 3X1IA 2HBHA 3AZ2A 4XAOA 1KKQA 3O1DA 1DKFA 3GYUA 4OLMA 2GPUA 2QW4A 4REFA 3R8AA 3ZR7A 4PPPA 2QXSA 2HB7A 4OEDA 4DK7A 3AZ3A 3DZUA 1L2IA 2PIRA 3B68A 1WM0X 3RY9A 3R2AA 4PP3A 2GP7A 3FS1A 1QKTA 2PIXA 5L7EA 2GL8A 5FQRA 2JJ3A 3B66A 5AWKA 1QKNA 3OSWA 4IUIA 4OEZA 4PP6A 4Q0AC 3OKIA 3JZCA 5DRMA 4PLDA 2ZVTA 1N4HA 4OC7A 1T73A 4PWLA 1MV9A 5DXEA 2YLOA 2B1ZA 1PRGA 3OMKA 4J26A 4DK8A 5AYGA 2G44A 4YNKA 4J5WC 5KCDA 1ZDUA 3CS8A 4OGHA 1TFCA 4JYGA 3OAPA 2XYWA 1YYEA 1U9EA 2Q70A 5DUEA 4DM6A 2ZXNA 2Q7JA 4A2JA 1NAXA 5L7HA 1I37A 2OCFA 2PJLA 2Q5GA 2ZY0A 5DLRA 4G21A 1L2JA 3DCUA 5G43A 3RLLA 5ACCA 2OVHA 4ZI1A 3CJWA 3CS6A 1OVLA 2EWPA 2P4YA 4OZTE 3VT8A 2ZMIA 4MGAA 4ONIA 1Z5XE 3RLJA 4TUZB 4O8FA 1R1KD 1R20A 5DTVA 3MNEA 3OS8A 3OZJA 3E00D 3AFRA 4MGCA 4RZGA 2XYXA 3EYBA 3O1EA 2ZNQA 3A9EB 4CSJA 5EJVA 3VHWA 4APUA 1E3GA 1XQ3A 3CLDA 3OS9A 1K74D 5DMFA 3W0YA 1YOKA 2YLPA 4ZNSA 2E2RA 1IE9A 4B7WA 4OARA 1Q4XA 4RZFA 3VRWA 2QA8B 1ILHA 1N46A 4OKTA 5DWLA 5C4SA 3OLSA 4RE8A 3WJ5A 4FNEA 3OMQA 2ZLCA 1ERRA 4R6SA 2Z4JA 4R06A 5FQTA 4POJA 4OEYA 5JI0D 1OSVA 4FHHA 4IVYA 2I4JA 2Q7IA 2P1UA 2A3IA 3SP9A 2V0VA 5DUGA 1X7RA 2QABA 1T7MA 2VV4A 4UDBA 5KRFA 4K6IA 3JZBA 3DY6A 2J14A 2BJ4A 2I0JA 3GWSX 4DOSA 5HJPA 1LV2A 5GIEA 2Q59A 5B5BA 1YMTA 1FM9A 4WLBA 2G5OA 2ZXMA 4ZNTA 2BAWA 5DXGA 5DIGA 5AVIA 2HWRA 3G0WA 4J24A 5DV3A 5AZTA 2YHDA 3N00A 1XVPB 3V4AA 4J5XA 5DWIA 1BSXA 4DM8A 5DZ1A 4NIEA 5DKSA 5DP0A 1RJKA 3ET2A 1NAVA 4JYIA 4DORA 3F7DA 5JJMB 2YJDA 5KCTA 4ZNWA 3PBAA 3KDUA 1YY4A 3W5QA 1YIMA 2ZFXA 5KRAA 1FM6A 2Q7KA 2QXMA 2AA6A 1YJEA 3E7CA 3GBKA 2P7AA 2GPPA 1XDKA 3ET3A 3IMYA 3K22A 3PO9A 4IU7A 5DXBA 5AAVB 1YP0A 2JF9A 2JFAB 5KYJA 3CS4A 4N8RA 3AUNA 4LNWA 3L03A 1ZH7A 3Q95A 4LNXA 1S9QA 1ZDTA 1PDUA 1FBYA 3AURA 3W0GA 4ZN7A 3H0AD 5KRLA 4L96A 5EGVA 2QSEA 4K7AA 5DU5A 5C4UA 1TXIA 3L3XA 3VHVA 2QGTA 4KZMA 5DZHA 4RFWA 2XYJA 3L3ZA 1XV9B 2Q6RA 1NHZA 3R5MA 3VT4A 4EM9A 3VRVA 4FHIA 2NXXE 1H9UA 1M7WA 2Q60A 3AN4A 3AZ1A 3W5TA 5L7GA 2ZMJA 3OS8C 5DXRA 3CWDA 2AYRA 2R6YA 3K23A 2AWHA 4RUOX 1X76A 2VSRA 2VV1B 4WHGA 3W0IA 2AX7A 5FQVA 1GWXA 2AX9A 3HLVA 4Q50A 3MNOA 3HZFA 4XHDA 4XUMA 1GWQA 3S9SA 5E0WA 4N73A 3UUDA 1P8DA 3D90A 4MG5A 4A4VA 3ADTA 3FC6B 3ADVA 3F5CB 3L0EA 4JAZA 2R40A 4MG9B 1PQ6A 4OIVA 2NPAA 2YFEA 4OJ9A 4IA1A 4QE8A 2OM9A 1EXXA 1T7FA 2ZXZA 5L11A 3T03A 1EXAA 3PLZA 2Q5PA 3UUCA 3VJTA 1Z95A 4LSJA 3ADWA 5DVSA 5KD9A 3R29A 4QK4A 4MDDA 2P54A 5DWGA 1Y0XX 3KMRA 1UHLB 4RWVA 1FCZA 3HM1A 1LBDA 2P1VA 4IA7A 4MGBB 3W0JA 5DSHA 3GZ9A 4J5XC 1M13A 2ACLB 4OFUA 4OKBA 4UDAA 5ICKA 3TX7B 3DZUD 1NQ2A 1NRLA 1RKHA 4TV1A 4S0SA 2QTUA 2Q61A 2HCDA 3LBDA 3H52A 5H1EA 4OKXA 5DXMA 4NUFA 4RZEA 3HC5A 4PXMA 2P15A 2POBA 2ZK5A 5GIDA 4Q13A 3A2IA 4MGDB 2HARA 2AX6A 3X36A 5FQSA 4G2IA 1I7IA 4PP5A 4NY9A 4IS8A 5DVVA 3RUUA 4EMAA 1K74A 3R5NA 3L1BA 4OKWA 5GT4A 3UVVB 3V9TA 1T5ZA 4YT1A 2IHQA 4S15A 1XIUA 5KRKA 3FALB 2AA5A 2ZKCA 5SYZA 1X7JA 5HZCA 1T74A 3ZRAA 2OUZA 4ZO1B 3G9EA 3ET0A 2QA6A 5APHA 4KZJA 1N83A 2ZBSA 4OK1A 4DMAA 1ZGYA 3B5RA 5KCCA 2FSZA 3CTBA 4PPSA 5DKGA 3UUAB 2ZNOA 2VV3A 1U3QA 4QM0A 4XUHA 1YOWA 2O4JA 3WT5A 4OH6A 3P88A 1R20D 2ZASA 4UDCA 1FCYA 1X78A 2AO6A 5G46A 3V49A 3OSIA 1I7GA 4OJ4A 3UU7B 5DUHA 3OLFA 4IWFA 4OH5A 2ZLAA 1RKGA 3OMPA 5DXKA 1HG4A 3D24A 4MG8B 4MG7B 1MZNA 2IOGA 4MG6A 2J7XA 1NQ0A 1P93A 4OZRU 2XKWA 3VT7A 1XP9A 2NV7A 3DCTA 3NSQA 1XNNA 2QMVA 5DVCA 5DX3B 3VT5A 1UPVA 3DZYA 3PRGA 5DKBA 5E7VA 5AK2A 3VRTA 1XB7A 5APKA 1DB1A 3LMPA 2AMBA 1SJ0A 3AX8A 1I38A 3GD2A 5F9BA 5DXQA 1SKXA 2P7GA 1ZUCA 2G0HA 3K6PA 4TUZA 4WVDA 2P1TA 2QZOB 1NYXA 2Q6JA 3W5RA 3KWYA 1XP1A 2AAXA 1PCGA 2ABIA 4XTAA 2LBDA 2NXXA 1GS4A 3IXPA 3VI8A 5DYDA 4RMEA 3A9EA 3A40X 1GWRA 1DKFB 1T76A 5KRMA 2QPYA 1FM9D 4XI3A 2O9IA 5DL4A 3FUGA 3WFGA 2ZK3A 4NB6A 2REWA 5E14A 5DIEA 1G1UA 5DV6A 3V9YA 3OLLA 2YLQA 1G50A 3VTDA 3WTQA 2QA8A 2PIQA 3B67A 4IV4A 2YATA 4ZNUA 4PVUA 3WT6A 1T7RA 3KMZA 3AUQA 2PIWA 3NOAA 5DZIA 4IV2A 5AWJA 4RUJA 1SR7A 5FQPA 2AA2A 2Q7LA 3DT3A 5DWEA 3ADUA 2P7ZA 2YLYA 1NUOA 3VTBA 2HAMA 2QNVA 3PCUA 1S9PA 3WWRA 5DY8A 4XLDA 3FEJA 1A52A 3HQ5A 5E15A 1PQCA 3HC6A 2HWQA 1HJ1A 1RDTD 3B0RA 1IE8A 4Y29A 3VT9A 5DXPA 2H77A 1R5KA 3KPZA 3OOKA 3P89A 2AM9A 3A2HA 4LBDA 2PIVA 5EITA 5HJSA 3OZ0A 3VRUA 1XVPA 1KV6A 2GTKA 3RVFA 4XT9A 3VT3A 5ETHA 2G0GA 3OSAA 5DX3A 5C4OA 2ZK1A 2Q6SA 4JL4A 5KRJA 1ILGA 1G5YA 3P0UA 5DIDA 1YA3A 2HC4A 2I4ZA 1OVLB 3B65A 1PQ9A 3A3ZX 4MGAB 5JJMA 4NQAB 3VSPA 4JYHA 2ZL9A 2PKLA 1KNUA 4YMQA 2QGWA 2I0GA 4PRGA 3FXVA 5DRJA 5AAUA 5DKEA 2O4RA 3ET1A 3B3KA 3B0WA 4ZNVA 1S0ZA 3CQVA 3V9VA 5G45A 1Y0SA 3B1MA 3HO0A 4OIUA 5AAVA 3VHUA 2AX8A 3D6DA 3OMOA 3KFCA 2JFAA 4UDDA 4IVWA 2ZK6A 4OILA 4DQMA 4ZO1X 2PIUA 4E2JA 5M96A 1MVCA 3ERDA 4G1YA 3DR1A 4HEEX 2Q1VA 2R40D 4IW6A 2R6WA 3VJIA 1A28A 2POGA 2AMAA 3WJ4A 1XV9A 4X1GA 3VJHA 3VTCA 3TY0A 3WFFA 3G8IA 5HCVA 4RAKA 3R8DA 3D5FA 2VV4B 1K7LA 4E4KA 1R1KA 1E3KA 2ZK4A 2W8YA 2BJ4B 1UOMA 5APJA 5HJPB 2ZK2A 2ZMHA 3E00A 1SQNA 1M2ZA 4JGVA 3KYTA 5IAWA 3E94A 3GYTA 1FD0A 2Q59B 3BEJA 4RMDA 4PLEA 4R2UA 2PNUA 4BCRA 2PRGA 2Q3YA 2VV1A 2ATHA 2J4AA 2AXAA 2YJAB 1X7BA 2VV2A 3OMMA 2PIPL 3PEQA 4OZRE 4ZN9A 3IPQA 5C4TA 4M8HA 5HYRA 2QE4A 4LTWA 1RK3A 5KYAA 1R6GA 4ZNHA 1S0XA 1Y9RA 5KCFA 5KROA 1XNXA 3G8OA 3L0LA 3FC6A 3D57A 4CI4A 3F5CA 4IQRA 1YINA 3B0QA 4MG9A 1OT7A 2PITA 5G5WA 3QT0A 4KZIA 2HVCA 4POHA 4P6XA 5EI1A 5HYKA 1PZLA 5DK9A 2AA7A 5EHJA 1XDKB 4FN9A 4REEA 5DXBB 3VT6A 2OZ7A 3K8SA 2AB2A 4OEAA 3W0AA 4E4QA 1S19A 3UP0A 2QH6A 2GPOA 1XZXX 2QR9A 4IWCA 4OHAA 4CI5A 5K13A 5CJ6A 5DYBA 1XLSA 3A2JA 3Q95B 3TKCA 1UHLA 5KR9A 4PF3A 2GIUA 4WHFA 4X1FA 3L0JA 1YUCA 3OOFA 5B41A 2Q8SA 1PK5A 1ZKYA 2IOKA 4MGBA 4M8EA 3FEIA 3OGTA 3ZQTA 3ZRBA 4G20A 3IPUA 4F9MA 5DZ3A 2VV0A 2ACLA 4S0TA 2B1VA 4RUPA 3BQDA 3SP6A 5KCWA 4N5GA 5IZ0A 1FCXA 3A78A 4YPQA 4G1DA 2ZNPA 5AZVA 2PIOA
chains in the Genus database with same CATH superfamily
