3AN3A

Human ppar gamma ligand binding domain in complex with a gamma selective agonist mo3s
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
274
structure length
263
Chain Sequence
QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKISKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, and Structural Analysis of Phenylpropanoic Acid-Type PPAR gamma-Selective Agonists: Discovery of Reversed Stereochemistry-Activity Relationship
pubmed doi rcsb
molecule keywords Peroxisome proliferator-activated receptor gamma
molecule tags Transcription
source organism Homo sapiens
total genus 104
structure length 263
sequence length 274
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3an3A00
2VV4A 4IV4A 2HBHA 4Q0AC 5DI7A 1N46A 3ZR7A 3FUGA 3PO9A 2GPPA 4JYGA 1PK5A 5E1CA 2P15A 4DK7A 3OGTA 2QTUA 4MGDA 5FQSA 3FEIA 2YLPA 3OKIA 4RMEA 3W5TA 2XYJA 3S9SA 1FBYA 3PBAA 3EYBA 4XLDA 3H0AD 2B23A 5KRKA 3BQDA 1YMTA 5DXBB 4S0SA 2Q61A 3H0AA 2AX9A 3CDSA 5H1EA 2Q6JA 4ONIA 3K8SA 3AUNA 4FN9A 4MG7A 3DCTA 4NY9A 3FURA 3IPUA 4K6IA 2Q6RA 4KZMA 3GN8A 4OIVA 4OZRE 4WVDA 4QM0A 3W0YA 3IA6A 2AO6A 2VV1A 3OSWA 2QZOA 3R29A 3B0TA 2JJ3A 3DCUA 5DYBA 1XPCA 4KZJA 3X31A 3HLVA 4M8EA 3VRVA 1OSHA 4CI4A 4J5WA 3OLFA 4OEAA 4JL4A 3ET0A 4NQAB 1IE9A 1M7WA 2ZK5A 5AZTA 1I7GA 3ZRAA 2QNVA 2ZXMA 3IMYA 1X78A 3FEJA 5DXQA 1T7TA 5AVLA 3UVVA 2ABIA 3ILZA 5ICKA 3VHUA 1YA3A 5KRAA 2GPOA 2ZNNA 3B68A 1T7MA 2ZNQA 3AN3A 4PPPA 1S0ZA 5DIDA 3VRWA 4RZFA 3Q95A 3X1IA 4UDAA 3RY9A 1M13A 2AA5A 3UUDB 2YLOA 2Q59B 4OZTU 3CLDA 5DV8A 4IA3A 3B5RA 3DZYD 4DM8A 4G1ZA 5LWPA 1Q4XA 2FAIA 1I38A 5HJPB 5LGAA 4UDBA 3D57A 3H52A 3L1BA 3CWDA 3W0HA 4EM9A 4PP5A 2BAWA 4X1GA 2V0VA 5KD9A 2OVMA 4MGAA 2ACLA 2PINA 2QA8B 5G3JA 5G5WA 5KCUA 2HVCA 2QMVA 1U9EA 3ADVA 3OOKA 5C4SA 4JYHA 4MGCA 4MG8A 1NYXA 3ERDA 2P7ZA 5DIEA 1Y0SA 3B0QA 3G0WA 3KMZA 4A4VA 1KV6A 2POGA 2Q3YA 1DKFA 2Z4JA 3NOAA 4JAZA 5FQTA 5L7HA 3WT6A 5HZCA 4ZNSA 4TUZB 5EC9A 1T79A 5AWKA 3OLLA 3W0AA 1XZXX 3P89A 3CS6A 2O4JA 1NUOA 1OSVA 5ETHA 2J14A 3GBKA 3GYUA 1HG4A 4MGBA 4N5GA 4OKWA 5EJVA 4E4QA 1FM6D 1ZH7A 2ZNPA 1DB1A 1TXIA 4HEEX 5AYGA 1T73A 4ZN7A 3L0EA 3G8IA 2QPYA 4ZNHA 1LBDA 5C4OA 3BEJA 5IXKA 2OUZA 1KKQA 2Q7IA 4N1YA 4PP3A 3R8IA 3V9TA 3AN4A 1SQNA 2AX7A 2YLQA 4OIUA 3V9VA 2FVJA 3VT5A 2JFAB 3B67A 3GD2A 4FGYA 4MG9B 5DU5A 4ZJWA 1T7FA 4P6XA 2PIVA 5DZHA 1FM9A 5DSHA 2P1TA 1YIMA 3VT3A 3KYTA 3CTBA 4UDCA 4CSJA 3ZRBA 2GTKA 4DMAA 5DWJA 5DKGA 4XAOA 4IQRA 3AX8A 5DX3B 2QE4A 3VJIA 4POJA 3SP6A 3E7CA 3MNPA 2VV4B 3IXPD 3D90A 3CS4A 4PP6A 5C4UA 5DXKA 5DIGA 4ZN9A 2GL8A 3IXPA 1R1KD 5KRLA 3P0UA 1UHLA 2ZLAA 4IWCA 3W0CA 1YINA 3OOFA 4OC7A 4R6SA 5IAWA 5KRHA 5DWIA 5APHA 5M96A 3P88A 1R20D 4MGDB 3CS8A 3DZUD 1QKNA 2GWXA 4JYIA 5E15A 4M8HA 3QT0A 3OZJA 1M2ZA 2Q5SA 3DZUA 2O9IA 2QR9A 5KRFA 1ZDUA 2HC4A 4PWLA 2P4YA 3B3KA 2PITA 4MG7B 5IZ0A 4Y29A 4YT1A 1FCYA 4J26A 3RLJA 2G0HA 2Q6SA 1RKGA 2PIPL 2VV1B 4R2UA 4O8FA 4L96A 2QZOB 3SZ1A 4IA7A 3VJTA 4ZJRA 3GZ9A 4IS8A 1T63A 3KBAA 3M7RA 5DLRA 2Q7JA 1UPVA 1LV2A 3TKMA 3OAPA 5KCFA 3T03A 2AX8A 5DP0A 2ZMIA 2Q7KA 2PIOA 5DUEA 4QE8A 3ET2A 5E0WA 3AUQA 2H79A 1WM0X 2F4BA 3UU7A 3UVVB 3F7DA 2PJLA 4J5WC 2AM9A 2ZFXA 1Z5XU 3AFRA 2ZK4A 2I4ZA 3Q95B 1ZGYA 4ZNUA 1I7IA 2E2RA 3NSQA 3KPZA 4K4JA 1X76A 3WFGA 3BC5A 3W5QA 5G42A 1YYEA 4YNKA 1PZLA 1SKXA 2VSRA 3UUAA 5HYKA 5DRJA 2AYRA 3ET3A 5DZ0A 1KNUA 3RVFA 2I0JA 2GP7A 3OSIA 4MGAB 1IE8A 2ACLB 4RUOX 4DM6A 2IHQA 4DORA 1GWXA 2ZASA 5DZIA 5AWJA 2Q5PA 5KCDA 1OT7A 5A86A 2P7AA 1XIUA 5DL4A 4MG8B 4OZTE 5F9BA 3JZCA 3A2JA 3O1EA 1PQCA 2AXAA 4OGHA 3L03A 3VSOA 3GWSX 2AB2A 3N00A 3OSAA 4OARA 1DKFB 5DV3A 1SJ0A 4A2JA 3UUCA 1NAVA 3R8AA 3PLZA 3KFCA 2BJ4A 3W0GA 2AX6A 3L3ZA 1XB7A 1T76A 2Q5GA 1YUCA 3ZQTA 1ERRA 5E7VA 1X7RA 4OH6A 2ZLCA 4IV2A 2H77A 3AZ3A 4Q50A 4ZO1B 2PIUA 5DWLA 3CQVA 2ZK6A 2PIRA 2PKLA 3L3XA 3G9EA 5DTVA 5E14A 3FC6A 4REFA 3VT7A 2QABA 1ZAFA 2HWRA 2G0GA 4FHHA 3VTDA 3FS1A 3E00D 3AZ1A 1NQ0A 3E00A 4IA1A 4A4WA 1GWRA 1ILHA 1RKHA 4G2HA 3GYTA 3VRTA 1P93A 4QK4A 5DXEA 3G8OA 4RE8A 5AAVA 1ZEOA 3ADUA 3B1MA 3FALA 4CI5A 3KWYA 4FNEA 2REWA 2QA6A 3VI8A 3W5RA 3CJWA 3AZ2A 4OEDA 4R06A 4G1YA 2V7CA 2PNUA 4WPFA 1MV9A 2NV7A 3V4AA 4B7WA 3VT6A 4G2IA 1UHLB 1ZUCA 2P1UA 2QH6A 1X7EA 2YHDA 1RDTA 2ZMHA 4G20A 2QSEA 1FCXA 4WLBA 3WJ5A 3WTQA 5G43A 4IWFA 2EWPA 5EHJA 3WFFA 5E0XA 1BSXA 1K4WA 1Y0XX 1TFCA 4OK1A 5DZ1A 1L2IA 1XP9A 3KMGA 1HJ1A 2Q1VA 2ZMJA 5DV6A 2AMBA 1XNXA 3B0RA 2YFEA 3LBDA 1A52A 5G46A 2QXSA 2Q70A 5DUGA 4DQMA 1XOWA 1FM9D 2YJDA 2XHSA 1PDUA 3ERTA 3GWXA 3JZBA 5DK9A 3VT8A 3HVLA 