3ERTA 4N1YA 5LWPA 5DZ0A 5KRHA 3CDPA 1ZEOA 3ADSA 2ZNNA 4OJBA 5AVLA 4WPFA 3BC5A 4WQPA 5E1CA 1U3SA 4HLWA 4ZJWA 1XLSE 2Z4BA 4OZTU 3U9QA 5G3JA 1Z5XU 4MGDA 3RUTA 3W0CA 2OAXA 3GWXA 2J7YA 3KBAA 3WT7A 5KCEA 2GPVA 1XJ7A 2I4PA 3UVVA 3R8IA 4J5WA 3H0AA 4IW8A 3UP3A 3UUDB 2FAIA 3FALA 3V3QA 4FGYA 3X31A 3FLIA 4IA2A 4ITFA 4RMCA 1NQ1A 5DV8A 4G2HA 2HFPA 3DZYD 3MNPA 4S14A 1QKUA 2H79A 2OVMA 3X1HA 4A4WA 3FURA 3HVLA 3P8XA 3W0HA 5GICA 1NQ7A 5EC9A 3SZ1A 1T79A 3UUAA 5KRCA 1ZAFA 1U3RA 1XOWA 3KMGA 5I4VA 1FM6D 2FVJA 2Q1HA 4ITEA 3VN2A 3VJSA 1T65A 3IA6A 4K4JA 3GN8A 3WMHA 5DI7A 2F4BA 3KDTA 1XAPA 1RDTA 3IXPD 1XPCA 4QJRA 2GWXA 3ILZA 3UU7A 2B23A 2NW4A 4P6WA 3V3EA 4ZOMA 4QE6A 5DMCA 5E19A 3VSOA 2PINA 1G2NA 5E0XA 4MG8A 4MG7A 2B50A 3NSPA 1T7TA 1NDEA 4IA3A 4TV1B 3WGPA 2HB8A 3ADXA 3HODA 1UPWA 2XHSA 1XQCA 3B0TA 2VSTA 3M7RA 5JY3A 5IXKA 2ZK0A 3IPSA 1VJBA 2V7CA 4QL8A 5DWJA 5G44A 5KCUA 5G42A 5LGAA 1QKMA 5A86A 3W5PA 1OSHA 1XP6A 2HASA 1EREA 3AN3A 4OFRA 1T63A 4G1ZA 3TKMA 5KRIA 1X7EA 4L98A 2QZOA 3OKHA 3CDSA 4ZJRA 2Q5SA 1K4WA 3X1IA 2HBHA 3AZ2A 4XAOA 1KKQA 3O1DA 1DKFA 3GYUA 4OLMA 2GPUA 2QW4A 4REFA 3R8AA 3ZR7A 4PPPA 2QXSA 2HB7A 4OEDA 4DK7A 3AZ3A 3DZUA 1L2IA 2PIRA 3B68A 1WM0X 3RY9A 3R2AA 4PP3A 2GP7A 3FS1A 1QKTA 2PIXA 5L7EA 2GL8A 5FQRA 2JJ3A 3B66A 5AWKA 1QKNA 3OSWA 4IUIA 4OEZA 4PP6A 4Q0AC 3OKIA 3JZCA 5DRMA 4PLDA 2ZVTA 1N4HA 4OC7A 1T73A 4PWLA 1MV9A 5DXEA 2YLOA 2B1ZA 1PRGA 3OMKA 4J26A 4DK8A 5AYGA 2G44A 4YNKA 4J5WC 5KCDA 1ZDUA 3CS8A 4OGHA 1TFCA 4JYGA 3OAPA 2XYWA 1YYEA 1U9EA 2Q70A 5DUEA 4DM6A 2ZXNA 2Q7JA 4A2JA 1NAXA 5L7HA 1I37A 2OCFA 2PJLA 2Q5GA 2ZY0A 5DLRA 4G21A 1L2JA 3DCUA 5G43A 3RLLA 5ACCA 2OVHA 4ZI1A 3CJWA 3CS6A 1OVLA 2EWPA 2P4YA 4OZTE 3VT8A 2ZMIA 4MGAA 4ONIA 1Z5XE 3RLJA 4TUZB 4O8FA 1R1KD 1R20A 5DTVA 3MNEA 3OS8A 3OZJA 3E00D 3AFRA 4MGCA 4RZGA 2XYXA 3EYBA 3O1EA 2ZNQA 3A9EB 4CSJA 5EJVA 3VHWA 4APUA 1E3GA 1XQ3A 3CLDA 3OS9A 1K74D 5DMFA 3W0YA 1YOKA 2YLPA 4ZNSA 2E2RA 1IE9A 4B7WA 4OARA 1Q4XA 4RZFA 3VRWA 2QA8B 1ILHA 1N46A 4OKTA 5DWLA 5C4SA 3OLSA 4RE8A 3WJ5A 4FNEA 3OMQA 2ZLCA 1ERRA 4R6SA 2Z4JA 4R06A 5FQTA 4POJA 4OEYA 5JI0D 1OSVA 4FHHA 4IVYA 2I4JA 2Q7IA 2P1UA 2A3IA 3SP9A 2V0VA 5DUGA 1X7RA 2QABA 1T7MA 2VV4A 4UDBA 5KRFA 4K6IA 3JZBA 3DY6A 2J14A 2BJ4A 2I0JA 3GWSX 4DOSA 5HJPA 1LV2A 5GIEA 2Q59A 5B5BA 1YMTA 1FM9A 4WLBA 2G5OA 2ZXMA 4ZNTA 2BAWA 5DXGA 5DIGA 5AVIA 2HWRA 3G0WA 4J24A 5DV3A 5AZTA 2YHDA 3N00A 1XVPB 3V4AA 4J5XA 5DWIA 1BSXA 4DM8A 5DZ1A 4NIEA 5DKSA 5DP0A 1RJKA 3ET2A 1NAVA 4JYIA 4DORA 3F7DA 5JJMB 2YJDA 5KCTA 4ZNWA 3PBAA 3KDUA 1YY4A 3W5QA 1YIMA 2ZFXA 5KRAA 1FM6A 2Q7KA 2QXMA 2AA6A 1YJEA 3E7CA 3GBKA 2P7AA 2GPPA 1XDKA 3ET3A 3IMYA 3K22A 3PO9A 4IU7A 5DXBA 5AAVB 1YP0A 2JF9A 2JFAB 5KYJA 3CS4A 4N8RA 3AUNA 4LNWA 3L03A 1ZH7A 3Q95A 4LNXA 1S9QA 1ZDTA 1PDUA 1FBYA 3AURA 3W0GA 4ZN7A 3H0AD 5KRLA 4L96A 5EGVA 2QSEA 4K7AA 5DU5A 5C4UA 1TXIA 3L3XA 3VHVA 2QGTA 4KZMA 5DZHA 4RFWA 2XYJA 3L3ZA 1XV9B 2Q6RA 1NHZA 3R5MA 3VT4A 4EM9A 3VRVA 4FHIA 2NXXE 1H9UA 1M7WA 2Q60A 3AN4A 3AZ1A 3W5TA 5L7GA 2ZMJA 3OS8C 5DXRA 3CWDA 2AYRA 2R6YA 3K23A 2AWHA 4RUOX 1X76A 2VSRA 2VV1B 4WHGA 3W0IA 2AX7A 5FQVA 1GWXA 2AX9A 3HLVA 4Q50A 3MNOA 3HZFA 4XHDA 4XUMA 1GWQA 3S9SA 5E0WA 4N73A 3UUDA 1P8DA 3D90A 4MG5A 4A4VA 3ADTA 3FC6B 3ADVA 3F5CB 3L0EA 4JAZA 2R40A 4MG9B 1PQ6A 4OIVA 2NPAA 2YFEA 4OJ9A 4IA1A 4QE8A 2OM9A 1EXXA 1T7FA 2ZXZA 5L11A 3T03A 1EXAA 3PLZA 2Q5PA 3UUCA 3VJTA 1Z95A 4LSJA 3ADWA 5DVSA 5KD9A 3R29A 4QK4A 4MDDA 2P54A 5DWGA 1Y0XX 3KMRA 1UHLB 4RWVA 1FCZA 3HM1A 1LBDA 2P1VA 4IA7A 4MGBB 3W0JA 5DSHA 3GZ9A 4J5XC 1M13A 2ACLB 4OFUA 4OKBA 4UDAA 5ICKA 3TX7B 3DZUD 1NQ2A 1NRLA 1RKHA 4TV1A 4S0SA 2QTUA 2Q61A 2HCDA 3LBDA 3H52A 5H1EA 4OKXA 5DXMA 4NUFA 4RZEA 3HC5A 4PXMA 2P15A 2POBA 2ZK5A 5GIDA 4Q13A 3A2IA 4MGDB 2HARA 2AX6A 3X36A 5FQSA 4G2IA 1I7IA 4PP5A 4NY9A 4IS8A 5DVVA 3RUUA 4EMAA 1K74A 3R5NA 3L1BA 4OKWA 5GT4A 3UVVB 3V9TA 1T5ZA 4YT1A 2IHQA 4S15A 1XIUA 5KRKA 3FALB 2AA5A 2ZKCA 5SYZA 1X7JA 5HZCA 1T74A 3ZRAA 2OUZA 4ZO1B 3G9EA 3ET0A 2QA6A 5APHA 4KZJA 1N83A 2ZBSA 4OK1A 4DMAA 1ZGYA 3B5RA 5KCCA 2FSZA 3CTBA 4PPSA 5DKGA 3UUAB 2ZNOA 2VV3A 1U3QA 4QM0A 4XUHA 1YOWA 2O4JA 3WT5A 4OH6A 3P88A 1R20D 2ZASA 4UDCA 1FCYA 1X78A 2AO6A 5G46A 3V49A 3OSIA 1I7GA 4OJ4A 3UU7B 5DUHA 3OLFA 4IWFA 4OH5A 2ZLAA 1RKGA 3OMPA 5DXKA 1HG4A 3D24A 4MG8B 4MG7B 1MZNA 2IOGA 4MG6A 2J7XA 1NQ0A 1P93A 4OZRU 2XKWA 3VT7A 1XP9A 2NV7A 3DCTA 3NSQA 1XNNA 2QMVA 5DVCA 5DX3B 3VT5A 1UPVA 3DZYA 3PRGA 5DKBA 5E7VA 5AK2A 3VRTA 1XB7A 5APKA 1DB1A 3LMPA 2AMBA 1SJ0A 3AX8A 1I38A 3GD2A 5F9BA 5DXQA 1SKXA 2P7GA 1ZUCA 2G0HA 3K6PA 4TUZA 4WVDA 2P1TA 2QZOB 1NYXA 2Q6JA 3W5RA 3KWYA 1XP1A 2AAXA 1PCGA 2ABIA 4XTAA 2LBDA 2NXXA 1GS4A 3IXPA 3VI8A 5DYDA 4RMEA 3A9EA 3A40X 1GWRA 1DKFB 1T76A 5KRMA 2QPYA 1FM9D 4XI3A 2O9IA 5DL4A 3FUGA 3WFGA 2ZK3A 4NB6A 2REWA 5E14A 5DIEA 1G1UA 5DV6A 3V9YA 3OLLA 2YLQA 1G50A 3VTDA 3WTQA 2QA8A 2PIQA 3B67A 4IV4A 2YATA 4ZNUA 4PVUA 3WT6A 1T7RA 3KMZA 3AUQA 2PIWA 3NOAA 5DZIA 4IV2A 5AWJA 4RUJA 1SR7A 5FQPA 2AA2A 2Q7LA 3DT3A 5DWEA 3ADUA 2P7ZA 2YLYA 1NUOA 3VTBA 2HAMA 2QNVA 3PCUA 1S9PA 3WWRA 5DY8A 4XLDA 3FEJA 1A52A 3HQ5A 5E15A 1PQCA 3HC6A 2HWQA 1HJ1A 1RDTD 3B0RA 1IE8A 4Y29A 3VT9A 5DXPA 2H77A 1R5KA 3KPZA 3OOKA 3P89A 2AM9A 3A2HA 4LBDA 2PIVA 5EITA 5HJSA 3OZ0A 3VRUA 1XVPA 1KV6A 2GTKA 3RVFA 4XT9A 3VT3A 5ETHA 2G0GA 3OSAA 5DX3A 5C4OA 2ZK1A 2Q6SA 4JL4A 5KRJA 1ILGA 1G5YA 3P0UA 5DIDA 1YA3A 2HC4A 2I4ZA 1OVLB 3B65A 1PQ9A 3A3ZX 4MGAB 5JJMA 4NQAB 3VSPA 4JYHA 2ZL9A 2PKLA 1KNUA 4YMQA 2QGWA 2I0GA 4PRGA 3FXVA 5DRJA 5AAUA 5DKEA 2O4RA 3ET1A 3B3KA 3B0WA 4ZNVA 1S0ZA 3CQVA 3V9VA 5G45A 1Y0SA 3B1MA 3HO0A 4OIUA 5AAVA 3VHUA 2AX8A 3D6DA 3OMOA 3KFCA 2JFAA 4UDDA 4IVWA 2ZK6A 4OILA 4DQMA 4ZO1X 2PIUA 4E2JA 5M96A 1MVCA 3ERDA 4G1YA 3DR1A 4HEEX 2Q1VA 2R40D 4IW6A 2R6WA 3VJIA 1A28A 2POGA 2AMAA 3WJ4A 1XV9A 4X1GA 3VJHA 3VTCA 3TY0A 3WFFA 3G8IA 5HCVA 4RAKA 3R8DA 3D5FA 2VV4B 1K7LA 4E4KA 1R1KA 1E3KA 2ZK4A 2W8YA 2BJ4B 1UOMA 5APJA 5HJPB 2ZK2A 2ZMHA 3E00A 1SQNA 1M2ZA 4JGVA 3KYTA 5IAWA 3E94A 3GYTA 1FD0A 2Q59B 3BEJA 4RMDA 4PLEA 4R2UA 2PNUA 4BCRA 2PRGA 2Q3YA 2VV1A 2ATHA 2J4AA 2AXAA 2YJAB 1X7BA 2VV2A 3OMMA 2PIPL 3PEQA 4OZRE 4ZN9A 3IPQA 5C4TA 4M8HA 5HYRA 2QE4A 4LTWA 1RK3A 5KYAA 1R6GA 4ZNHA 1S0XA 1Y9RA 5KCFA 5KROA 1XNXA 3G8OA 3L0LA 3FC6A 3D57A 4CI4A 3F5CA 4IQRA 1YINA 3B0QA 4MG9A 1OT7A 2PITA 5G5WA 3QT0A 4KZIA 2HVCA 4POHA 4P6XA 5EI1A 5HYKA 1PZLA 5DK9A 2AA7A 5EHJA 1XDKB 4FN9A 4REEA 5DXBB 3VT6A 2OZ7A 3K8SA 2AB2A 4OEAA 3W0AA 4E4QA 1S19A 3UP0A 2QH6A 2GPOA 1XZXX 2QR9A 4IWCA 4OHAA 4CI5A 5K13A 5CJ6A 5DYBA 1XLSA 3A2JA 3Q95B 3TKCA 1UHLA 5KR9A 4PF3A 2GIUA 4WHFA 4X1FA 3L0JA 1YUCA 3OOFA 5B41A 2Q8SA 1PK5A 1ZKYA 2IOKA 4MGBA 4M8EA 3FEIA 3OGTA 3ZQTA 3ZRBA 4G20A 3IPUA 4F9MA 5DZ3A 2VV0A 2ACLA 4S0TA 2B1VA 4RUPA 3BQDA 3SP6A 5KCWA 4N5GA 5IZ0A 1FCXA 3A78A 4YPQA 4G1DA 2ZNPA 5AZVA 2PIOA
chains in the Genus database with same CATH topology
3ERTA 4N1YA 5LWPA 5DZ0A 5KRHA 3CDPA 1ZEOA 3ADSA 2ZNNA 4OJBA 5AVLA 4WPFA 3BC5A 4WQPA 5E1CA 1U3SA 4HLWA 4ZJWA 1XLSE 2Z4BA 4OZTU 3U9QA 5G3JA 1Z5XU 4MGDA 3RUTA 3W0CA 2OAXA 3GWXA 2J7YA 3KBAA 3WT7A 5KCEA 2GPVA 1XJ7A 2I4PA 3UVVA 3R8IA 4J5WA 3H0AA 4IW8A 3UP3A 3UUDB 2FAIA 3FALA 3V3QA 4FGYA 3X31A 3FLIA 4IA2A 4ITFA 4RMCA 1NQ1A 5DV8A 4G2HA 2HFPA 3DZYD 3MNPA 4S14A 1QKUA 2H79A 2OVMA 3X1HA 4A4WA 3FURA 3HVLA 3P8XA 3W0HA 5GICA 1NQ7A 5EC9A 3SZ1A 1T79A 3UUAA 5KRCA 1ZAFA 1U3RA 1XOWA 3KMGA 5I4VA 1FM6D 2FVJA 2Q1HA 4ITEA 3VN2A 3VJSA 1T65A 3IA6A 4K4JA 3GN8A 3WMHA 5DI7A 2F4BA 3KDTA 1XAPA 1RDTA 3IXPD 1XPCA 4QJRA 2GWXA 3ILZA 3UU7A 2B23A 2NW4A 4P6WA 3V3EA 4ZOMA 4QE6A 5DMCA 5E19A 3VSOA 2PINA 1G2NA 5E0XA 4MG8A 4MG7A 2B50A 3NSPA 1T7TA 1NDEA 4IA3A 4TV1B 3WGPA 2HB8A 3ADXA 3HODA 1UPWA 2XHSA 1XQCA 3B0TA 2VSTA 3M7RA 5JY3A 5IXKA 2ZK0A 3IPSA 1VJBA 2V7CA 4QL8A 5DWJA 5G44A 5KCUA 5G42A 5LGAA 1QKMA 5A86A 3W5PA 1OSHA 1XP6A 2HASA 1EREA 3AN3A 4OFRA 1T63A 4G1ZA 3TKMA 5KRIA 1X7EA 4L98A 2QZOA 3OKHA 3CDSA 4ZJRA 2Q5SA 1K4WA 3X1IA 2HBHA 3AZ2A 4XAOA 1KKQA 3O1DA 1DKFA 3GYUA 4OLMA 2GPUA 2QW4A 4REFA 3R8AA 3ZR7A 4PPPA 2QXSA 2HB7A 4OEDA 4DK7A 3AZ3A 3DZUA 1L2IA 2PIRA 3B68A 1WM0X 3RY9A 3R2AA 4PP3A 2GP7A 3FS1A 1QKTA 2PIXA 5L7EA 2GL8A 5FQRA 2JJ3A 3B66A 5AWKA 1QKNA 3OSWA 4IUIA 4OEZA 4PP6A 4Q0AC 3OKIA 3JZCA 5DRMA 4PLDA 2ZVTA 1N4HA 4OC7A 1T73A 4PWLA 1MV9A 5DXEA 2YLOA 2B1ZA 1PRGA 3OMKA 4J26A 4DK8A 5AYGA 2G44A 4YNKA 4J5WC 5KCDA 1ZDUA 3CS8A 4OGHA 1TFCA 4JYGA 3OAPA 2XYWA 1YYEA 1U9EA 2Q70A 5DUEA 4DM6A 2ZXNA 2Q7JA 4A2JA 1NAXA 5L7HA 1I37A 2OCFA 2PJLA 2Q5GA 2ZY0A 5DLRA 4G21A 1L2JA 3DCUA 5G43A 3RLLA 5ACCA 2OVHA 4ZI1A 3CJWA 3CS6A 1OVLA 2EWPA 2P4YA 4OZTE 3VT8A 2ZMIA 4MGAA 4ONIA 1Z5XE 3RLJA 4TUZB 4O8FA 1R1KD 1R20A 5DTVA 3MNEA 3OS8A 3OZJA 3E00D 3AFRA 4MGCA 4RZGA 2XYXA 3EYBA 3O1EA 2ZNQA 3A9EB 4CSJA 5EJVA 3VHWA 4APUA 1E3GA 1XQ3A 3CLDA 3OS9A 1K74D 5DMFA 3W0YA 1YOKA 2YLPA 4ZNSA 2E2RA 1IE9A 4B7WA 4OARA 1Q4XA 4RZFA 3VRWA 2QA8B 1ILHA 1N46A 4OKTA 5DWLA 5C4SA 3OLSA 4RE8A 3WJ5A 4FNEA 3OMQA 2ZLCA 1ERRA 4R6SA 2Z4JA 4R06A 5FQTA 4POJA 4OEYA 5JI0D 1OSVA 4FHHA 4IVYA 2I4JA 2Q7IA 2P1UA 2A3IA 3SP9A 2V0VA 5DUGA 1X7RA 2QABA 1T7MA 2VV4A 4UDBA 5KRFA 4K6IA 3JZBA 3DY6A 2J14A 2BJ4A 2I0JA 3GWSX 4DOSA 5HJPA 1LV2A 5GIEA 2Q59A 5B5BA 1YMTA 1FM9A 4WLBA 2G5OA 2ZXMA 4ZNTA 2BAWA 5DXGA 5DIGA 5AVIA 2HWRA 3G0WA 4J24A 5DV3A 5AZTA 2YHDA 3N00A 1XVPB 3V4AA 4J5XA 5DWIA 1BSXA 4DM8A 5DZ1A 4NIEA 5DKSA 5DP0A 1RJKA 3ET2A 1NAVA 4JYIA 4DORA 3F7DA 5JJMB 2YJDA 5KCTA 4ZNWA 3PBAA 3KDUA 1YY4A 3W5QA 1YIMA 2ZFXA 5KRAA 1FM6A 2Q7KA 2QXMA 2AA6A 1YJEA 3E7CA 3GBKA 2P7AA 2GPPA 1XDKA 3ET3A 3IMYA 3K22A 3PO9A 4IU7A 5DXBA 5AAVB 1YP0A 2JF9A 2JFAB 5KYJA 3CS4A 4N8RA 3AUNA 4LNWA 3L03A 1ZH7A 3Q95A 4LNXA 1S9QA 1ZDTA 1PDUA 1FBYA 3AURA 3W0GA 4ZN7A 3H0AD 5KRLA 4L96A 5EGVA 2QSEA 4K7AA 5DU5A 5C4UA 1TXIA 3L3XA 3VHVA 2QGTA 4KZMA 5DZHA 4RFWA 2XYJA 3L3ZA 1XV9B 2Q6RA 1NHZA 3R5MA 3VT4A 4EM9A 3VRVA 4FHIA 2NXXE 1H9UA 1M7WA 2Q60A 3AN4A 3AZ1A 3W5TA 5L7GA 2ZMJA 3OS8C 5DXRA 3CWDA 2AYRA 2R6YA 3K23A 2AWHA 4RUOX 1X76A 2VSRA 2VV1B 4WHGA 3W0IA 2AX7A 5FQVA 1GWXA 2AX9A 3HLVA 4Q50A 3MNOA 3HZFA 4XHDA 4XUMA 1GWQA 3S9SA 5E0WA 4N73A 3UUDA 1P8DA 3D90A 4MG5A 4A4VA 3ADTA 3FC6B 3ADVA 3F5CB 3L0EA 4JAZA 2R40A 4MG9B 1PQ6A 4OIVA 2NPAA 2YFEA 4OJ9A 4IA1A 4QE8A 2OM9A 1EXXA 1T7FA 2ZXZA 5L11A 3T03A 1EXAA 3PLZA 2Q5PA 3UUCA 3VJTA 1Z95A 4LSJA 3ADWA 5DVSA 5KD9A 3R29A 4QK4A 4MDDA 2P54A 5DWGA 1Y0XX 3KMRA 1UHLB 4RWVA 1FCZA 3HM1A 1LBDA 2P1VA 4IA7A 4MGBB 3W0JA 5DSHA 3GZ9A 4J5XC 1M13A 2ACLB 4OFUA 4OKBA 4UDAA 5ICKA 3TX7B 3DZUD 1NQ2A 1NRLA 1RKHA 4TV1A 4S0SA 2QTUA 2Q61A 2HCDA 3LBDA 3H52A 5H1EA 4OKXA 5DXMA 4NUFA 4RZEA 3HC5A 4PXMA 2P15A 2POBA 2ZK5A 5GIDA 4Q13A 3A2IA 4MGDB 2HARA 2AX6A 3X36A 5FQSA 4G2IA 1I7IA 4PP5A 4NY9A 4IS8A 5DVVA 3RUUA 4EMAA 1K74A 3R5NA 3L1BA 4OKWA 5GT4A 3UVVB 3V9TA 1T5ZA 4YT1A 2IHQA 4S15A 1XIUA 5KRKA 3FALB 2AA5A 2ZKCA 5SYZA 1X7JA 5HZCA 1T74A 3ZRAA 2OUZA 4ZO1B 3G9EA 3ET0A 2QA6A 5APHA 4KZJA 1N83A 2ZBSA 4OK1A 4DMAA 1ZGYA 3B5RA 5KCCA 2FSZA 3CTBA 4PPSA 5DKGA 3UUAB 2ZNOA 2VV3A 1U3QA 4QM0A 4XUHA 1YOWA 2O4JA 3WT5A 4OH6A 3P88A 1R20D 2ZASA 4UDCA 1FCYA 1X78A 2AO6A 5G46A 3V49A 3OSIA 1I7GA 4OJ4A 3UU7B 5DUHA 3OLFA 4IWFA 4OH5A 2ZLAA 1RKGA 3OMPA 5DXKA 1HG4A 3D24A 4MG8B 4MG7B 1MZNA 2IOGA 4MG6A 2J7XA 1NQ0A 1P93A 4OZRU 2XKWA 3VT7A 1XP9A 2NV7A 3DCTA 3NSQA 1XNNA 2QMVA 5DVCA 5DX3B 3VT5A 1UPVA 3DZYA 3PRGA 5DKBA 5E7VA 5AK2A 3VRTA 1XB7A 5APKA 1DB1A 3LMPA 2AMBA 1SJ0A 3AX8A 1I38A 3GD2A 5F9BA 5DXQA 1SKXA 2P7GA 1ZUCA 2G0HA 3K6PA 4TUZA 4WVDA 2P1TA 2QZOB 1NYXA 2Q6JA 3W5RA 3KWYA 1XP1A 2AAXA 1PCGA 2ABIA 4XTAA 2LBDA 2NXXA 1GS4A 3IXPA 3VI8A 5DYDA 4RMEA 3A9EA 3A40X 1GWRA 1DKFB 1T76A 5KRMA 2QPYA 1FM9D 4XI3A 2O9IA 5DL4A 3FUGA 3WFGA 2ZK3A 4NB6A 2REWA 5E14A 5DIEA 1G1UA 5DV6A 3V9YA 3OLLA 2YLQA 1G50A 3VTDA 3WTQA 2QA8A 2PIQA 3B67A 4IV4A 2YATA 4ZNUA 4PVUA 3WT6A 1T7RA 3KMZA 3AUQA 2PIWA 3NOAA 5DZIA 4IV2A 5AWJA 4RUJA 1SR7A 5FQPA 2AA2A 2Q7LA 3DT3A 5DWEA 3ADUA 2P7ZA 2YLYA 1NUOA 3VTBA 2HAMA 2QNVA 3PCUA 1S9PA 3WWRA 5DY8A 4XLDA 3FEJA 1A52A 3HQ5A 5E15A 1PQCA 3HC6A 2HWQA 1HJ1A 1RDTD 3B0RA 1IE8A 4Y29A 3VT9A 5DXPA 2H77A 1R5KA 3KPZA 3OOKA 3P89A 2AM9A 3A2HA 4LBDA 2PIVA 5EITA 5HJSA 3OZ0A 3VRUA 1XVPA 1KV6A 2GTKA 3RVFA 4XT9A 3VT3A 5ETHA 2G0GA 3OSAA 5DX3A 5C4OA 2ZK1A 2Q6SA 4JL4A 5KRJA 1ILGA 1G5YA 3P0UA 5DIDA 1YA3A 2HC4A 2I4ZA 1OVLB 3B65A 1PQ9A 3A3ZX 4MGAB 5JJMA 4NQAB 3VSPA 4JYHA 2ZL9A 2PKLA 1KNUA 4YMQA 2QGWA 2I0GA 4PRGA 3FXVA 5DRJA 5AAUA 5DKEA 2O4RA 3ET1A 3B3KA 3B0WA 4ZNVA 1S0ZA 3CQVA 3V9VA 5G45A 1Y0SA 3B1MA 3HO0A 4OIUA 5AAVA 3VHUA 2AX8A 3D6DA 3OMOA 3KFCA 2JFAA 4UDDA 4IVWA 2ZK6A 4OILA 4DQMA 4ZO1X 2PIUA 4E2JA 5M96A 1MVCA 3ERDA 4G1YA 3DR1A 4HEEX 2Q1VA 2R40D 4IW6A 2R6WA 3VJIA 1A28A 2POGA 2AMAA 3WJ4A 1XV9A 4X1GA 3VJHA 3VTCA 3TY0A 3WFFA 3G8IA 5HCVA 4RAKA 3R8DA 3D5FA 2VV4B 1K7LA 4E4KA 1R1KA 1E3KA 2ZK4A 2W8YA 2BJ4B 1UOMA 5APJA 5HJPB 2ZK2A 2ZMHA 3E00A 1SQNA 1M2ZA 4JGVA 3KYTA 5IAWA 3E94A 3GYTA 1FD0A 2Q59B 3BEJA 4RMDA 4PLEA 4R2UA 2PNUA 4BCRA 2PRGA 2Q3YA 2VV1A 2ATHA 2J4AA 2AXAA 2YJAB 1X7BA 2VV2A 3OMMA 2PIPL 3PEQA 4OZRE 4ZN9A 3IPQA 5C4TA 4M8HA 5HYRA 2QE4A 4LTWA 1RK3A 5KYAA 1R6GA 4ZNHA 1S0XA 