2AA2A 4MG6A 4OEZA 1XQ3A 5CJ6A 2QGTA 3VHVA 3OZ0A 4YPQA 4K7AA 5KCWA 1XP1A 2YJAB 4WHGA 2PRGA 3VJHA 1EREA 4ZOMA 4J5XA 4WQPA 3VHWA 5K13A 1T5ZA 3HC5A 5G45A 3V3EA 3UP0A 2Q60A 3LMPA 4Q13A 4XI3A 3UU7B 3B65A 3WWRA 2I0GA 5HJSA 5KRIA 2ZBSA 1XNNA 2ATHA 3KMRA 4PPSA 2O4RA 2P1VA 4XUHA 3B66A 1PCGA 3FXVA 2FSZA 4BCRA 3A3ZX 5DVCA 4TV1A 3X1HA 3VJSA 5L7GA 3OMOA 1GS4A 2HCDA 5DVVA 3UUAB 4IA2A 2Q8SA 4S14A 1GWQA 1XLSE 3DT3A 3K22A 4RAKA 4RFWA 4RMCA 2Q1HA 4NUFA 1R5KA 3NSPA 2OZ7A 1Z5XE 1E3KA 3L0LA 2ZK2A 3F5CA 5JJMA 1QKUA 4ZNWA 3ADSA 3KDUA 3W0JA 5KRMA 4S0TA 2ZK1A 5KRJA 4RUJA 1XAPA 2P7GA 3R5MA 4OFUA 3ADWA 4QE6A 4S15A 4F9MA 2G5OA 5AZVA 2G44A 4LNXA 4N8RA 3DY6A 3P8XA 4POHA 1YP0A 2HWQA 2VSTA 2IOGA 2AMAA 3ADXA 2HB8A 4RUPA 4E4KA 4XT9A 2BJ4B 3IPSA 1XVPA 4G21A 4JGVA 1XV9A 5GT4A 3PEQA 1SR7A 1E3GA 1EXAA 3W5PA 1P8DA 1YOKA 3OMQA 1OVLA 1NQ7A 4LNWA 5DXGA 3V3QA 2B50A 1Z95A 5L7EA 1NQ2A 2R40D 3FC6B 4APUA 2IOKA 3TKCA 1S0XA 3B0WA 2R40A 1QKMA 2NXXA 1XJ7A 1R6GA 1ZDTA 2AA6A 3OKHA 4OKXA 3V9YA 2R6YA 4ZNVA 3PRGA 3VN2A 4PVUA 5APKA 2GIUA 2HB7A 1K74D 4NIEA 2I4JA 4OLMA 5DXMA 4ZNTA 5KCTA 1N83A 4QL8A 5KCEA 1G5YA 1K74A 1XDKA 5AK2A 5AAVB 3A9EA 5KYAA 3OS8A 3FALB 5DKSA 4IVYA 4OJBA 3ADTA 3K23A 4OKTA 4MG5A 4RWVA 2JF9A 3TY0A 1G1UA 2NW4A 5EGVA 2QW4A 2YATA 3WMHA 3E94A 1S9QA 2J7YA 3A2HA 3HO0A 4YMQA 5L11A 2ZKCA 2AWHA 2XYXA 4MGBB 4OHAA 2GPVA 4IUIA 1UPWA 2ZL9A 2VV2A 4N73A 3VTCA 3K6PA 1Y9RA 4PLDA 3SP9A 4IW6A 5GIDA 2OM9A 2HAMA 4OJ4A 2YLYA 1XLSA 1G50A 2VV0A 1U3QA 3OMPA 5DUHA 4WHFA 4EMAA 1X7BA 5DVSA 4IW8A 4OH5A 4OZRU 3WJ4A 1RJKA 4LSJA 5DMCA 1U3RA 3CDPA 1QKTA 4OKBA 5E19A 5FQPA 2PIQA 3WT7A 2Q7LA 4MDDA 5DXBA 1NDEA 3FLIA 4OFRA 5EITA 3A78A 3DZYA 1RDTD 5DY8A 1K7LA 2ZK0A 4RMDA 4OEYA 4J5XC 5B41A 2HFPA 1S9PA 5APJA 5FQRA 3VRUA 2J7XA 2ZY0A 4L98A 3IPQA 1PQ6A 2XYWA 1MVCA 2A3IA 3OLSA 1NQ1A 2OAXA 1RK3A 1YJEA 4TV1B 3VT9A 5AAUA 5HYRA 5FQVA 2GPUA 4RZEA 4XTAA 4ZO1X 1T74A 4E2JA 5I4VA 4LTWA 3A40X 3RUUA 1N4HA 1VJBA 4IVWA 1YOWA 5AVIA 5GIEA 5KROA 2NXXE 1T7RA 3MNEA 5DYDA 5B5BA 3F5CB 5JJMB 5ACCA 1L2JA 1T65A 1X7JA 4PF3A 2OVHA 1I37A 3D5FA 3RUTA 3OMKA 3UUDA 2Q59A 2I4PA 5DXPA 1FM6A 3A2IA 1H9UA 1U3SA 3DR1A 5DMFA 4LBDA 5HJPA 4G1DA 3D24A 2HASA 3UP3A 3WT5A 3RLLA 4QJRA 1EXXA 1G2NA 5KRCA 3V49A 4ITFA 2QA8A 2ZVTA 4DOSA 5JY3A 3U9QA 1XVPB 4ITEA 5EI1A 3TX7B 1XV9B 2B1ZA 1S19A 2PIWA 3VTBA 3VT4A 1YY4A 2XKWA 1PRGA 2ZXZA 4REEA 2J4AA 4PLEA 5DXRA 4FHIA 3R5NA 4KZIA 4RZGA 1OVLB 3HQ5A 4ZI1A 5KCCA 3HODA 5G44A 1NHZA 2W8YA 4TUZA 2LBDA 5DKBA 4P6WA 2AA7A 1A28A 2NPAA 5DKEA 5DRMA 3WGPA 4DK8A 2Z4BA 2ZNOA 3W0IA 3R2AA 4XUMA 1R1KA 1UOMA 2POBA 5HCVA 4OILA 3D6DA 2AAXA 1XDKB 1MZNA 3A9EB 4PRGA 5GICA 2B1VA 4IU7A 1R20A 5KR9A 2R6WA 3R8DA 5DWGA 3OMMA 2ZK3A 5DWEA 3VSPA 4X1FA 4OJ9A 5SYZA 1NAXA 2ZXNA 4UDDA 5JI0D 4NB6A 3OS8C 3PCUA 1FD0A 2OCFA 2VV3A 2JFAA 4MG9A 3HZFA 1FCZA 2QXMA 1XQCA 3AURA 3HM1A 3L0JA 4J24A 2PIXA 3MNOA 2HARA 3KDTA 1NRLA 1ILGA 3X36A 2QGWA 3OS9A 1XP6A 3HC6A 1ZKYA 4XHDA 4PXMA 5DZ3A 5C4TA 3ET1A 1PQ9A 5DX3A 5KYJA 3O1DA 4HLWA 2P54A
chains in the Genus database with same CATH superfamily
2VV4A 4IV4A 2HBHA 4Q0AC 5DI7A 1N46A 3ZR7A 3FUGA 3PO9A 2GPPA 4JYGA 1PK5A 5E1CA 2P15A 4DK7A 3OGTA 2QTUA 4MGDA 5FQSA 3FEIA 2YLPA 3OKIA 4RMEA 3W5TA 2XYJA 3S9SA 1FBYA 3PBAA 3EYBA 4XLDA 3H0AD 2B23A 5KRKA 3BQDA 1YMTA 5DXBB 4S0SA 2Q61A 3H0AA 2AX9A 3CDSA 5H1EA 2Q6JA 4ONIA 3K8SA 3AUNA 4FN9A 4MG7A 3DCTA 4NY9A 3FURA 3IPUA 4K6IA 2Q6RA 4KZMA 3GN8A 4OIVA 4OZRE 4WVDA 4QM0A 3W0YA 3IA6A 2AO6A 2VV1A 3OSWA 2QZOA 3R29A 3B0TA 2JJ3A 3DCUA 5DYBA 1XPCA 4KZJA 3X31A 3HLVA 4M8EA 3VRVA 1OSHA 4CI4A 4J5WA 3OLFA 4OEAA 4JL4A 3ET0A 4NQAB 1IE9A 1M7WA 2ZK5A 5AZTA 1I7GA 3ZRAA 2QNVA 2ZXMA 3IMYA 1X78A 3FEJA 5DXQA 1T7TA 5AVLA 3UVVA 2ABIA 3ILZA 5ICKA 3VHUA 1YA3A 5KRAA 2GPOA 2ZNNA 3B68A 1T7MA 2ZNQA 3AN3A 4PPPA 1S0ZA 5DIDA 3VRWA 4RZFA 3Q95A 3X1IA 4UDAA 3RY9A 1M13A 2AA5A 3UUDB 2YLOA 2Q59B 4OZTU 3CLDA 5DV8A 4IA3A 3B5RA 3DZYD 4DM8A 4G1ZA 5LWPA 1Q4XA 2FAIA 1I38A 5HJPB 5LGAA 4UDBA 3D57A 3H52A 3L1BA 3CWDA 3W0HA 4EM9A 4PP5A 2BAWA 4X1GA 2V0VA 5KD9A 2OVMA 4MGAA 2ACLA 2PINA 2QA8B 5G3JA 5G5WA 5KCUA 2HVCA 2QMVA 1U9EA 3ADVA 3OOKA 5C4SA 4JYHA 4MGCA 4MG8A 1NYXA 3ERDA 2P7ZA 5DIEA 1Y0SA 3B0QA 3G0WA 3KMZA 4A4VA 1KV6A 2POGA 2Q3YA 1DKFA 2Z4JA 3NOAA 4JAZA 5FQTA 5L7HA 3WT6A 5HZCA 4ZNSA 4TUZB 5EC9A 1T79A 5AWKA 3OLLA 3W0AA 1XZXX 3P89A 3CS6A 2O4JA 1NUOA 1OSVA 5ETHA 2J14A 3GBKA 3GYUA 1HG4A 4MGBA 4N5GA 4OKWA 5EJVA 4E4QA 1FM6D 1ZH7A 2ZNPA 1DB1A 1TXIA 4HEEX 5AYGA 1T73A 4ZN7A 3L0EA 3G8IA 2QPYA 4ZNHA 1LBDA 5C4OA 3BEJA 5IXKA 2OUZA 1KKQA 2Q7IA 4N1YA 4PP3A 3R8IA 3V9TA 3AN4A 1SQNA 2AX7A 2YLQA 4OIUA 3V9VA 2FVJA 3VT5A 2JFAB 3B67A 3GD2A 4FGYA 4MG9B 5DU5A 4ZJWA 1T7FA 4P6XA 2PIVA 5DZHA 1FM9A 5DSHA 2P1TA 1YIMA 3VT3A 3KYTA 3CTBA 4UDCA 4CSJA 3ZRBA 2GTKA 4DMAA 5DWJA 5DKGA 4XAOA 4IQRA 3AX8A 5DX3B 2QE4A 3VJIA 4POJA 3SP6A 3E7CA 3MNPA 2VV4B 3IXPD 3D90A 3CS4A 4PP6A 5C4UA 5DXKA 5DIGA 4ZN9A 2GL8A 3IXPA 1R1KD 5KRLA 3P0UA 1UHLA 2ZLAA 4IWCA 3W0CA 1YINA 3OOFA 4OC7A 4R6SA 5IAWA 5KRHA 5DWIA 5APHA 5M96A 3P88A 1R20D 4MGDB 3CS8A 3DZUD 1QKNA 2GWXA 4JYIA 5E15A 4M8HA 3QT0A 3OZJA 1M2ZA 2Q5SA 3DZUA 2O9IA 2QR9A 5KRFA 1ZDUA 2HC4A 4PWLA 2P4YA 3B3KA 2PITA 4MG7B 5IZ0A 4Y29A 4YT1A 1FCYA 4J26A 3RLJA 2G0HA 2Q6SA 1RKGA 2PIPL 2VV1B 4R2UA 4O8FA 4L96A 2QZOB 3SZ1A 4IA7A 3VJTA 4ZJRA 3GZ9A 4IS8A 1T63A 3KBAA 3M7RA 5DLRA 2Q7JA 1UPVA 1LV2A 3TKMA 3OAPA 5KCFA 3T03A 2AX8A 5DP0A 2ZMIA 2Q7KA 2PIOA 5DUEA 4QE8A 3ET2A 5E0WA 3AUQA 2H79A 1WM0X 2F4BA 3UU7A 3UVVB 3F7DA 2PJLA 4J5WC 2AM9A 2ZFXA 1Z5XU 3AFRA 2ZK4A 2I4ZA 3Q95B 1ZGYA 4ZNUA 1I7IA 2E2RA 3NSQA 3KPZA 4K4JA 1X76A 3WFGA 3BC5A 3W5QA 5G42A 1YYEA 4YNKA 1PZLA 1SKXA 2VSRA 3UUAA 5HYKA 5DRJA 2AYRA 3ET3A 5DZ0A 1KNUA 3RVFA 2I0JA 2GP7A 3OSIA 4MGAB 1IE8A 2ACLB 4RUOX 4DM6A 2IHQA 4DORA 1GWXA 2ZASA 5DZIA 5AWJA 2Q5PA 5KCDA 1OT7A 5A86A 2P7AA 1XIUA 5DL4A 4MG8B 4OZTE 5F9BA 3JZCA 3A2JA 3O1EA 1PQCA 2AXAA 4OGHA 3L03A 3VSOA 3GWSX 2AB2A 3N00A 3OSAA 4OARA 1DKFB 5DV3A 1SJ0A 4A2JA 3UUCA 1NAVA 3R8AA 3PLZA 3KFCA 2BJ4A 3W0GA 2AX6A 3L3ZA 1XB7A 1T76A 2Q5GA 1YUCA 3ZQTA 1ERRA 5E7VA 1X7RA 4OH6A 2ZLCA 4IV2A 2H77A 3AZ3A 4Q50A 4ZO1B 2PIUA 5DWLA 3CQVA 2ZK6A 2PIRA 2PKLA 3L3XA 3G9EA 5DTVA 5E14A 3FC6A 4REFA 3VT7A 2QABA 1ZAFA 2HWRA 2G0GA 4FHHA 3VTDA 3FS1A 3E00D 3AZ1A 1NQ0A 3E00A 4IA1A 4A4WA 1GWRA 1ILHA 1RKHA 4G2HA 3GYTA 3VRTA 1P93A 4QK4A 5DXEA 3G8OA 4RE8A 5AAVA 1ZEOA 3ADUA 3B1MA 3FALA 4CI5A 3KWYA 4FNEA 2REWA 2QA6A 3VI8A 3W5RA 3CJWA 3AZ2A 4OEDA 4R06A 4G1YA 2V7CA 2PNUA 4WPFA 1MV9A 2NV7A 3V4AA 4B7WA 3VT6A 4G2IA 1UHLB 1ZUCA 2P1UA 2QH6A 1X7EA 2YHDA 1RDTA 2ZMHA 4G20A 2QSEA 1FCXA 4WLBA 3WJ5A 3WTQA 5G43A 4IWFA 2EWPA 5EHJA 3WFFA 5E0XA 1BSXA 1K4WA 1Y0XX 1TFCA 4OK1A 5DZ1A 1L2IA 1XP9A 3KMGA 1HJ1A 2Q1VA 2ZMJA 5DV6A 2AMBA 1XNXA 3B0RA 2YFEA 3LBDA 1A52A 5G46A 2QXSA 2Q70A 5DUGA 4DQMA 1XOWA 1FM9D 2YJDA 2XHSA 1PDUA 3ERTA 3GWXA 3JZBA 5DK9A 3VT8A 3HVLA 2AA2A 4MG6A 4OEZA 1XQ3A 5CJ6A 2QGTA 3VHVA 3OZ0A 4YPQA 4K7AA 5KCWA 1XP1A 2YJAB 4WHGA 2PRGA 3VJHA 1EREA 4ZOMA 4J5XA 4WQPA 3VHWA 5K13A 1T5ZA 3HC5A 5G45A 3V3EA 3UP0A 2Q60A 3LMPA 4Q13A 4XI3A 3UU7B 3B65A 3WWRA 2I0GA 5HJSA 5KRIA 2ZBSA 1XNNA 2ATHA 3KMRA 4PPSA 2O4RA 2P1VA 4XUHA 3B66A 1PCGA 3FXVA 2FSZA 4BCRA 3A3ZX 5DVCA 4TV1A 3X1HA 3VJSA 5L7GA 3OMOA 1GS4A 2HCDA 5DVVA 3UUAB 4IA2A 2Q8SA 4S14A 1GWQA 1XLSE 3DT3A 3K22A 4RAKA 4RFWA 4RMCA 2Q1HA 4NUFA 1R5KA 3NSPA 2OZ7A 1Z5XE 1E3KA 3L0LA 2ZK2A 3F5CA 5JJMA 1QKUA 4ZNWA 3ADSA 3KDUA 3W0JA 5KRMA 4S0TA 2ZK1A 5KRJA 4RUJA 1XAPA 2P7GA 3R5MA 4OFUA 3ADWA 4QE6A 4S15A 4F9MA 2G5OA 5AZVA 2G44A 4LNXA 4N8RA 3DY6A 3P8XA 4POHA 1YP0A 2HWQA 2VSTA 2IOGA 2AMAA 3ADXA 2HB8A 4RUPA 4E4KA 4XT9A 2BJ4B 3IPSA 1XVPA 4G21A 4JGVA 1XV9A 5GT4A 3PEQA 1SR7A 1E3GA 1EXAA 3W5PA 1P8DA 1YOKA 3OMQA 1OVLA 1NQ7A 4LNWA 5DXGA 3V3QA 2B50A 1Z95A 5L7EA 1NQ2A 2R40D 3FC6B 4APUA 2IOKA 3TKCA 1S0XA 3B0WA 2R40A 1QKMA 2NXXA 1XJ7A 1R6GA 1ZDTA 2AA6A 3OKHA 4OKXA 3V9YA 2R6YA 4ZNVA 3PRGA 3VN2A 4PVUA 5APKA 2GIUA 2HB7A 1K74D 4NIEA 2I4JA 4OLMA 5DXMA 4ZNTA 5KCTA 1N83A 4QL8A 5KCEA 1G5YA 1K74A 1XDKA 5AK2A 5AAVB 3A9EA 5KYAA 3OS8A 3FALB 5DKSA 4IVYA 4OJBA 3ADTA 3K23A 4OKTA 4MG5A 4RWVA 2JF9A 3TY0A 1G1UA 2NW4A 5EGVA 2QW4A 2YATA 3WMHA 3E94A 1S9QA 2J7YA 3A2HA 3HO0A 4YMQA 5L11A 2ZKCA 2AWHA 2XYXA 4MGBB 4OHAA 2GPVA 4IUIA 1UPWA 2ZL9A 2VV2A 4N73A 3VTCA 3K6PA 1Y9RA 4PLDA 3SP9A 4IW6A 5GIDA 2OM9A 2HAMA 4OJ4A 2YLYA 1XLSA 1G50A 2VV0A 1U3QA 3OMPA 5DUHA 4WHFA 4EMAA 1X7BA 5DVSA 4IW8A 4OH5A 4OZRU 3WJ4A 1RJKA 4LSJA 5DMCA 1U3RA 3CDPA 1QKTA 4OKBA 5E19A 5FQPA 2PIQA 3WT7A 2Q7LA 4MDDA 5DXBA 1NDEA 3FLIA 4OFRA 5EITA 3A78A 3DZYA 1RDTD 5DY8A 1K7LA 2ZK0A 4RMDA 4OEYA 4J5XC 5B41A 2HFPA 1S9PA 5APJA 5FQRA 3VRUA 2J7XA 2ZY0A 4L98A 3IPQA 1PQ6A 2XYWA 1MVCA 2A3IA 3OLSA 1NQ1A 2OAXA 1RK3A 1YJEA 4TV1B 3VT9A 5AAUA 5HYRA 5FQVA 2GPUA 4RZEA 4XTAA 4ZO1X 1T74A 4E2JA 5I4VA 4LTWA 3A40X 3RUUA 1N4HA 1VJBA 4IVWA 1YOWA 5AVIA 5GIEA 5KROA 2NXXE 1T7RA 3MNEA 5DYDA 5B5BA 3F5CB 5JJMB 5ACCA 1L2JA 1T65A 1X7JA 4PF3A 2OVHA 1I37A 3D5FA 3RUTA 3OMKA 3UUDA 2Q59A 2I4PA 5DXPA 1FM6A 3A2IA 1H9UA 1U3SA 3DR1A 5DMFA 4LBDA 5HJPA 4G1DA 3D24A 2HASA 3UP3A 3WT5A 