1Y9RA 5KCFA 5KROA 1XNXA 3G8OA 3L0LA 3FC6A 3D57A 4CI4A 3F5CA 4IQRA 1YINA 3B0QA 4MG9A 1OT7A 2PITA 5G5WA 3QT0A 4KZIA 2HVCA 4POHA 4P6XA 5EI1A 5HYKA 1PZLA 5DK9A 2AA7A 5EHJA 1XDKB 4FN9A 4REEA 5DXBB 3VT6A 2OZ7A 3K8SA 2AB2A 4OEAA 3W0AA 4E4QA 1S19A 3UP0A 2QH6A 2GPOA 1XZXX 2QR9A 4IWCA 4OHAA 4CI5A 5K13A 5CJ6A 5DYBA 1XLSA 3A2JA 3Q95B 3TKCA 1UHLA 5KR9A 4PF3A 2GIUA 4WHFA 4X1FA 3L0JA 1YUCA 3OOFA 5B41A 2Q8SA 1PK5A 1ZKYA 2IOKA 4MGBA 4M8EA 3FEIA 3OGTA 3ZQTA 3ZRBA 4G20A 3IPUA 4F9MA 5DZ3A 2VV0A 2ACLA 4S0TA 2B1VA 4RUPA 3BQDA 3SP6A 5KCWA 4N5GA 5IZ0A 1FCXA 3A78A 4YPQA 4G1DA 2ZNPA 5AZVA 2PIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERT A;  4N1Y A;  5LWP A;  5DZ0 A;  5KRH A;  3CDP A;  1ZEO A;  3ADS A;  2ZNN A;  4OJB A;  5AVL A;  4WPF A;  3BC5 A;  4WQP A;  5E1C A;  1U3S A;  4HLW A;  4ZJW A;  1XLS E;  2Z4B A;  4OZT U;  3U9Q A;  5G3J A;  1Z5X U;  4MGD A;  3RUT A;  3W0C A;  2OAX A;  3GWX A;  2J7Y A;  3KBA A;  3WT7 A;  5KCE A;  2GPV A;  1XJ7 A;  2I4P A;  3UVV A;  3R8I A;  4J5W A;  3H0A A;  4IW8 A;  3UP3 A;  3UUD B;  2FAI A;  3FAL A;  3V3Q A;  4FGY A;  3X31 A;  3FLI A;  4IA2 A;  4ITF A;  4RMC A;  1NQ1 A;  5DV8 A;  4G2H A;  2HFP A;  3DZY D;  3MNP A;  4S14 A;  1QKU A;  2H79 A;  2OVM A;  3X1H A;  4A4W A;  3FUR A;  3HVL A;  3P8X A;  3W0H A;  5GIC A;  1NQ7 A;  5EC9 A;  3SZ1 A;  1T79 A;  3UUA A;  5KRC A;  1ZAF A;  1U3R A;  1XOW A;  3KMG A;  5I4V A;  1FM6 D;  2FVJ A;  2Q1H A;  4ITE A;  3VN2 A;  3VJS A;  1T65 A;  3IA6 A;  4K4J A;  3GN8 A;  3WMH A;  5DI7 A;  2F4B A;  3KDT A;  1XAP A;  1RDT A;  3IXP D;  1XPC A;  4QJR A;  2GWX A;  3ILZ A;  3UU7 A;  2B23 A;  2NW4 A;  4P6W A;  3V3E A;  4ZOM A;  4QE6 A;  5DMC A;  5E19 A;  3VSO A;  2PIN A;  1G2N A;  5E0X A;  4MG8 A;  4MG7 A;  2B50 A;  3NSP A;  1T7T A;  1NDE A;  4IA3 A;  4TV1 B;  3WGP A;  2HB8 A;  3ADX A;  3HOD A;  1UPW A;  2XHS A;  1XQC A;  3B0T A;  2VST A;  3M7R A;  5JY3 A;  5IXK A;  2ZK0 A;  3IPS A;  1VJB A;  2V7C A;  4QL8 A;  5DWJ A;  5G44 A;  5KCU A;  5G42 A;  5LGA A;  1QKM A;  5A86 A;  3W5P A;  1OSH A;  1XP6 A;  2HAS A;  1ERE A;  3AN3 A;  4OFR A;  1T63 A;  4G1Z A;  3TKM A;  5KRI A;  1X7E A;  4L98 A;  2QZO A;  3OKH A;  3CDS A;  4ZJR A;  2Q5S A;  1K4W A;  3X1I A;  2HBH A;  3AZ2 A;  4XAO A;  1KKQ A;  3O1D A;  1DKF A;  3GYU A;  4OLM A;  2GPU A;  2QW4 A;  4REF A;  3R8A A;  3ZR7 A;  4PPP A;  2QXS A;  2HB7 A;  4OED A;  4DK7 A;  3AZ3 A;  3DZU A;  1L2I A;  2PIR A;  3B68 A;  1WM0 X;  3RY9 A;  3R2A A;  4PP3 A;  2GP7 A;  3FS1 A;  1QKT A;  2PIX A;  5L7E A;  2GL8 A;  5FQR A;  2JJ3 A;  3B66 A;  5AWK A;  1QKN A;  3OSW A;  4IUI A;  4OEZ A;  4PP6 A;  4Q0A C;  3OKI A;  3JZC A;  5DRM A;  4PLD A;  2ZVT A;  1N4H A;  4OC7 A;  1T73 A;  4PWL A;  1MV9 A;  5DXE A;  2YLO A;  2B1Z A;  1PRG A;  3OMK A;  4J26 A;  4DK8 A;  5AYG A;  2G44 A;  4YNK A;  4J5W C;  5KCD A;  1ZDU A;  3CS8 A;  4OGH A;  1TFC A;  4JYG A;  3OAP A;  2XYW A;  1YYE A;  1U9E A;  2Q70 A;  5DUE A;  4DM6 A;  2ZXN A;  2Q7J A;  4A2J A;  1NAX A;  5L7H A;  1I37 A;  2OCF A;  2PJL A;  2Q5G A;  2ZY0 A;  5DLR A;  4G21 A;  1L2J A;  3DCU A;  5G43 A;  3RLL A;  5ACC A;  2OVH A;  4ZI1 A;  3CJW A;  3CS6 A;  1OVL A;  2EWP A;  2P4Y A;  4OZT E;  3VT8 A;  2ZMI A;  4MGA A;  4ONI A;  1Z5X E;  3RLJ A;  4TUZ B;  4O8F A;  1R1K D;  1R20 A;  5DTV A;  3MNE A;  3OS8 A;  3OZJ A;  3E00 D;  3AFR A;  4MGC A;  4RZG A;  2XYX A;  3EYB A;  3O1E A;  2ZNQ A;  3A9E B;  4CSJ A;  5EJV A;  3VHW A;  4APU A;  1E3G A;  1XQ3 A;  3CLD A;  3OS9 A;  1K74 D;  5DMF A;  3W0Y A;  1YOK A;  2YLP A;  4ZNS A;  2E2R A;  1IE9 A;  4B7W A;  4OAR A;  1Q4X A;  4RZF A;  3VRW A;  2QA8 B;  1ILH A;  1N46 A;  4OKT A;  5DWL A;  5C4S A;  3OLS A;  4RE8 A;  3WJ5 A;  4FNE A;  3OMQ A;  2ZLC A;  1ERR A;  4R6S A;  2Z4J A;  4R06 A;  5FQT A;  4POJ A;  4OEY A;  5JI0 D;  1OSV A;  4FHH A;  4IVY A;  2I4J A;  2Q7I A;  2P1U A;  2A3I A;  3SP9 A;  2V0V A;  5DUG A;  1X7R A;  2QAB A;  1T7M A;  2VV4 A;  4UDB A;  5KRF A;  4K6I A;  3JZB A;  3DY6 A;  2J14 A;  2BJ4 A;  2I0J A;  3GWS X;  4DOS A;  5HJP A;  1LV2 A;  5GIE A;  2Q59 A;  5B5B A;  1YMT A;  1FM9 A;  4WLB A;  2G5O A;  2ZXM A;  4ZNT A;  2BAW A;  5DXG A;  5DIG A;  5AVI A;  2HWR A;  3G0W A;  4J24 A;  5DV3 A;  5AZT A;  2YHD A;  3N00 A;  1XVP B;  3V4A A;  4J5X A;  5DWI A;  1BSX A;  4DM8 A;  5DZ1 A;  4NIE A;  5DKS A;  5DP0 A;  1RJK A;  3ET2 A;  1NAV A;  4JYI A;  4DOR A;  3F7D A;  5JJM B;  2YJD A;  5KCT A;  4ZNW A;  3PBA A;  3KDU A;  1YY4 A;  3W5Q A;  1YIM A;  2ZFX A;  5KRA A;  1FM6 A;  2Q7K A;  2QXM A;  2AA6 A;  1YJE A;  3E7C A;  3GBK A;  2P7A A;  2GPP A;  1XDK A;  3ET3 A;  3IMY A;  3K22 A;  3PO9 A;  4IU7 A;  5DXB A;  5AAV B;  1YP0 A;  2JF9 A;  2JFA B;  5KYJ A;  3CS4 A;  4N8R A;  3AUN A;  4LNW A;  3L03 A;  1ZH7 A;  3Q95 A;  4LNX A;  1S9Q A;  1ZDT A;  1PDU A;  1FBY A;  3AUR A;  3W0G A;  4ZN7 A;  3H0A D;  5KRL A;  4L96 A;  5EGV A;  2QSE A;  4K7A A;  5DU5 A;  5C4U A;  1TXI A;  3L3X A;  3VHV A;  2QGT A;  4KZM A;  5DZH A;  4RFW A;  2XYJ A;  3L3Z A;  1XV9 B;  2Q6R A;  1NHZ A;  3R5M A;  3VT4 A;  4EM9 A;  3VRV A;  4FHI A;  2NXX E;  1H9U A;  1M7W A;  2Q60 A;  3AN4 A;  3AZ1 A;  3W5T A;  5L7G A;  2ZMJ A;  3OS8 C;  5DXR A;  3CWD A;  2AYR A;  2R6Y A;  3K23 A;  2AWH A;  4RUO X;  1X76 A;  2VSR A;  2VV1 B;  4WHG A;  3W0I A;  2AX7 A;  5FQV A;  1GWX A;  2AX9 A;  3HLV A;  4Q50 A;  3MNO A;  3HZF A;  4XHD A;  4XUM A;  1GWQ A;  3S9S A;  5E0W A;  4N73 A;  3UUD A;  1P8D A;  3D90 A;  4MG5 A;  4A4V A;  3ADT A;  3FC6 B;  3ADV A;  3F5C B;  3L0E A;  4JAZ A;  2R40 A;  4MG9 B;  1PQ6 A;  4OIV A;  2NPA A;  2YFE A;  4OJ9 A;  4IA1 A;  4QE8 A;  2OM9 A;  1EXX A;  1T7F A;  2ZXZ A;  5L11 A;  3T03 A;  1EXA A;  3PLZ A;  2Q5P A;  3UUC A;  3VJT A;  1Z95 A;  4LSJ A;  3ADW A;  5DVS A;  5KD9 A;  3R29 A;  4QK4 A;  4MDD A;  2P54 A;  5DWG A;  1Y0X X;  3KMR A;  1UHL B;  4RWV A;  1FCZ A;  3HM1 A;  1LBD A;  2P1V A;  4IA7 A;  4MGB B;  3W0J A;  5DSH A;  3GZ9 A;  4J5X C;  1M13 A;  2ACL B;  4OFU A;  4OKB A;  4UDA A;  5ICK A;  3TX7 B;  3DZU D;  1NQ2 A;  1NRL A;  1RKH A;  4TV1 A;  4S0S A;  2QTU A;  2Q61 A;  2HCD A;  3LBD A;  3H52 A;  5H1E A;  4OKX A;  5DXM A;  4NUF A;  4RZE A;  3HC5 A;  4PXM A;  2P15 A;  2POB A;  2ZK5 A;  5GID A;  4Q13 A;  3A2I A;  4MGD B;  2HAR A;  