3RLLA 4QJRA 1EXXA 1G2NA 5KRCA 3V49A 4ITFA 2QA8A 2ZVTA 4DOSA 5JY3A 3U9QA 1XVPB 4ITEA 5EI1A 3TX7B 1XV9B 2B1ZA 1S19A 2PIWA 3VTBA 3VT4A 1YY4A 2XKWA 1PRGA 2ZXZA 4REEA 2J4AA 4PLEA 5DXRA 4FHIA 3R5NA 4KZIA 4RZGA 1OVLB 3HQ5A 4ZI1A 5KCCA 3HODA 5G44A 1NHZA 2W8YA 4TUZA 2LBDA 5DKBA 4P6WA 2AA7A 1A28A 2NPAA 5DKEA 5DRMA 3WGPA 4DK8A 2Z4BA 2ZNOA 3W0IA 3R2AA 4XUMA 1R1KA 1UOMA 2POBA 5HCVA 4OILA 3D6DA 2AAXA 1XDKB 1MZNA 3A9EB 4PRGA 5GICA 2B1VA 4IU7A 1R20A 5KR9A 2R6WA 3R8DA 5DWGA 3OMMA 2ZK3A 5DWEA 3VSPA 4X1FA 4OJ9A 5SYZA 1NAXA 2ZXNA 4UDDA 5JI0D 4NB6A 3OS8C 3PCUA 1FD0A 2OCFA 2VV3A 2JFAA 4MG9A 3HZFA 1FCZA 2QXMA 1XQCA 3AURA 3HM1A 3L0JA 4J24A 2PIXA 3MNOA 2HARA 3KDTA 1NRLA 1ILGA 3X36A 2QGWA 3OS9A 1XP6A 3HC6A 1ZKYA 4XHDA 4PXMA 5DZ3A 5C4TA 3ET1A 1PQ9A 5DX3A 5KYJA 3O1DA 4HLWA 2P54A
chains in the Genus database with same CATH topology
2VV4A 4IV4A 2HBHA 4Q0AC 5DI7A 1N46A 3ZR7A 3FUGA 3PO9A 2GPPA 4JYGA 1PK5A 5E1CA 2P15A 4DK7A 3OGTA 2QTUA 4MGDA 5FQSA 3FEIA 2YLPA 3OKIA 4RMEA 3W5TA 2XYJA 3S9SA 1FBYA 3PBAA 3EYBA 4XLDA 3H0AD 2B23A 5KRKA 3BQDA 1YMTA 5DXBB 4S0SA 2Q61A 3H0AA 2AX9A 3CDSA 5H1EA 2Q6JA 4ONIA 3K8SA 3AUNA 4FN9A 4MG7A 3DCTA 4NY9A 3FURA 3IPUA 4K6IA 2Q6RA 4KZMA 3GN8A 4OIVA 4OZRE 4WVDA 4QM0A 3W0YA 3IA6A 2AO6A 2VV1A 3OSWA 2QZOA 3R29A 3B0TA 2JJ3A 3DCUA 5DYBA 1XPCA 4KZJA 3X31A 3HLVA 4M8EA 3VRVA 1OSHA 4CI4A 4J5WA 3OLFA 4OEAA 4JL4A 3ET0A 4NQAB 1IE9A 1M7WA 2ZK5A 5AZTA 1I7GA 3ZRAA 2QNVA 2ZXMA 3IMYA 1X78A 3FEJA 5DXQA 1T7TA 5AVLA 3UVVA 2ABIA 3ILZA 5ICKA 3VHUA 1YA3A 5KRAA 2GPOA 2ZNNA 3B68A 1T7MA 2ZNQA 3AN3A 4PPPA 1S0ZA 5DIDA 3VRWA 4RZFA 3Q95A 3X1IA 4UDAA 3RY9A 1M13A 2AA5A 3UUDB 2YLOA 2Q59B 4OZTU 3CLDA 5DV8A 4IA3A 3B5RA 3DZYD 4DM8A 4G1ZA 5LWPA 1Q4XA 2FAIA 1I38A 5HJPB 5LGAA 4UDBA 3D57A 3H52A 3L1BA 3CWDA 3W0HA 4EM9A 4PP5A 2BAWA 4X1GA 2V0VA 5KD9A 2OVMA 4MGAA 2ACLA 2PINA 2QA8B 5G3JA 5G5WA 5KCUA 2HVCA 2QMVA 1U9EA 3ADVA 3OOKA 5C4SA 4JYHA 4MGCA 4MG8A 1NYXA 3ERDA 2P7ZA 5DIEA 1Y0SA 3B0QA 3G0WA 3KMZA 4A4VA 1KV6A 2POGA 2Q3YA 1DKFA 2Z4JA 3NOAA 4JAZA 5FQTA 5L7HA 3WT6A 5HZCA 4ZNSA 4TUZB 5EC9A 1T79A 5AWKA 3OLLA 3W0AA 1XZXX 3P89A 3CS6A 2O4JA 1NUOA 1OSVA 5ETHA 2J14A 3GBKA 3GYUA 1HG4A 4MGBA 4N5GA 4OKWA 5EJVA 4E4QA 1FM6D 1ZH7A 2ZNPA 1DB1A 1TXIA 4HEEX 5AYGA 1T73A 4ZN7A 3L0EA 3G8IA 2QPYA 4ZNHA 1LBDA 5C4OA 3BEJA 5IXKA 2OUZA 1KKQA 2Q7IA 4N1YA 4PP3A 3R8IA 3V9TA 3AN4A 1SQNA 2AX7A 2YLQA 4OIUA 3V9VA 2FVJA 3VT5A 2JFAB 3B67A 3GD2A 4FGYA 4MG9B 5DU5A 4ZJWA 1T7FA 4P6XA 2PIVA 5DZHA 1FM9A 5DSHA 2P1TA 1YIMA 3VT3A 3KYTA 3CTBA 4UDCA 4CSJA 3ZRBA 2GTKA 4DMAA 5DWJA 5DKGA 4XAOA 4IQRA 3AX8A 5DX3B 2QE4A 3VJIA 4POJA 3SP6A 3E7CA 3MNPA 2VV4B 3IXPD 3D90A 3CS4A 4PP6A 5C4UA 5DXKA 5DIGA 4ZN9A 2GL8A 3IXPA 1R1KD 5KRLA 3P0UA 1UHLA 2ZLAA 4IWCA 3W0CA 1YINA 3OOFA 4OC7A 4R6SA 5IAWA 5KRHA 5DWIA 5APHA 5M96A 3P88A 1R20D 4MGDB 3CS8A 3DZUD 1QKNA 2GWXA 4JYIA 5E15A 4M8HA 3QT0A 3OZJA 1M2ZA 2Q5SA 3DZUA 2O9IA 2QR9A 5KRFA 1ZDUA 2HC4A 4PWLA 2P4YA 3B3KA 2PITA 4MG7B 5IZ0A 4Y29A 4YT1A 1FCYA 4J26A 3RLJA 2G0HA 2Q6SA 1RKGA 2PIPL 2VV1B 4R2UA 4O8FA 4L96A 2QZOB 3SZ1A 4IA7A 3VJTA 4ZJRA 3GZ9A 4IS8A 1T63A 3KBAA 3M7RA 5DLRA 2Q7JA 1UPVA 1LV2A 3TKMA 3OAPA 5KCFA 3T03A 2AX8A 5DP0A 2ZMIA 2Q7KA 2PIOA 5DUEA 4QE8A 3ET2A 5E0WA 3AUQA 2H79A 1WM0X 2F4BA 3UU7A 3UVVB 3F7DA 2PJLA 4J5WC 2AM9A 2ZFXA 1Z5XU 3AFRA 2ZK4A 2I4ZA 3Q95B 1ZGYA 4ZNUA 1I7IA 2E2RA 3NSQA 3KPZA 4K4JA 1X76A 3WFGA 3BC5A 3W5QA 5G42A 1YYEA 4YNKA 1PZLA 1SKXA 2VSRA 3UUAA 5HYKA 5DRJA 2AYRA 3ET3A 5DZ0A 1KNUA 3RVFA 2I0JA 2GP7A 3OSIA 4MGAB 1IE8A 2ACLB 4RUOX 4DM6A 2IHQA 4DORA 1GWXA 2ZASA 5DZIA 5AWJA 2Q5PA 5KCDA 1OT7A 5A86A 2P7AA 1XIUA 5DL4A 4MG8B 4OZTE 5F9BA 3JZCA 3A2JA 3O1EA 1PQCA 2AXAA 4OGHA 3L03A 3VSOA 3GWSX 2AB2A 3N00A 3OSAA 4OARA 1DKFB 5DV3A 1SJ0A 4A2JA 3UUCA 1NAVA 3R8AA 3PLZA 3KFCA 2BJ4A 3W0GA 2AX6A 3L3ZA 1XB7A 1T76A 2Q5GA 1YUCA 3ZQTA 1ERRA 5E7VA 1X7RA 4OH6A 2ZLCA 4IV2A 2H77A 3AZ3A 4Q50A 4ZO1B 2PIUA 5DWLA 3CQVA 2ZK6A 2PIRA 2PKLA 3L3XA 3G9EA 5DTVA 5E14A 3FC6A 4REFA 3VT7A 2QABA 1ZAFA 2HWRA 2G0GA 4FHHA 3VTDA 3FS1A 3E00D 3AZ1A 1NQ0A 3E00A 4IA1A 4A4WA 1GWRA 1ILHA 1RKHA 4G2HA 3GYTA 3VRTA 1P93A 4QK4A 5DXEA 3G8OA 4RE8A 5AAVA 1ZEOA 3ADUA 3B1MA 3FALA 4CI5A 3KWYA 4FNEA 2REWA 2QA6A 3VI8A 3W5RA 3CJWA 3AZ2A 4OEDA 4R06A 4G1YA 2V7CA 2PNUA 4WPFA 1MV9A 2NV7A 3V4AA 4B7WA 3VT6A 4G2IA 1UHLB 1ZUCA 2P1UA 2QH6A 1X7EA 2YHDA 1RDTA 2ZMHA 4G20A 2QSEA 1FCXA 4WLBA 3WJ5A 3WTQA 5G43A 4IWFA 2EWPA 5EHJA 3WFFA 5E0XA 1BSXA 1K4WA 1Y0XX 1TFCA 4OK1A 5DZ1A 1L2IA 1XP9A 3KMGA 1HJ1A 2Q1VA 2ZMJA 5DV6A 2AMBA 1XNXA 3B0RA 2YFEA 3LBDA 1A52A 5G46A 2QXSA 2Q70A 5DUGA 4DQMA 1XOWA 1FM9D 2YJDA 2XHSA 1PDUA 3ERTA 3GWXA 3JZBA 5DK9A 3VT8A 3HVLA 2AA2A 4MG6A 4OEZA 1XQ3A 5CJ6A 2QGTA 3VHVA 3OZ0A 4YPQA 4K7AA 5KCWA 1XP1A 2YJAB 4WHGA 2PRGA 3VJHA 1EREA 4ZOMA 4J5XA 4WQPA 3VHWA 5K13A 1T5ZA 3HC5A 5G45A 3V3EA 3UP0A 2Q60A 3LMPA 4Q13A 4XI3A 3UU7B 3B65A 3WWRA 2I0GA 5HJSA 5KRIA 2ZBSA 1XNNA 2ATHA 3KMRA 4PPSA 2O4RA 2P1VA 4XUHA 3B66A 1PCGA 3FXVA 2FSZA 4BCRA 3A3ZX 5DVCA 4TV1A 3X1HA 3VJSA 5L7GA 3OMOA 1GS4A 2HCDA 5DVVA 3UUAB 4IA2A 2Q8SA 4S14A 1GWQA 1XLSE 3DT3A 3K22A 4RAKA 4RFWA 4RMCA 2Q1HA 4NUFA 1R5KA 3NSPA 2OZ7A 1Z5XE 1E3KA 3L0LA 2ZK2A 3F5CA 5JJMA 1QKUA 4ZNWA 3ADSA 3KDUA 3W0JA 5KRMA 4S0TA 2ZK1A 5KRJA 4RUJA 1XAPA 2P7GA 3R5MA 4OFUA 3ADWA 4QE6A 4S15A 4F9MA 2G5OA 5AZVA 2G44A 4LNXA 4N8RA 3DY6A 3P8XA 4POHA 1YP0A 2HWQA 2VSTA 2IOGA 2AMAA 3ADXA 2HB8A 4RUPA 4E4KA 4XT9A 2BJ4B 3IPSA 1XVPA 4G21A 4JGVA 1XV9A 5GT4A 3PEQA 1SR7A 1E3GA 1EXAA 3W5PA 1P8DA 1YOKA 3OMQA 1OVLA 1NQ7A 4LNWA 5DXGA 3V3QA 2B50A 1Z95A 5L7EA 1NQ2A 2R40D 3FC6B 4APUA 2IOKA 3TKCA 1S0XA 3B0WA 2R40A 1QKMA 2NXXA 1XJ7A 1R6GA 1ZDTA 2AA6A 3OKHA 4OKXA 3V9YA 2R6YA 4ZNVA 3PRGA 3VN2A 4PVUA 5APKA 2GIUA 2HB7A 1K74D 4NIEA 2I4JA 4OLMA 5DXMA 4ZNTA 5KCTA 1N83A 4QL8A 5KCEA 1G5YA 1K74A 1XDKA 5AK2A 5AAVB 3A9EA 5KYAA 3OS8A 3FALB 5DKSA 4IVYA 4OJBA 3ADTA 3K23A 4OKTA 4MG5A 4RWVA 2JF9A 3TY0A 1G1UA 2NW4A 5EGVA 2QW4A 2YATA 3WMHA 3E94A 1S9QA 2J7YA 3A2HA 3HO0A 4YMQA 5L11A 2ZKCA 2AWHA 2XYXA 4MGBB 4OHAA 2GPVA 4IUIA 1UPWA 2ZL9A 2VV2A 4N73A 3VTCA 3K6PA 1Y9RA 4PLDA 3SP9A 4IW6A 5GIDA 2OM9A 2HAMA 4OJ4A 2YLYA 1XLSA 1G50A 2VV0A 1U3QA 3OMPA 5DUHA 4WHFA 4EMAA 1X7BA 5DVSA 4IW8A 4OH5A 4OZRU 3WJ4A 1RJKA 4LSJA 5DMCA 1U3RA 3CDPA 1QKTA 4OKBA 5E19A 5FQPA 2PIQA 3WT7A 2Q7LA 4MDDA 5DXBA 1NDEA 3FLIA 4OFRA 5EITA 3A78A 3DZYA 1RDTD 5DY8A 1K7LA 2ZK0A 4RMDA 4OEYA 4J5XC 5B41A 2HFPA 1S9PA 5APJA 5FQRA 3VRUA 2J7XA 2ZY0A 4L98A 3IPQA 1PQ6A 2XYWA 1MVCA 2A3IA 3OLSA 1NQ1A 2OAXA 1RK3A 1YJEA 4TV1B 3VT9A 5AAUA 5HYRA 5FQVA 2GPUA 4RZEA 4XTAA 4ZO1X 1T74A 4E2JA 5I4VA 4LTWA 3A40X 3RUUA 1N4HA 1VJBA 4IVWA 1YOWA 5AVIA 5GIEA 5KROA 2NXXE 1T7RA 3MNEA 5DYDA 5B5BA 3F5CB 5JJMB 5ACCA 1L2JA 1T65A 1X7JA 4PF3A 2OVHA 1I37A 3D5FA 3RUTA 3OMKA 3UUDA 2Q59A 2I4PA 5DXPA 1FM6A 3A2IA 1H9UA 1U3SA 3DR1A 5DMFA 4LBDA 5HJPA 4G1DA 3D24A 2HASA 3UP3A 3WT5A 3RLLA 4QJRA 1EXXA 1G2NA 5KRCA 3V49A 4ITFA 2QA8A 2ZVTA 4DOSA 5JY3A 3U9QA 1XVPB 4ITEA 5EI1A 3TX7B 1XV9B 2B1ZA 1S19A 2PIWA 3VTBA 3VT4A 1YY4A 2XKWA 1PRGA 2ZXZA 4REEA 2J4AA 4PLEA 5DXRA 4FHIA 3R5NA 4KZIA 4RZGA 1OVLB 3HQ5A 4ZI1A 5KCCA 3HODA 5G44A 1NHZA 2W8YA 4TUZA 2LBDA 5DKBA 4P6WA 2AA7A 1A28A 2NPAA 5DKEA 5DRMA 3WGPA 4DK8A 2Z4BA 2ZNOA 3W0IA 3R2AA 4XUMA 1R1KA 1UOMA 2POBA 5HCVA 4OILA 3D6DA 2AAXA 1XDKB 1MZNA 3A9EB 4PRGA 5GICA 2B1VA 4IU7A 1R20A 5KR9A 2R6WA 3R8DA 5DWGA 3OMMA 2ZK3A 5DWEA 3VSPA 4X1FA 4OJ9A 5SYZA 1NAXA 2ZXNA 4UDDA 5JI0D 4NB6A 3OS8C 3PCUA 1FD0A 2OCFA 2VV3A 2JFAA 4MG9A 3HZFA 1FCZA 2QXMA 1XQCA 3AURA 3HM1A 3L0JA 4J24A 2PIXA 3MNOA 2HARA 3KDTA 1NRLA 1ILGA 3X36A 2QGWA 3OS9A 1XP6A 3HC6A 1ZKYA 4XHDA 4PXMA 5DZ3A 5C4TA 3ET1A 1PQ9A 5DX3A 5KYJA 3O1DA 4HLWA 2P54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VV4 A;  4IV4 A;  2HBH A;  4Q0A C;  5DI7 A;  1N46 A;  3ZR7 A;  3FUG A;  3PO9 A;  2GPP A;  4JYG A;  1PK5 A;  5E1C A;  2P15 A;  4DK7 A;  3OGT A;  2QTU A;  4MGD A;  5FQS A;  3FEI A;  2YLP A;  3OKI A;  4RME A;  3W5T A;  2XYJ A;  3S9S A;  1FBY A;  3PBA A;  3EYB A;  4XLD A;  3H0A D;  2B23 A;  5KRK A;  3BQD A;  1YMT A;  5DXB B;  4S0S A;  2Q61 A;  3H0A A;  2AX9 A;  3CDS A;  5H1E A;  2Q6J A;  4ONI A;  3K8S A;  3AUN A;  4FN9 A;  4MG7 A;  3DCT A;  4NY9 A;  3FUR A;  3IPU A;  4K6I A;  2Q6R A;  4KZM A;  3GN8 A;  4OIV A;  4OZR E;  4WVD A;  4QM0 A;  3W0Y A;  3IA6 A;  2AO6 A;  2VV1 A;  3OSW A;  2QZO A;  3R29 A;  3B0T A;  2JJ3 A;  3DCU A;  5DYB A;  1XPC A;  4KZJ A;  3X31 A;  3HLV A;  4M8E A;  3VRV A;  1OSH A;  4CI4 A;  4J5W A;  3OLF A;  4OEA A;  4JL4 A;  3ET0 A;  4NQA B;  1IE9 A;  1M7W A;  2ZK5 A;  5AZT A;  1I7G A;  3ZRA A;  2QNV A;  2ZXM A;  3IMY A;  1X78 A;  3FEJ A;  5DXQ A;  1T7T A;  5AVL A;  3UVV A;  2ABI A;  3ILZ A;  5ICK A;  3VHU A;  1YA3 A;  5KRA A;  2GPO A;  2ZNN A;  3B68 A;  1T7M A;  2ZNQ A;  3AN3 A;  4PPP A;  1S0Z A;  5DID A;  3VRW A;  4RZF A;  3Q95 A;  3X1I A;  4UDA A;  3RY9 A;  1M13 A;  2AA5 A;  3UUD B;  2YLO A;  2Q59 B;  4OZT U;  3CLD A;  5DV8 A;  4IA3 A;  3B5R A;  3DZY D;  4DM8 A;  4G1Z A;  5LWP A;  1Q4X A;  2FAI A;  1I38 A;  5HJP B;  5LGA A;  4UDB A;  