2AX6 A;  3X36 A;  5FQS A;  4G2I A;  1I7I A;  4PP5 A;  4NY9 A;  4IS8 A;  5DVV A;  3RUU A;  4EMA A;  1K74 A;  3R5N A;  3L1B A;  4OKW A;  5GT4 A;  3UVV B;  3V9T A;  1T5Z A;  4YT1 A;  2IHQ A;  4S15 A;  1XIU A;  5KRK A;  3FAL B;  2AA5 A;  2ZKC A;  5SYZ A;  1X7J A;  5HZC A;  1T74 A;  3ZRA A;  2OUZ A;  4ZO1 B;  3G9E A;  3ET0 A;  2QA6 A;  5APH A;  4KZJ A;  1N83 A;  2ZBS A;  4OK1 A;  4DMA A;  1ZGY A;  3B5R A;  5KCC A;  2FSZ A;  3CTB A;  4PPS A;  5DKG A;  3UUA B;  2ZNO A;  2VV3 A;  1U3Q A;  4QM0 A;  4XUH A;  1YOW A;  2O4J A;  3WT5 A;  4OH6 A;  3P88 A;  1R20 D;  2ZAS A;  4UDC A;  1FCY A;  1X78 A;  2AO6 A;  5G46 A;  3V49 A;  3OSI A;  1I7G A;  4OJ4 A;  3UU7 B;  5DUH A;  3OLF A;  4IWF A;  4OH5 A;  2ZLA A;  1RKG A;  3OMP A;  5DXK A;  1HG4 A;  3D24 A;  4MG8 B;  4MG7 B;  1MZN A;  2IOG A;  4MG6 A;  2J7X A;  1NQ0 A;  1P93 A;  4OZR U;  2XKW A;  3VT7 A;  1XP9 A;  2NV7 A;  3DCT A;  3NSQ A;  1XNN A;  2QMV A;  5DVC A;  5DX3 B;  3VT5 A;  1UPV A;  3DZY A;  3PRG A;  5DKB A;  5E7V A;  5AK2 A;  3VRT A;  1XB7 A;  5APK A;  1DB1 A;  3LMP A;  2AMB A;  1SJ0 A;  3AX8 A;  1I38 A;  3GD2 A;  5F9B A;  5DXQ A;  1SKX A;  2P7G A;  1ZUC A;  2G0H A;  3K6P A;  4TUZ A;  4WVD A;  2P1T A;  2QZO B;  1NYX A;  2Q6J A;  3W5R A;  3KWY A;  1XP1 A;  2AAX A;  1PCG A;  2ABI A;  4XTA A;  2LBD A;  2NXX A;  1GS4 A;  3IXP A;  3VI8 A;  5DYD A;  4RME A;  3A9E A;  3A40 X;  1GWR A;  1DKF B;  1T76 A;  5KRM A;  2QPY A;  1FM9 D;  4XI3 A;  2O9I A;  5DL4 A;  3FUG A;  3WFG A;  2ZK3 A;  4NB6 A;  2REW A;  5E14 A;  5DIE A;  1G1U A;  5DV6 A;  3V9Y A;  3OLL A;  2YLQ A;  1G50 A;  3VTD A;  3WTQ A;  2QA8 A;  2PIQ A;  3B67 A;  4IV4 A;  2YAT A;  4ZNU A;  4PVU A;  3WT6 A;  1T7R A;  3KMZ A;  3AUQ A;  2PIW A;  3NOA A;  5DZI A;  4IV2 A;  5AWJ A;  4RUJ A;  1SR7 A;  5FQP A;  2AA2 A;  2Q7L A;  3DT3 A;  5DWE A;  3ADU A;  2P7Z A;  2YLY A;  1NUO A;  3VTB A;  2HAM A;  2QNV A;  3PCU A;  1S9P A;  3WWR A;  5DY8 A;  4XLD A;  3FEJ A;  1A52 A;  3HQ5 A;  5E15 A;  1PQC A;  3HC6 A;  2HWQ A;  1HJ1 A;  1RDT D;  3B0R A;  1IE8 A;  4Y29 A;  3VT9 A;  5DXP A;  2H77 A;  1R5K A;  3KPZ A;  3OOK A;  3P89 A;  2AM9 A;  3A2H A;  4LBD A;  2PIV A;  5EIT A;  5HJS A;  3OZ0 A;  3VRU A;  1XVP A;  1KV6 A;  2GTK A;  3RVF A;  4XT9 A;  3VT3 A;  5ETH A;  2G0G A;  3OSA A;  5DX3 A;  5C4O A;  2ZK1 A;  2Q6S A;  4JL4 A;  5KRJ A;  1ILG A;  1G5Y A;  3P0U A;  5DID A;  1YA3 A;  2HC4 A;  2I4Z A;  1OVL B;  3B65 A;  1PQ9 A;  3A3Z X;  4MGA B;  5JJM A;  4NQA B;  3VSP A;  4JYH A;  2ZL9 A;  2PKL A;  1KNU A;  4YMQ A;  2QGW A;  2I0G A;  4PRG A;  3FXV A;  5DRJ A;  5AAU A;  5DKE A;  2O4R A;  3ET1 A;  3B3K A;  3B0W A;  4ZNV A;  1S0Z A;  3CQV A;  3V9V A;  5G45 A;  1Y0S A;  3B1M A;  3HO0 A;  4OIU A;  5AAV A;  3VHU A;  2AX8 A;  3D6D A;  3OMO A;  3KFC A;  2JFA A;  4UDD A;  4IVW A;  2ZK6 A;  4OIL A;  4DQM A;  4ZO1 X;  2PIU A;  4E2J A;  5M96 A;  1MVC A;  3ERD A;  4G1Y A;  3DR1 A;  4HEE X;  2Q1V A;  2R40 D;  4IW6 A;  2R6W A;  3VJI A;  1A28 A;  2POG A;  2AMA A;  3WJ4 A;  1XV9 A;  4X1G A;  3VJH A;  3VTC A;  3TY0 A;  3WFF A;  3G8I A;  5HCV A;  4RAK A;  3R8D A;  3D5F A;  2VV4 B;  1K7L A;  4E4K A;  1R1K A;  1E3K A;  2ZK4 A;  2W8Y A;  2BJ4 B;  1UOM A;  5APJ A;  5HJP B;  2ZK2 A;  2ZMH A;  3E00 A;  1SQN A;  1M2Z A;  4JGV A;  3KYT A;  5IAW A;  3E94 A;  3GYT A;  1FD0 A;  2Q59 B;  3BEJ A;  4RMD A;  4PLE A;  4R2U A;  2PNU A;  4BCR A;  2PRG A;  2Q3Y A;  2VV1 A;  2ATH A;  2J4A A;  2AXA A;  2YJA B;  1X7B A;  2VV2 A;  3OMM A;  2PIP L;  3PEQ A;  4OZR E;  4ZN9 A;  3IPQ A;  5C4T A;  4M8H A;  5HYR A;  2QE4 A;  4LTW A;  1RK3 A;  5KYA A;  1R6G A;  4ZNH A;  1S0X A;  1Y9R A;  5KCF A;  5KRO A;  1XNX A;  3G8O A;  3L0L A;  3FC6 A;  3D57 A;  4CI4 A;  3F5C A;  4IQR A;  1YIN A;  3B0Q A;  4MG9 A;  1OT7 A;  2PIT A;  5G5W A;  3QT0 A;  4KZI A;  2HVC A;  4POH A;  4P6X A;  5EI1 A;  5HYK A;  1PZL A;  5DK9 A;  2AA7 A;  5EHJ A;  1XDK B;  4FN9 A;  4REE A;  5DXB B;  3VT6 A;  2OZ7 A;  3K8S A;  2AB2 A;  4OEA A;  3W0A A;  4E4Q A;  1S19 A;  3UP0 A;  2QH6 A;  2GPO A;  1XZX X;  2QR9 A;  4IWC A;  4OHA A;  4CI5 A;  5K13 A;  5CJ6 A;  5DYB A;  1XLS A;  3A2J A;  3Q95 B;  3TKC A;  1UHL A;  5KR9 A;  4PF3 A;  2GIU A;  4WHF A;  4X1F A;  3L0J A;  1YUC A;  3OOF A;  5B41 A;  2Q8S A;  1PK5 A;  1ZKY A;  2IOK A;  4MGB A;  4M8E A;  3FEI A;  3OGT A;  3ZQT A;  3ZRB A;  4G20 A;  3IPU A;  4F9M A;  5DZ3 A;  2VV0 A;  2ACL A;  4S0T A;  2B1V A;  4RUP A;  3BQD A;  3SP6 A;  5KCW A;  4N5G A;  5IZ0 A;  1FCX A;  3A78 A;  4YPQ A;  4G1D A;  2ZNP A;  5AZV A;  2PIO A; 
#chains in the Genus database with same CATH topology
 3ERT A;  4N1Y A;  5LWP A;  5DZ0 A;  5KRH A;  3CDP A;  1ZEO A;  3ADS A;  2ZNN A;  4OJB A;  5AVL A;  4WPF A;  3BC5 A;  4WQP A;  5E1C A;  1U3S A;  4HLW A;  4ZJW A;  1XLS E;  2Z4B A;  4OZT U;  3U9Q A;  5G3J A;  1Z5X U;  4MGD A;  3RUT A;  3W0C A;  2OAX A;  3GWX A;  2J7Y A;  3KBA A;  3WT7 A;  5KCE A;  2GPV A;  1XJ7 A;  2I4P A;  3UVV A;  3R8I A;  4J5W A;  3H0A A;  4IW8 A;  3UP3 A;  3UUD B;  2FAI A;  3FAL A;  3V3Q A;  4FGY A;  3X31 A;  3FLI A;  4IA2 A;  4ITF A;  4RMC A;  1NQ1 A;  5DV8 A;  4G2H A;  2HFP A;  3DZY D;  3MNP A;  4S14 A;  1QKU A;  2H79 A;  2OVM A;  3X1H A;  4A4W A;  3FUR A;  3HVL A;  3P8X A;  3W0H A;  5GIC A;  1NQ7 A;  5EC9 A;  3SZ1 A;  1T79 A;  3UUA A;  5KRC A;  1ZAF A;  1U3R A;  1XOW A;  3KMG A;  5I4V A;  1FM6 D;  2FVJ A;  2Q1H A;  4ITE A;  3VN2 A;  3VJS A;  1T65 A;  3IA6 A;  4K4J A;  3GN8 A;  3WMH A;  5DI7 A;  2F4B A;  3KDT A;  1XAP A;  1RDT A;  3IXP D;  1XPC A;  4QJR A;  2GWX A;  3ILZ A;  3UU7 A;  2B23 A;  2NW4 A;  4P6W A;  3V3E A;  4ZOM A;  4QE6 A;  5DMC A;  5E19 A;  3VSO A;  2PIN A;  1G2N A;  5E0X A;  4MG8 A;  4MG7 A;  2B50 A;  3NSP A;  1T7T A;  1NDE A;  4IA3 A;  4TV1 B;  3WGP A;  2HB8 A;  3ADX A;  3HOD A;  1UPW A;  2XHS A;  1XQC A;  3B0T A;  2VST A;  3M7R A;  5JY3 A;  5IXK A;  2ZK0 A;  3IPS A;  1VJB A;  2V7C A;  4QL8 A;  5DWJ A;  5G44 A;  5KCU A;  5G42 A;  5LGA A;  1QKM A;  5A86 A;  3W5P A;  1OSH A;  1XP6 A;  2HAS A;  1ERE A;  3AN3 A;  4OFR A;  1T63 A;  4G1Z A;  3TKM A;  5KRI A;  1X7E A;  4L98 A;  2QZO A;  3OKH A;  3CDS A;  4ZJR A;  2Q5S A;  1K4W A;  3X1I A;  2HBH A;  3AZ2 A;  4XAO A;  1KKQ A;  3O1D A;  1DKF A;  3GYU A;  4OLM