3D57 A;  3H52 A;  3L1B A;  3CWD A;  3W0H A;  4EM9 A;  4PP5 A;  2BAW A;  4X1G A;  2V0V A;  5KD9 A;  2OVM A;  4MGA A;  2ACL A;  2PIN A;  2QA8 B;  5G3J A;  5G5W A;  5KCU A;  2HVC A;  2QMV A;  1U9E A;  3ADV A;  3OOK A;  5C4S A;  4JYH A;  4MGC A;  4MG8 A;  1NYX A;  3ERD A;  2P7Z A;  5DIE A;  1Y0S A;  3B0Q A;  3G0W A;  3KMZ A;  4A4V A;  1KV6 A;  2POG A;  2Q3Y A;  1DKF A;  2Z4J A;  3NOA A;  4JAZ A;  5FQT A;  5L7H A;  3WT6 A;  5HZC A;  4ZNS A;  4TUZ B;  5EC9 A;  1T79 A;  5AWK A;  3OLL A;  3W0A A;  1XZX X;  3P89 A;  3CS6 A;  2O4J A;  1NUO A;  1OSV A;  5ETH A;  2J14 A;  3GBK A;  3GYU A;  1HG4 A;  4MGB A;  4N5G A;  4OKW A;  5EJV A;  4E4Q A;  1FM6 D;  1ZH7 A;  2ZNP A;  1DB1 A;  1TXI A;  4HEE X;  5AYG A;  1T73 A;  4ZN7 A;  3L0E A;  3G8I A;  2QPY A;  4ZNH A;  1LBD A;  5C4O A;  3BEJ A;  5IXK A;  2OUZ A;  1KKQ A;  2Q7I A;  4N1Y A;  4PP3 A;  3R8I A;  3V9T A;  3AN4 A;  1SQN A;  2AX7 A;  2YLQ A;  4OIU A;  3V9V A;  2FVJ A;  3VT5 A;  2JFA B;  3B67 A;  3GD2 A;  4FGY A;  4MG9 B;  5DU5 A;  4ZJW A;  1T7F A;  4P6X A;  2PIV A;  5DZH A;  1FM9 A;  5DSH A;  2P1T A;  1YIM A;  3VT3 A;  3KYT A;  3CTB A;  4UDC A;  4CSJ A;  3ZRB A;  2GTK A;  4DMA A;  5DWJ A;  5DKG A;  4XAO A;  4IQR A;  3AX8 A;  5DX3 B;  2QE4 A;  3VJI A;  4POJ A;  3SP6 A;  3E7C A;  3MNP A;  2VV4 B;  3IXP D;  3D90 A;  3CS4 A;  4PP6 A;  5C4U A;  5DXK A;  5DIG A;  4ZN9 A;  2GL8 A;  3IXP A;  1R1K D;  5KRL A;  3P0U A;  1UHL A;  2ZLA A;  4IWC A;  3W0C A;  1YIN A;  3OOF A;  4OC7 A;  4R6S A;  5IAW A;  5KRH A;  5DWI A;  5APH A;  5M96 A;  3P88 A;  1R20 D;  4MGD B;  3CS8 A;  3DZU D;  1QKN A;  2GWX A;  4JYI A;  5E15 A;  4M8H A;  3QT0 A;  3OZJ A;  1M2Z A;  2Q5S A;  3DZU A;  2O9I A;  2QR9 A;  5KRF A;  1ZDU A;  2HC4 A;  4PWL A;  2P4Y A;  3B3K A;  2PIT A;  4MG7 B;  5IZ0 A;  4Y29 A;  4YT1 A;  1FCY A;  4J26 A;  3RLJ A;  2G0H A;  2Q6S A;  1RKG A;  2PIP L;  2VV1 B;  4R2U A;  4O8F A;  4L96 A;  2QZO B;  3SZ1 A;  4IA7 A;  3VJT A;  4ZJR A;  3GZ9 A;  4IS8 A;  1T63 A;  3KBA A;  3M7R A;  5DLR A;  2Q7J A;  1UPV A;  1LV2 A;  3TKM A;  3OAP A;  5KCF A;  3T03 A;  2AX8 A;  5DP0 A;  2ZMI A;  2Q7K A;  2PIO A;  5DUE A;  4QE8 A;  3ET2 A;  5E0W A;  3AUQ A;  2H79 A;  1WM0 X;  2F4B A;  3UU7 A;  3UVV B;  3F7D A;  2PJL A;  4J5W C;  2AM9 A;  2ZFX A;  1Z5X U;  3AFR A;  2ZK4 A;  2I4Z A;  3Q95 B;  1ZGY A;  4ZNU A;  1I7I A;  2E2R A;  3NSQ A;  3KPZ A;  4K4J A;  1X76 A;  3WFG A;  3BC5 A;  3W5Q A;  5G42 A;  1YYE A;  4YNK A;  1PZL A;  1SKX A;  2VSR A;  3UUA A;  5HYK A;  5DRJ A;  2AYR A;  3ET3 A;  5DZ0 A;  1KNU A;  3RVF A;  2I0J A;  2GP7 A;  3OSI A;  4MGA B;  1IE8 A;  2ACL B;  4RUO X;  4DM6 A;  2IHQ A;  4DOR A;  1GWX A;  2ZAS A;  5DZI A;  5AWJ A;  2Q5P A;  5KCD A;  1OT7 A;  5A86 A;  2P7A A;  1XIU A;  5DL4 A;  4MG8 B;  4OZT E;  5F9B A;  3JZC A;  3A2J A;  3O1E A;  1PQC A;  2AXA A;  4OGH A;  3L03 A;  3VSO A;  3GWS X;  2AB2 A;  3N00 A;  3OSA A;  4OAR A;  1DKF B;  5DV3 A;  1SJ0 A;  4A2J A;  3UUC A;  1NAV A;  3R8A A;  3PLZ A;  3KFC A;  2BJ4 A;  3W0G A;  2AX6 A;  3L3Z A;  1XB7 A;  1T76 A;  2Q5G A;  1YUC A;  3ZQT A;  1ERR A;  5E7V A;  1X7R A;  4OH6 A;  2ZLC A;  4IV2 A;  2H77 A;  3AZ3 A;  4Q50 A;  4ZO1 B;  2PIU A;  5DWL A;  3CQV A;  2ZK6 A;  2PIR A;  2PKL A;  3L3X A;  3G9E A;  5DTV A;  5E14 A;  3FC6 A;  4REF A;  3VT7 A;  2QAB A;  1ZAF A;  2HWR A;  2G0G A;  4FHH A;  3VTD A;  3FS1 A;  3E00 D;  3AZ1 A;  1NQ0 A;  3E00 A;  4IA1 A;  4A4W A;  1GWR A;  1ILH A;  1RKH A;  4G2H A;  3GYT A;  3VRT A;  1P93 A;  4QK4 A;  5DXE A;  3G8O A;  4RE8 A;  5AAV A;  1ZEO A;  3ADU A;  3B1M A;  3FAL A;  4CI5 A;  3KWY A;  4FNE A;  2REW A;  2QA6 A;  3VI8 A;  3W5R A;  3CJW A;  3AZ2 A;  4OED A;  4R06 A;  4G1Y A;  2V7C A;  2PNU A;  4WPF A;  1MV9 A;  2NV7 A;  3V4A A;  4B7W A;  3VT6 A;  4G2I A;  1UHL B;  1ZUC A;  2P1U A;  2QH6 A;  1X7E A;  2YHD A;  1RDT A;  2ZMH A;  4G20 A;  2QSE A;  1FCX A;  4WLB A;  3WJ5 A;  3WTQ A;  5G43 A;  4IWF A;  2EWP A;  5EHJ A;  3WFF A;  5E0X A;  1BSX A;  1K4W A;  1Y0X X;  1TFC A;  4OK1 A;  5DZ1 A;  1L2I A;  1XP9 A;  3KMG A;  1HJ1 A;  2Q1V A;  2ZMJ A;  5DV6 A;  2AMB A;  1XNX A;  3B0R A;  2YFE A;  3LBD A;  1A52 A;  5G46 A;  2QXS A;  2Q70 A;  5DUG A;  4DQM A;  1XOW A;  1FM9 D;  2YJD A;  2XHS A;  1PDU A;  3ERT A;  3GWX A;  3JZB A;  5DK9 A;  3VT8 A;  3HVL A;  2AA2 A;  4MG6 A;  4OEZ A;  1XQ3 A;  5CJ6 A;  2QGT A;  3VHV A;  3OZ0 A;  4YPQ A;  4K7A A;  5KCW A;  1XP1 A;  2YJA B;  4WHG A;  2PRG A;  3VJH A;  1ERE A;  4ZOM A;  4J5X A;  4WQP A;  3VHW A;  5K13 A;  1T5Z A;  3HC5 A;  5G45 A;  3V3E A;  3UP0 A;  2Q60 A;  3LMP A;  4Q13 A;  4XI3 A;  3UU7 B;  3B65 A;  3WWR A;  2I0G A;  5HJS A;  5KRI A;  2ZBS A;  1XNN A;  2ATH A;  3KMR A;  4PPS A;  2O4R A;  2P1V A;  4XUH A;  3B66 A;  1PCG A;  3FXV A;  2FSZ A;  4BCR A;  3A3Z X;  5DVC A;  4TV1 A;  3X1H A;  3VJS A;  5L7G A;  3OMO A;  1GS4 A;  2HCD A;  5DVV A;  3UUA B;  4IA2 A;  2Q8S A;  4S14 A;  1GWQ A;  1XLS E;  3DT3 A;  3K22 A;  4RAK A;  4RFW A;  4RMC A;  2Q1H A;  4NUF A;  1R5K A;  3NSP A;  2OZ7 A;  1Z5X E;  1E3K A;  3L0L A;  2ZK2 A;  3F5C A;  5JJM A;  1QKU A;  4ZNW A;  3ADS A;  3KDU A;  3W0J A;  5KRM A;  4S0T A;  2ZK1 A;  5KRJ A;  4RUJ A;  1XAP A;  2P7G A;  3R5M A;  4OFU A;  3ADW A;  4QE6 A;  4S15 A;  4F9M A;  2G5O A;  5AZV A;  2G44 A;  4LNX A;  4N8R A;  3DY6 A;  3P8X A;  4POH A;  1YP0 A;  2HWQ A;  2VST A;  2IOG A;  2AMA A;  3ADX A;  2HB8 A;  4RUP A;  4E4K A;  4XT9 A;  2BJ4 B;  3IPS A;  1XVP A;  4G21 A;  4JGV A;  1XV9 A;  5GT4 A;  3PEQ A;  1SR7 A;  1E3G A;  1EXA A;  3W5P A;  1P8D A;  1YOK A;  3OMQ A;  1OVL A;  1NQ7 A;  4LNW A;  5DXG A;  3V3Q A;  2B50 A;  1Z95 A;  5L7E A;  1NQ2 A;  2R40 D;  3FC6 B;  4APU A;  2IOK A;  3TKC A;  1S0X A;  3B0W A;  2R40 A;  1QKM A;  2NXX A;  1XJ7 A;  1R6G A;  1ZDT A;  2AA6 A;  3OKH A;  4OKX A;  3V9Y A;  2R6Y A;  4ZNV A;  3PRG A;  3VN2 A;  4PVU A;  5APK A;  2GIU A;  2HB7 A;  1K74 D;  4NIE A;  2I4J A;  4OLM A;  5DXM A;  4ZNT A;  5KCT A;  1N83 A;  4QL8 A;  5KCE A;  1G5Y A;  1K74 A;  1XDK A;  5AK2 A;  5AAV B;  3A9E A;  5KYA A;  3OS8 A;  3FAL B;  5DKS A;  4IVY A;  4OJB A;  3ADT A;  3K23 A;  4OKT A;  4MG5 A;  4RWV A;  2JF9 A;  3TY0 A;  1G1U A;  2NW4 A;  5EGV A;  2QW4 A;  2YAT A;  3WMH A;  3E94 A;  1S9Q A;  2J7Y A;  3A2H A;  3HO0 A;  4YMQ A;  5L11 A;  2ZKC A;  2AWH A;  2XYX A;  4MGB B;  4OHA A;  2GPV A;  4IUI A;  1UPW A;  2ZL9 A;  2VV2 A;  4N73 A;  3VTC A;  3K6P A;  1Y9R A;  4PLD A;  3SP9 A;  4IW6 A;  5GID A;  2OM9 A;  2HAM A;  4OJ4 A;  2YLY A;  1XLS A;  1G50 A;  2VV0 A;  1U3Q A;  3OMP A;  5DUH A;  4WHF A;  4EMA A;  1X7B A;  5DVS A;  4IW8 A;  4OH5 A;  4OZR U;  3WJ4 A;  1RJK A;  4LSJ A;  5DMC A;  1U3R A;  3CDP A;  1QKT A;  4OKB A;  5E19 A;  5FQP A;  2PIQ A;  3WT7 A;  2Q7L A;  4MDD A;  5DXB A;  1NDE A;  3FLI A;  4OFR A;  5EIT A;  3A78 A;  3DZY A;  1RDT D;  5DY8 A;  1K7L A;  2ZK0 A;  4RMD A;  4OEY A;  4J5X C;  5B41 A;  2HFP A;  1S9P A;  5APJ A;  5FQR A;  3VRU A;  2J7X A;  2ZY0 A;  4L98 A;  3IPQ A;  1PQ6 A;  2XYW A;  1MVC A;  2A3I A;  3OLS A;  1NQ1 A;  2OAX A;  1RK3 A;  1YJE A;  4TV1 B;  3VT9 A;  5AAU A;  5HYR A;  5FQV A;  2GPU A;  4RZE A;  4XTA A;  4ZO1 X;  1T74 A;  4E2J A;  5I4V A;  4LTW A;  3A40 X;  3RUU A;  1N4H A;  1VJB A;  4IVW A;  1YOW A;  5AVI A;  5GIE A;  5KRO A;  2NXX E;  1T7R A;  3MNE A;  5DYD A;  5B5B A;  3F5C B;  5JJM B;  5ACC A;  1L2J A;  1T65 A;  1X7J A;  4PF3 A;  2OVH A;  1I37 A;  3D5F A;  3RUT A;  3OMK A;  3UUD A;  2Q59 A;  2I4P A;  5DXP A;  1FM6 A;  3A2I A;  1H9U A;  1U3S A;  3DR1 A;  5DMF A;  4LBD A;  5HJP A;  4G1D A;  3D24 A;  2HAS A;  3UP3 A;  3WT5 A;  3RLL A;  4QJR A;  1EXX A;  1G2N A;  5KRC A;  3V49 A;  4ITF A;  2QA8 A;  2ZVT A;  4DOS A;  5JY3 A;  3U9Q A;  1XVP B;  4ITE A;  5EI1 A;  3TX7 B;  1XV9 B;  2B1Z A;  1S19 A;  2PIW A;  3VTB A;  3VT4 A;  1YY4 A;  2XKW A;  1PRG A;  2ZXZ A;  4REE A;  2J4A A;  4PLE A;  5DXR A;  4FHI A;  3R5N A;  4KZI A;  4RZG A;  1OVL B;  3HQ5 A;  4ZI1 A;  5KCC A;  3HOD A;  5G44 A;  1NHZ A;  2W8Y A;  4TUZ A;  2LBD A;  5DKB A;  4P6W A;  2AA7 A;  1A28 A;  2NPA A;  5DKE A;  5DRM A;  3WGP A;  4DK8 A;  2Z4B A;  2ZNO A;  3W0I A;  3R2A A;  4XUM A;  1R1K A;  1UOM A;  2POB A;  5HCV A;  4OIL A;  3D6D A;  2AAX A;  1XDK B;  1MZN A;  3A9E B;  4PRG A;  5GIC A;  2B1V A;  4IU7 A;  1R20 A;  5KR9 A;  2R6W A;  3R8D A;  5DWG A;  3OMM A;  2ZK3 A;  5DWE A;  3VSP A;  4X1F A;  4OJ9 A;  5SYZ A;  1NAX A;  2ZXN A;  4UDD A;  5JI0 D;  4NB6 A;  3OS8 C;  3PCU A;  1FD0 A;  2OCF A;  2VV3 A;  2JFA A;  4MG9 A;  3HZF A;  1FCZ A;  2QXM A;  1XQC A;  3AUR A;  3HM1 A;  3L0J A;  4J24 A;  2PIX A;  3MNO A;  2HAR A;  3KDT A;  1NRL A;  1ILG A;  3X36 A;  2QGW A;  3OS9 A;  1XP6 A;  3HC6 A;  1ZKY A;  4XHD A;  4PXM A;  5DZ3 A;  5C4T A;  3ET1 A;  1PQ9 A;  5DX3 A;  5KYJ A;  3O1D A;  4HLW A;  2P54 A; 
#chains in the Genus database with same CATH topology