A;  2GPU A;  2QW4 A;  4REF A;  3R8A A;  3ZR7 A;  4PPP A;  2QXS A;  2HB7 A;  4OED A;  4DK7 A;  3AZ3 A;  3DZU A;  1L2I A;  2PIR A;  3B68 A;  1WM0 X;  3RY9 A;  3R2A A;  4PP3 A;  2GP7 A;  3FS1 A;  1QKT A;  2PIX A;  5L7E A;  2GL8 A;  5FQR A;  2JJ3 A;  3B66 A;  5AWK A;  1QKN A;  3OSW A;  4IUI A;  4OEZ A;  4PP6 A;  4Q0A C;  3OKI A;  3JZC A;  5DRM A;  4PLD A;  2ZVT A;  1N4H A;  4OC7 A;  1T73 A;  4PWL A;  1MV9 A;  5DXE A;  2YLO A;  2B1Z A;  1PRG A;  3OMK A;  4J26 A;  4DK8 A;  5AYG A;  2G44 A;  4YNK A;  4J5W C;  5KCD A;  1ZDU A;  3CS8 A;  4OGH A;  1TFC A;  4JYG A;  3OAP A;  2XYW A;  1YYE A;  1U9E A;  2Q70 A;  5DUE A;  4DM6 A;  2ZXN A;  2Q7J A;  4A2J A;  1NAX A;  5L7H A;  1I37 A;  2OCF A;  2PJL A;  2Q5G A;  2ZY0 A;  5DLR A;  4G21 A;  1L2J A;  3DCU A;  5G43 A;  3RLL A;  5ACC A;  2OVH A;  4ZI1 A;  3CJW A;  3CS6 A;  1OVL A;  2EWP A;  2P4Y A;  4OZT E;  3VT8 A;  2ZMI A;  4MGA A;  4ONI A;  1Z5X E;  3RLJ A;  4TUZ B;  4O8F A;  1R1K D;  1R20 A;  5DTV A;  3MNE A;  3OS8 A;  3OZJ A;  3E00 D;  3AFR A;  4MGC A;  4RZG A;  2XYX A;  3EYB A;  3O1E A;  2ZNQ A;  3A9E B;  4CSJ A;  5EJV A;  3VHW A;  4APU A;  1E3G A;  1XQ3 A;  3CLD A;  3OS9 A;  1K74 D;  5DMF A;  3W0Y A;  1YOK A;  2YLP A;  4ZNS A;  2E2R A;  1IE9 A;  4B7W A;  4OAR A;  1Q4X A;  4RZF A;  3VRW A;  2QA8 B;  1ILH A;  1N46 A;  4OKT A;  5DWL A;  5C4S A;  3OLS A;  4RE8 A;  3WJ5 A;  4FNE A;  3OMQ A;  2ZLC A;  1ERR A;  4R6S A;  2Z4J A;  4R06 A;  5FQT A;  4POJ A;  4OEY A;  5JI0 D;  1OSV A;  4FHH A;  4IVY A;  2I4J A;  2Q7I A;  2P1U A;  2A3I A;  3SP9 A;  2V0V A;  5DUG A;  1X7R A;  2QAB A;  1T7M A;  2VV4 A;  4UDB A;  5KRF A;  4K6I A;  3JZB A;  3DY6 A;  2J14 A;  2BJ4 A;  2I0J A;  3GWS X;  4DOS A;  5HJP A;  1LV2 A;  5GIE A;  2Q59 A;  5B5B A;  1YMT A;  1FM9 A;  4WLB A;  2G5O A;  2ZXM A;  4ZNT A;  2BAW A;  5DXG A;  5DIG A;  5AVI A;  2HWR A;  3G0W A;  4J24 A;  5DV3 A;  5AZT A;  2YHD A;  3N00 A;  1XVP B;  3V4A A;  4J5X A;  5DWI A;  1BSX A;  4DM8 A;  5DZ1 A;  4NIE A;  5DKS A;  5DP0 A;  1RJK A;  3ET2 A;  1NAV A;  4JYI A;  4DOR A;  3F7D A;  5JJM B;  2YJD A;  5KCT A;  4ZNW A;  3PBA A;  3KDU A;  1YY4 A;  3W5Q A;  1YIM A;  2ZFX A;  5KRA A;  1FM6 A;  2Q7K A;  2QXM A;  2AA6 A;  1YJE A;  3E7C A;  3GBK A;  2P7A A;  2GPP A;  1XDK A;  3ET3 A;  3IMY A;  3K22 A;  3PO9 A;  4IU7 A;  5DXB A;  5AAV B;  1YP0 A;  2JF9 A;  2JFA B;  5KYJ A;  3CS4 A;  4N8R A;  3AUN A;  4LNW A;  3L03 A;  1ZH7 A;  3Q95 A;  4LNX A;  1S9Q A;  1ZDT A;  1PDU A;  1FBY A;  3AUR A;  3W0G A;  4ZN7 A;  3H0A D;  5KRL A;  4L96 A;  5EGV A;  2QSE A;  4K7A A;  5DU5 A;  5C4U A;  1TXI A;  3L3X A;  3VHV A;  2QGT A;  4KZM A;  5DZH A;  4RFW A;  2XYJ A;  3L3Z A;  1XV9 B;  2Q6R A;  1NHZ A;  3R5M A;  3VT4 A;  4EM9 A;  3VRV A;  4FHI A;  2NXX E;  1H9U A;  1M7W A;  2Q60 A;  3AN4 A;  3AZ1 A;  3W5T A;  5L7G A;  2ZMJ A;  3OS8 C;  5DXR A;  3CWD A;  2AYR A;  2R6Y A;  3K23 A;  2AWH A;  4RUO X;  1X76 A;  2VSR A;  2VV1 B;  4WHG A;  3W0I A;  2AX7 A;  5FQV A;  1GWX A;  2AX9 A;  3HLV A;  4Q50 A;  3MNO A;  3HZF A;  4XHD A;  4XUM A;  1GWQ A;  3S9S A;  5E0W A;  4N73 A;  3UUD A;  1P8D A;  3D90 A;  4MG5 A;  4A4V A;  3ADT A;  3FC6 B;  3ADV A;  3F5C B;  3L0E A;  4JAZ A;  2R40 A;  4MG9 B;  1PQ6 A;  4OIV A;  2NPA A;  2YFE A;  4OJ9 A;  4IA1 A;  4QE8 A;  2OM9 A;  1EXX A;  1T7F A;  2ZXZ A;  5L11 A;  3T03 A;  1EXA A;  3PLZ A;  2Q5P A;  3UUC A;  3VJT A;  1Z95 A;  4LSJ A;  3ADW A;  5DVS A;  5KD9 A;  3R29 A;  4QK4 A;  4MDD A;  2P54 A;  5DWG A;  1Y0X X;  3KMR A;  1UHL B;  4RWV A;  1FCZ A;  3HM1 A;  1LBD A;  2P1V A;  4IA7 A;  4MGB B;  3W0J A;  5DSH A;  3GZ9 A;  4J5X C;  1M13 A;  2ACL B;  4OFU A;  4OKB A;  4UDA A;  5ICK A;  3TX7 B;  3DZU D;  1NQ2 A;  1NRL A;  1RKH A;  4TV1 A;  4S0S A;  2QTU A;  2Q61 A;  2HCD A;  3LBD A;  3H52 A;  5H1E A;  4OKX A;  5DXM A;  4NUF A;  4RZE A;  3HC5 A;  4PXM A;  2P15 A;  2POB A;  2ZK5 A;  5GID A;  4Q13 A;  3A2I A;  4MGD B;  2HAR A;  2AX6 A;  3X36 A;  5FQS A;  4G2I A;  1I7I A;  4PP5 A;  4NY9 A;  4IS8 A;  5DVV A;  3RUU A;  4EMA A;  1K74 A;  3R5N A;  3L1B A;  4OKW A;  5GT4 A;  3UVV B;  3V9T A;  1T5Z A;  4YT1 A;  2IHQ A;  4S15 A;  1XIU A;  5KRK A;  3FAL B;  2AA5 A;  2ZKC A;  5SYZ A;  1X7J A;  5HZC A;  1T74 A;  3ZRA A;  2OUZ A;  4ZO1 B;  3G9E A;  3ET0 A;  2QA6 A;  5APH A;  4KZJ A;  1N83 A;  2ZBS A;  4OK1 A;  4DMA A;  1ZGY A;  3B5R A;  5KCC A;  2FSZ A;  3CTB A;  4PPS A;  5DKG A;  3UUA B;  2ZNO A;  2VV3 A;  1U3Q A;  4QM0 A;  4XUH A;  1YOW A;  2O4J A;  3WT5 A;  4OH6 A;  3P88 A;  1R20 D;  2ZAS A;  4UDC A;  1FCY A;  1X78 A;  2AO6 A;  5G46 A;  3V49 A;  3OSI A;  1I7G A;  4OJ4 A;  3UU7 B;  5DUH A;  3OLF A;  4IWF A;  4OH5 A;  2ZLA A;  1RKG A;  3OMP A;  5DXK A;  1HG4 A;  3D24 A;  4MG8 B;  4MG7 B;  1MZN A;  2IOG A;  4MG6 A;  2J7X A;  1NQ0 A;  1P93 A;  4OZR U;  2XKW A;  3VT7 A;  1XP9 A;  2NV7 A;  3DCT A;  3NSQ A;  1XNN A;  2QMV A;  5DVC A;  5DX3 B;  3VT5 A;  1UPV A;  3DZY A;  3PRG A;  5DKB A;  5E7V A;  5AK2 A;  3VRT A;  1XB7 A;  5APK A;  1DB1 A;  3LMP A;  2AMB A;  1SJ0 A;  3AX8 A;  1I38 A;  3GD2 A;  5F9B A;  5DXQ A;  1SKX A;  2P7G A;  1ZUC A;  2G0H A;  3K6P A;  4TUZ A;  4WVD A;  2P1T A;  2QZO B;  1NYX A;  2Q6J A;  3W5R A;  3KWY A;  1XP1 A;  2AAX A;  1PCG A;  2ABI A;  4XTA A;  2LBD A;  2NXX A;  1GS4 A;  3IXP A;  3VI8 A;  5DYD A;  4RME A;  3A9E A;  3A40 X;  1GWR A;  1DKF B;  1T76 A;  5KRM A;  2QPY A;  1FM9 D;  4XI3 A;  2O9I A;  5DL4 A;  3FUG A;  3WFG A;  2ZK3 A;  4NB6 A;  2REW A;  5E14 A;  5DIE A;  1G1U A;  5DV6 A;  3V9Y A;  3OLL A;  2YLQ A;  1G50 A;  3VTD A;  3WTQ A;  2QA8 A;  2PIQ A;  3B67 A;  4IV4 A;  2YAT A;  4ZNU A;  4PVU A;  3WT6 A;  1T7R A;  3KMZ A;  3AUQ A;  2PIW A;  3NOA A;  5DZI A;  4IV2 A;  5AWJ A;  4RUJ A;  1SR7 A;  5FQP A;  2AA2 A;  2Q7L A;  3DT3 A;  5DWE A;  3ADU A;  2P7Z A;  2YLY A;  1NUO A;  3VTB A;  2HAM A;  2QNV A;  3PCU A;  1S9P A;  3WWR A;  5DY8 A;  4XLD A;  3FEJ A;  1A52 A;  3HQ5 A;  5E15 A;  1PQC A;  3HC6 A;  2HWQ A;  1HJ1 A;  1RDT D;  3B0R A;  1IE8 A;  4Y29 A;  3VT9 A;  5DXP A;  2H77 A;  1R5K A;  3KPZ A;  3OOK A;  3P89 A;  2AM9 A;  3A2H A;  4LBD A;  2PIV A;  5EIT A;  5HJS A;  3OZ0 A;  3VRU A;  1XVP A;  1KV6 A;  2GTK A;  3RVF A;  4XT9 A;  3VT3 A;  5ETH A;  2G0G A;  3OSA A;  5DX3 A;  5C4O A;  2ZK1 A;  2Q6S A;  4JL4 A;  5KRJ A;  1ILG A;  1G5Y A;  3P0U A;  5DID A;  1YA3 A;  2HC4 A;  2I4Z A;  1OVL B;  3B65 A;  1PQ9 A;  3A3Z X;  4MGA B;  5JJM A;  4NQA B;  3VSP A;  4JYH A;  2ZL9 A;  2PKL A;  1KNU A;  4YMQ A;  2QGW A;  2I0G A;  4PRG A;  3FXV A;  5DRJ A;  5AAU A;  5DKE A;  2O4R A;  3ET1 A;  3B3K A;  3B0W A;  4ZNV A;  1S0Z A;  3CQV A;  3V9V A;  5G45 A;  1Y0S A;  3B1M A;  3HO0 A;  4OIU A;  5AAV A;  3VHU A;  2AX8 A;  3D6D A;  3OMO A;  3KFC A;  2JFA A;  4UDD A;  4IVW A;  2ZK6 A;  4OIL A;  4DQM A;  4ZO1 X;  2PIU A;  4E2J A;  5M96 A;  1MVC A;  3ERD A;  4G1Y A;  3DR1 A;  4HEE X;  2Q1V A;  2R40 D;  4IW6 A;  2R6W A;  3VJI A;  1A28 A;  2POG A;  2AMA A;  3WJ4 A;  1XV9 A;  4X1G A;  3VJH A;  3VTC A;  3TY0 A;  3WFF A;  3G8I A;  5HCV A;  4RAK A;  3R8D A;  3D5F A;  2VV4 B;  1K7L A;  4E4K A;  1R1K A;  1E3K A;  2ZK4 A;  2W8Y A;  2BJ4 B;  1UOM A;  5APJ A;  5HJP B;  2ZK2 A;  2ZMH A;  3E00 A;  1SQN A;  1M2Z A;  4JGV A;  3KYT A;  5IAW A;  3E94 A;  3GYT A;  1FD0 A;  2Q59 B;  3BEJ A;  4RMD A;  4PLE A;  4R2U A;  2PNU A;  4BCR A;  2PRG A;  2Q3Y A;  2VV1 A;  2ATH A;  2J4A A;  2AXA A;  2YJA B;  1X7B A;  2VV2 A;  3OMM A;  2PIP L;  3PEQ A;  4OZR E;  4ZN9 A;  3IPQ A;  5C4T A;  4M8H A;  5HYR A;  2QE4 A;  4LTW A;  1RK3 A;  5KYA A;  1R6G A;  4ZNH A;  1S0X A;  1Y9R A;  5KCF A;  5KRO A;  1XNX A;  3G8O A;  3L0L A;  3FC6 A;  3D57 A;  4CI4 A;  3F5C A;  4IQR A;  1YIN A;  3B0Q A;  4MG9 A;  1OT7 A;  2PIT A;  5G5W A;  3QT0 A;  4KZI A;  2HVC A;  4POH A;  4P6X A;  5EI1 A;  5HYK A;  1PZL A;  5DK9 A;  2AA7 A;  5EHJ A;  1XDK B;  4FN9 A;  4REE A;  5DXB B;  3VT6 A;  2OZ7 A;  3K8S A;  2AB2 A;  4OEA A;  3W0A A;  4E4Q A;  1S19 A;  3UP0 A;  2QH6 A;  2GPO A;  1XZX X;  2QR9 A;  4IWC A;  4OHA A;  4CI5 A;  5K13 A;  5CJ6 A;  5DYB A;  1XLS A;  3A2J A;  3Q95 B;  3TKC A;  1UHL A;  5KR9 A;  4PF3 A;  2GIU A;  4WHF A;  4X1F A;  3L0J A;  1YUC A;  3OOF A;  5B41 A;  2Q8S A;  1PK5 A;  1ZKY A;  2IOK A;  4MGB A;  4M8E A;  3FEI A;  3OGT A;  3ZQT A;  3ZRB A;  4G20 A;  3IPU A;  4F9M A;  5DZ3 A;  2VV0 A;  2ACL A;  4S0T A;  2B1V A;  4RUP A;  3BQD A;  3SP6 A;  5KCW A;  4N5G A;  5IZ0 A;  1FCX A;  3A78 A;  4YPQ A;  4G1D A;  2ZNP A;  5AZV A;  2PIO A; 
#chains in the Genus database with same CATH homology
 3ERT A;  4N1Y A;  5LWP A;  5DZ0 A;  5KRH A;  3CDP A;  1ZEO A;  3ADS A;  2ZNN A;  4OJB A;  5AVL A;  4WPF A;  3BC5 A;  4WQP A;  5E1C A;  1U3S A;  4HLW A;  4ZJW A;  1XLS E;  2Z4B A;  4OZT U;  3U9Q A;  5G3J A;  1Z5X U;  4MGD A;  3RUT A;  3W0C A;  2OAX A;  3GWX A;  2J7Y A;  3KBA A;  3WT7 A;  5KCE A;  2GPV A;  1XJ7 A;  2I4P A;  3UVV A;  3R8I A;  4J5W A;  3H0A A;  4IW8 A;  3UP3 A;  3UUD B;  2FAI A;  3FAL A;  3V3Q A;  4FGY A;  3X31 A;  3FLI A;  4IA2 A;  4ITF A;  4RMC A;  1NQ1 A;  5DV8 A;  4G2H A;  2HFP A;  3DZY D;  3MNP A;  4S14 A;  1QKU A;  2H79 A;  2OVM A;  3X1H A;  4A4W A;  3FUR A;  3HVL A;  3P8X A;  3W0H A;  5GIC A;  1NQ7 A;  5EC9 A;  3SZ1 A;  1T79 A;  3UUA A;  5KRC A;  1ZAF A;  1U3R A;  1XOW A;  3KMG A;  5I4V A;  1FM6 D;  2FVJ A;  2Q1H A;  4ITE A;  3VN2 A;  3VJS A;  1T65 A;  3IA6 A;  4K4J A;  3GN8 A;  3WMH A;  5DI7 A;  2F4B A;  3KDT A;  1XAP A;  1RDT A;  3IXP D;  1XPC A;  4QJR A;  2GWX A;  3ILZ A;  3UU7 A;  2B23 A;  2NW4 A;  4P6W A;  3V3E A;  4ZOM A;  4QE6 A;  5DMC A;  5E19 A;  3VSO A;  2PIN A;  1G2N A;  5E0X A;  4MG8 A;  4MG7 A;  2B50 A;  3NSP A;  1T7T A;  1NDE A;  4IA3 A;  4TV1 B;  3WGP A;  2HB8 A;  3ADX A;  3HOD A;  1UPW A;  2XHS A;  1XQC A;  3B0T A;  2VST A;  3M7R A;  5JY3 A;  5IXK A;  2ZK0 A;  3IPS A;  1VJB A;  2V7C A;  4QL8 A;  5DWJ A;  5G44 A;  5KCU A;  5G42 A;  5LGA A;  1QKM A;  5A86 A;  3W5P A;  1OSH A;  1XP6 A;  2HAS A;  1ERE A;  3AN3 A;  4OFR A;  1T63 A;  4G1Z A;  3TKM A;  5KRI A;  1X7E A;  4L98 A;  2QZO A;  3OKH A;  3CDS A;  4ZJR A;  2Q5S A;  1K4W A;  3X1I A;  2HBH A;  3AZ2 A;  4XAO A;  1KKQ A;  3O1D A;  1DKF A;  3GYU A;  4OLM A;  2GPU A;  2QW4 A;  4REF A;  3R8A A;  3ZR7 A;  4PPP A;  2QXS A;  2HB7 A;  4OED A;  4DK7 A;  3AZ3 A;  3DZU A;  1L2I A;  2PIR A;  3B68 A;  1WM0 X;  3RY9 A;  3R2A A;  4PP3 A;  2GP7 A;  3FS1 A;  1QKT A;  2PIX A;  5L7E A;  2GL8 A;  5FQR A;  2JJ3 A;  3B66 A;  5AWK A;  1QKN A;  3OSW A;  4IUI A;  4OEZ A;  4PP6 A;  4Q0A C;  3OKI A;  3JZC A;  5DRM A;  4PLD A;  2ZVT A;  1N4H A;  4OC7 A;  1T73 A;  4PWL A;  1MV9 A;  5DXE A;  2YLO A;  2B1Z A;  1PRG A;  3OMK A;  4J26 A;  4DK8 A;  5AYG A;  2G44 A;  4YNK A;  4J5W C;  5KCD A;  1ZDU A;  3CS8 A;  4OGH A;  1TFC A;  4JYG A;  3OAP A;  2XYW A;  1YYE A;  1U9E A;  2Q70 A;  5DUE A;  4DM6 A;  2ZXN A;  2Q7J A;  4A2J A;  1NAX A;  5L7H A;  1I37 A;  2OCF A;  2PJL A;  2Q5G A;  2ZY0 A;  5DLR A;  4G21 A;  1L2J A;  3DCU A;  5G43 A;  3RLL A;  5ACC A;  2OVH A;  4ZI1 A;  3CJW A;  3CS6 A;  1OVL A;  2EWP A;  2P4Y A;  4OZT E;  3VT8 A;  2ZMI A;  4MGA A;  4ONI A;  1Z5X E;  3RLJ A;  4TUZ B;  4O8F A;  1R1K D;  1R20 A;  5DTV A;  3MNE A;  3OS8 A;  3OZJ A;  3E00 D;  3AFR A;  4MGC A;  4RZG A;  2XYX A;  3EYB A;  3O1E A;  2ZNQ A;  3A9E B;  4CSJ A;  5EJV A;  3VHW A;  4APU A;  1E3G A;  1XQ3 A;  3CLD A;  3OS9 A;  1K74 D;  5DMF A;  3W0Y A;  1YOK A;  2YLP A;  4ZNS A;  2E2R A;  1IE9 A;  4B7W A;  4OAR A;  1Q4X A;  4RZF A;  3VRW A;  2QA8 B;  1ILH A;  1N46 A;  4OKT A;  5DWL A;  5C4S A;  3OLS A;  4RE8 A;  3WJ5 A;  4FNE A;  3OMQ A;  2ZLC A;  1ERR A;  4R6S A;  2Z4J A;  4R06 A;  5FQT A;  4POJ A;  4OEY A;  5JI0 D;  1OSV A;  4FHH A;  4IVY A;  2I4J A;  2Q7I A;  2P1U A;  2A3I A;  3SP9 A;  2V0V A;  5DUG A;  1X7R A;  2QAB A;  1T7M A;  2VV4 A;  4UDB A;  5KRF A;  4K6I A;  3JZB A;  3DY6 A;  2J14 A;  2BJ4 A;  2I0J A;  3GWS X;  4DOS A;  5HJP A;  1LV2 A;  5GIE A;  2Q59 A;  5B5B A;  1YMT A;  1FM9 A;  4WLB A;  2G5O A;  2ZXM A;  4ZNT A;  2BAW A;  5DXG A;  5DIG A;  5AVI A;  2HWR A;  3G0W A;  4J24 A;  5DV3 A;  5AZT A;  2YHD A;  3N00 A;  1XVP B;  3V4A A;  4J5X A;  5DWI A;  1BSX A;  4DM8 A;  5DZ1 A;  4NIE A;  5DKS A;  5DP0 A;  1RJK A;  3ET2 A;  1NAV A;  4JYI A;  4DOR A;  3F7D A;  5JJM B;  2YJD A;  5KCT A;  4ZNW A;  3PBA A;  3KDU A;  1YY4 A;  3W5Q A;  1YIM A;  2ZFX A;  5KRA A;  1FM6 A;  2Q7K A;  2QXM A;  2AA6 A;  1YJE A;  3E7C A;  3GBK A;  2P7A A;  2GPP A;  1XDK A;  3ET3 A;  3IMY A;  3K22 A;  3PO9 A;  4IU7 A;  5DXB A;  5AAV B;  1YP0 A;  2JF9 A;  2JFA B;  5KYJ A;  3CS4 A;  4N8R A;  3AUN A;  4LNW A;  3L03 A;  1ZH7 A;  3Q95 A;  4LNX A;  1S9Q A;  1ZDT A;  1PDU A;  1FBY A;  3AUR A;  3W0G A;  4ZN7 A;  3H0A D;  5KRL A;  4L96 A;  5EGV A;  2QSE A;  4K7A A;  5DU5 A;  5C4U A;  1TXI A;  3L3X A;  3VHV A;  2QGT A;  4KZM A;  5DZH A;  4RFW A;  2XYJ A;  3L3Z A;  1XV9 B;  2Q6R A;  1NHZ A;  3R5M A;  3VT4 A;  4EM9 A;  3VRV A;  4FHI A;  2NXX E;  1H9U A;  1M7W A;  2Q60 A;  3AN4 A;  3AZ1 A;  3W5T A;  5L7G A;  2ZMJ A;  3OS8 C;  5DXR A;  3CWD A;  2AYR A;  2R6Y A;  3K23 A;  2AWH A;  4RUO X;  1X76 A;  2VSR A;  2VV1 B;  4WHG A;  3W0I A;  2AX7 A;  5FQV A;  1GWX A;  2AX9 A;  3HLV A;  4Q50 A;  3MNO A;  3HZF A;  4XHD A;  4XUM A;  1GWQ A;  3S9S A;  5E0W A;  4N73 A;  3UUD A;  1P8D A;  3D90 A;  4MG5 A;  4A4V A;  3ADT A;  3FC6 B;  3ADV A;  3F5C B;  3L0E A;  4JAZ A;  2R40 A;  4MG9 B;  1PQ6 A;  4OIV A;  2NPA A;  2YFE A;  4OJ9 A;  4IA1 A;  4QE8 A;  2OM9 A;  1EXX A;  1T7F A;  2ZXZ A;  5L11 A;  3T03 A;  1EXA A;  3PLZ A;  2Q5P A;  3UUC A;  3VJT A;  1Z95 A;  4LSJ A;  3ADW A;  5DVS A;  5KD9 A;  3R29 A;  4QK4 A;  4MDD A;  2P54 A;  5DWG A;  1Y0X X;  3KMR A;  1UHL B;  4RWV A;  1FCZ A;  3HM1 A;  1LBD A;  2P1V A;  4IA7 A;  4MGB B;  3W0J A;  5DSH A;  3GZ9 A;  4J5X C;  1M13 A;  2ACL B;  4OFU A;  4OKB A;  4UDA A;  5ICK A;  3TX7 B;  3DZU D;  1NQ2 A;  1NRL A;  1RKH A;  4TV1 A;  4S0S A;  2QTU A;  2Q61 A;  2HCD A;  3LBD A;  3H52 A;  5H1E A;  4OKX A;  5DXM A;  4NUF A;  4RZE A;  3HC5 A;  4PXM A;  2P15 A;  2POB A;  2ZK5 A;  5GID A;  4Q13 A;  3A2I A;  4MGD B;  2HAR A;  2AX6 A;  3X36 A;  5FQS A;  4G2I A;  1I7I A;  4PP5 A;  4NY9 A;  4IS8 A;  5DVV A;  3RUU A;  4EMA A;  1K74 A;  3R5N A;  3L1B A;  4OKW A;  5GT4 A;  3UVV B;  3V9T A;  1T5Z A;  4YT1 A;  2IHQ A;  4S15 A;  1XIU A;  5KRK A;  3FAL B;  2AA5 A;  2ZKC A;  5SYZ A;  1X7J A;  5HZC A;  1T74 A;  3ZRA A;  2OUZ A;  4ZO1 B;  3G9E A;  3ET0 A;  2QA6 A;  5APH A;  4KZJ A;  1N83 A;  2ZBS A;  4OK1 A;  4DMA A;  1ZGY A;  3B5R A;  5KCC A;  2FSZ A;  3CTB A;  4PPS A;  5DKG A;  3UUA B;  2ZNO A;  2VV3 A;  1U3Q A;  4QM0 A;  4XUH A;  1YOW A;  2O4J A;  3WT5 A;  4OH6 A;  3P88 A;  1R20 D;  2ZAS A;  4UDC A;  1FCY A;  1X78 A;  2AO6 A;  5G46 A;  3V49 A;  3OSI A;  1I7G A;  4OJ4 A;  3UU7 B;  5DUH A;  3OLF A;  4IWF A;  4OH5 A;  2ZLA A;  1RKG A;  3OMP A;  5DXK A;  1HG4 A;  3D24 A;  4MG8 B;  4MG7 B;  1MZN A;  2IOG A;  4MG6 A;  2J7X A;  1NQ0 A;  1P93 A;  4OZR U;  2XKW A;  3VT7 A;  1XP9 A;  2NV7 A;  3DCT A;  3NSQ A;  1XNN A;  2QMV A;  5DVC A;  5DX3 B;  3VT5 A;  1UPV A;  3DZY A;  3PRG A;  5DKB A;  5E7V A;  5AK2 A;  3VRT A;  1XB7 A;  5APK A;  1DB1 A;  3LMP A;  2AMB A;  1SJ0 A;  3AX8 A;  1I38 A;  3GD2 A;  5F9B A;  5DXQ A;  1SKX A;  2P7G A;  1ZUC A;  2G0H A;  3K6P A;  4TUZ A;  4WVD A;  2P1T A;  2QZO B;  1NYX A;  2Q6J A;  3W5R A;  3KWY A;  1XP1 A;  2AAX A;  1PCG A;  2ABI A;  4XTA A;  2LBD A;  2NXX A;  1GS4 A;  3IXP A;  3VI8 A;  5DYD A;  4RME A;  3A9E A;  3A40 X;  1GWR A;  1DKF B;  1T76 A;  5KRM A;  2QPY A;  1FM9 D;  4XI3 A;  2O9I A;  5DL4 A;  3FUG A;  3WFG A;  2ZK3 A;  4NB6 A;  2REW A;  5E14 A;  5DIE A;  1G1U A;  5DV6 A;  3V9Y A;  3OLL A;  2YLQ A;  1G50 A;  3VTD A;  3WTQ A;  2QA8 A;  2PIQ A;  3B67 A;  4IV4 A;  2YAT A;  4ZNU A;  4PVU A;  3WT6 A;  1T7R A;  3KMZ A;  3AUQ A;  2PIW A;  3NOA A;  5DZI A;  4IV2 A;  5AWJ A;  4RUJ A;  1SR7 A;  5FQP A;  2AA2 A;  2Q7L A;  3DT3 A;  5DWE A;  3ADU A;  2P7Z A;  2YLY A;  1NUO A;  3VTB A;  2HAM A;  2QNV A;  3PCU A;  1S9P A;  3WWR A;  5DY8 A;  4XLD A;  3FEJ A;  1A52 A;  3HQ5 A;  5E15 A;  1PQC A;  3HC6 A;  2HWQ A;  1HJ1 A;  1RDT D;  3B0R A;  1IE8 A;  4Y29 A;  3VT9 A;  5DXP A;  2H77 A;  1R5K A;  3KPZ A;  3OOK A;  3P89 A;  2AM9 A;  3A2H A;  4LBD A;  2PIV A;  5EIT A;  5HJS A;  3OZ0 A;  3VRU A;  1XVP A;  1KV6 A;  2GTK A;  3RVF A;  4XT9 A;  3VT3 A;  5ETH A;  2G0G A;  3OSA A;  5DX3 A;  5C4O A;  2ZK1 A;  2Q6S A;  4JL4 A;  5KRJ A;  1ILG A;  1G5Y A;  3P0U A;  5DID A;  1YA3 A;  2HC4 A;  2I4Z A;  1OVL B;  3B65 A;  1PQ9 A;  3A3Z X;  4MGA B;  5JJM A;  4NQA B;  3VSP A;  4JYH A;  2ZL9 A;  2PKL A;  1KNU A;  4YMQ A;  2QGW A;  2I0G A;  4PRG A;  3FXV A;  5DRJ A;  5AAU A;  5DKE A;  2O4R A;  3ET1 A;  3B3K A;  3B0W A;  4ZNV A;  1S0Z A;  3CQV A;  3V9V A;  5G45 A;  1Y0S A;  3B1M A;  3HO0 A;  4OIU A;  5AAV A;  3VHU A;  2AX8 A;  3D6D A;  3OMO A;  3KFC A;  2JFA A;  4UDD A;  4IVW A;  2ZK6 A;  4OIL A;  4DQM A;  4ZO1 X;  2PIU A;  4E2J A;  5M96 A;  1MVC A;  3ERD A;  4G1Y A;  3DR1 A;  4HEE X;  2Q1V A;  2R40 D;  4IW6 A;  2R6W A;  3VJI A;  1A28 A;  2POG A;  2AMA A;  3WJ4 A;  1XV9 A;  4X1G A;  3VJH A;  3VTC A;  3TY0 A;  3WFF A;  3G8I A;  5HCV A;  4RAK A;  3R8D A;  3D5F A;  2VV4 B;  1K7L A;  4E4K A;  1R1K A;  1E3K A;  2ZK4 A;  2W8Y A;  2BJ4 B;  1UOM A;  5APJ A;  5HJP B;  2ZK2 A;  2ZMH A;  3E00 A;  1SQN A;  1M2Z A;  4JGV A;  3KYT A;  5IAW A;  3E94 A;  3GYT A;  1FD0 A;  2Q59 B;  3BEJ A;  4RMD A;  4PLE A;  4R2U A;  2PNU A;  4BCR A;  2PRG A;  2Q3Y A;  2VV1 A;  2ATH A;  2J4A A;  2AXA A;  2YJA B;  1X7B A;  2VV2 A;  3OMM A;  2PIP L;  3PEQ A;  4OZR E;  4ZN9 A;  3IPQ A;  5C4T A;  4M8H A;  5HYR A;  2QE4 A;  4LTW A;  1RK3 A;  5KYA A;  1R6G A;  4ZNH A;  1S0X A;  1Y9R A;  5KCF A;  5KRO A;  1XNX A;  3G8O A;  3L0L A;  3FC6 A;  3D57 A;  4CI4 A;  3F5C A;  4IQR A;  1YIN A;  3B0Q A;  4MG9 A;  1OT7 A;  2PIT A;  5G5W A;  3QT0 A;  4KZI A;  2HVC A;  4POH A;  4P6X A;  5EI1 A;  5HYK A;  1PZL A;  5DK9 A;  2AA7 A;  5EHJ A;  1XDK B;  4FN9 A;  4REE A;  5DXB B;  3VT6 A;  2OZ7 A;  3K8S A;  2AB2 A;  4OEA A;  3W0A A;  4E4Q A;  1S19 A;  3UP0 A;  2QH6 A;  2GPO A;  1XZX X;  2QR9 A;  4IWC A;  4OHA A;  4CI5 A;  5K13 A;  5CJ6 A;  5DYB A;  1XLS A;  3A2J A;  3Q95 B;  3TKC A;  1UHL A;  5KR9 A;  4PF3 A;  2GIU A;  4WHF A;  4X1F A;  3L0J A;  1YUC A;  3OOF A;  5B41 A;  2Q8S A;  1PK5 A;  1ZKY A;  2IOK A;  4MGB A;  4M8E A;  3FEI A;  3OGT A;  3ZQT A;  3ZRB A;  4G20 A;  3IPU A;  4F9M A;  5DZ3 A;  2VV0 A;  2ACL A;  4S0T A;  2B1V A;  4RUP A;  3BQD A;  3SP6 A;  5KCW A;  4N5G A;  5IZ0 A;  1FCX A;  3A78 A;  4YPQ A;  4G1D A;  2ZNP A;  5AZV A;  2PIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...