 2VV4 A;  4IV4 A;  2HBH A;  4Q0A C;  5DI7 A;  1N46 A;  3ZR7 A;  3FUG A;  3PO9 A;  2GPP A;  4JYG A;  1PK5 A;  5E1C A;  2P15 A;  4DK7 A;  3OGT A;  2QTU A;  4MGD A;  5FQS A;  3FEI A;  2YLP A;  3OKI A;  4RME A;  3W5T A;  2XYJ A;  3S9S A;  1FBY A;  3PBA A;  3EYB A;  4XLD A;  3H0A D;  2B23 A;  5KRK A;  3BQD A;  1YMT A;  5DXB B;  4S0S A;  2Q61 A;  3H0A A;  2AX9 A;  3CDS A;  5H1E A;  2Q6J A;  4ONI A;  3K8S A;  3AUN A;  4FN9 A;  4MG7 A;  3DCT A;  4NY9 A;  3FUR A;  3IPU A;  4K6I A;  2Q6R A;  4KZM A;  3GN8 A;  4OIV A;  4OZR E;  4WVD A;  4QM0 A;  3W0Y A;  3IA6 A;  2AO6 A;  2VV1 A;  3OSW A;  2QZO A;  3R29 A;  3B0T A;  2JJ3 A;  3DCU A;  5DYB A;  1XPC A;  4KZJ A;  3X31 A;  3HLV A;  4M8E A;  3VRV A;  1OSH A;  4CI4 A;  4J5W A;  3OLF A;  4OEA A;  4JL4 A;  3ET0 A;  4NQA B;  1IE9 A;  1M7W A;  2ZK5 A;  5AZT A;  1I7G A;  3ZRA A;  2QNV A;  2ZXM A;  3IMY A;  1X78 A;  3FEJ A;  5DXQ A;  1T7T A;  5AVL A;  3UVV A;  2ABI A;  3ILZ A;  5ICK A;  3VHU A;  1YA3 A;  5KRA A;  2GPO A;  2ZNN A;  3B68 A;  1T7M A;  2ZNQ A;  3AN3 A;  4PPP A;  1S0Z A;  5DID A;  3VRW A;  4RZF A;  3Q95 A;  3X1I A;  4UDA A;  3RY9 A;  1M13 A;  2AA5 A;  3UUD B;  2YLO A;  2Q59 B;  4OZT U;  3CLD A;  5DV8 A;  4IA3 A;  3B5R A;  3DZY D;  4DM8 A;  4G1Z A;  5LWP A;  1Q4X A;  2FAI A;  1I38 A;  5HJP B;  5LGA A;  4UDB A;  3D57 A;  3H52 A;  3L1B A;  3CWD A;  3W0H A;  4EM9 A;  4PP5 A;  2BAW A;  4X1G A;  2V0V A;  5KD9 A;  2OVM A;  4MGA A;  2ACL A;  2PIN A;  2QA8 B;  5G3J A;  5G5W A;  5KCU A;  2HVC A;  2QMV A;  1U9E A;  3ADV A;  3OOK A;  5C4S A;  4JYH A;  4MGC A;  4MG8 A;  1NYX A;  3ERD A;  2P7Z A;  5DIE A;  1Y0S A;  3B0Q A;  3G0W A;  3KMZ A;  4A4V A;  1KV6 A;  2POG A;  2Q3Y A;  1DKF A;  2Z4J A;  3NOA A;  4JAZ A;  5FQT A;  5L7H A;  3WT6 A;  5HZC A;  4ZNS A;  4TUZ B;  5EC9 A;  1T79 A;  5AWK A;  3OLL A;  3W0A A;  1XZX X;  3P89 A;  3CS6 A;  2O4J A;  1NUO A;  1OSV A;  5ETH A;  2J14 A;  3GBK A;  3GYU A;  1HG4 A;  4MGB A;  4N5G A;  4OKW A;  5EJV A;  4E4Q A;  1FM6 D;  1ZH7 A;  2ZNP A;  1DB1 A;  1TXI A;  4HEE X;  5AYG A;  1T73 A;  4ZN7 A;  3L0E A;  3G8I A;  2QPY A;  4ZNH A;  1LBD A;  5C4O A;  3BEJ A;  5IXK A;  2OUZ A;  1KKQ A;  2Q7I A;  4N1Y A;  4PP3 A;  3R8I A;  3V9T A;  3AN4 A;  1SQN A;  2AX7 A;  2YLQ A;  4OIU A;  3V9V A;  2FVJ A;  3VT5 A;  2JFA B;  3B67 A;  3GD2 A;  4FGY A;  4MG9 B;  5DU5 A;  4ZJW A;  1T7F A;  4P6X A;  2PIV A;  5DZH A;  1FM9 A;  5DSH A;  2P1T A;  1YIM A;  3VT3 A;  3KYT A;  3CTB A;  4UDC A;  4CSJ A;  3ZRB A;  2GTK A;  4DMA A;  5DWJ A;  5DKG A;  4XAO A;  4IQR A;  3AX8 A;  5DX3 B;  2QE4 A;  3VJI A;  4POJ A;  3SP6 A;  3E7C A;  3MNP A;  2VV4 B;  3IXP D;  3D90 A;  3CS4 A;  4PP6 A;  5C4U A;  5DXK A;  5DIG A;  4ZN9 A;  2GL8 A;  3IXP A;  1R1K D;  5KRL A;  3P0U A;  1UHL A;  2ZLA A;  4IWC A;  3W0C A;  1YIN A;  3OOF A;  4OC7 A;  4R6S A;  5IAW A;  5KRH A;  5DWI A;  5APH A;  5M96 A;  3P88 A;  1R20 D;  4MGD B;  3CS8 A;  3DZU D;  1QKN A;  2GWX A;  4JYI A;  5E15 A;  4M8H A;  3QT0 A;  3OZJ A;  1M2Z A;  2Q5S A;  3DZU A;  2O9I A;  2QR9 A;  5KRF A;  1ZDU A;  2HC4 A;  4PWL A;  2P4Y A;  3B3K A;  2PIT A;  4MG7 B;  5IZ0 A;  4Y29 A;  4YT1 A;  1FCY A;  4J26 A;  3RLJ A;  2G0H A;  2Q6S A;  1RKG A;  2PIP L;  2VV1 B;  4R2U A;  4O8F A;  4L96 A;  2QZO B;  3SZ1 A;  4IA7 A;  3VJT A;  4ZJR A;  3GZ9 A;  4IS8 A;  1T63 A;  3KBA A;  3M7R A;  5DLR A;  2Q7J A;  1UPV A;  1LV2 A;  3TKM A;  3OAP A;  5KCF A;  3T03 A;  2AX8 A;  5DP0 A;  2ZMI A;  2Q7K A;  2PIO A;  5DUE A;  4QE8 A;  3ET2 A;  5E0W A;  3AUQ A;  2H79 A;  1WM0 X;  2F4B A;  3UU7 A;  3UVV B;  3F7D A;  2PJL A;  4J5W C;  2AM9 A;  2ZFX A;  1Z5X U;  3AFR A;  2ZK4 A;  2I4Z A;  3Q95 B;  1ZGY A;  4ZNU A;  1I7I A;  2E2R A;  3NSQ A;  3KPZ A;  4K4J A;  1X76 A;  3WFG A;  3BC5 A;  3W5Q A;  5G42 A;  1YYE A;  4YNK A;  1PZL A;  1SKX A;  2VSR A;  3UUA A;  5HYK A;  5DRJ A;  2AYR A;  3ET3 A;  5DZ0 A;  1KNU A;  3RVF A;  2I0J A;  2GP7 A;  3OSI A;  4MGA B;  1IE8 A;  2ACL B;  4RUO X;  4DM6 A;  2IHQ A;  4DOR A;  1GWX A;  2ZAS A;  5DZI A;  5AWJ A;  2Q5P A;  5KCD A;  1OT7 A;  5A86 A;  2P7A A;  1XIU A;  5DL4 A;  4MG8 B;  4OZT E;  5F9B A;  3JZC A;  3A2J A;  3O1E A;  1PQC A;  2AXA A;  4OGH A;  3L03 A;  3VSO A;  3GWS X;  2AB2 A;  3N00 A;  3OSA A;  4OAR A;  1DKF B;  5DV3 A;  1SJ0 A;  4A2J A;  3UUC A;  1NAV A;  3R8A A;  3PLZ A;  3KFC A;  2BJ4 A;  3W0G A;  2AX6 A;  3L3Z A;  1XB7 A;  1T76 A;  2Q5G A;  1YUC A;  3ZQT A;  1ERR A;  5E7V A;  1X7R A;  4OH6 A;  2ZLC A;  4IV2 A;  2H77 A;  3AZ3 A;  4Q50 A;  4ZO1 B;  2PIU A;  5DWL A;  3CQV A;  2ZK6 A;  2PIR A;  2PKL A;  3L3X A;  3G9E A;  5DTV A;  5E14 A;  3FC6 A;  4REF A;  3VT7 A;  2QAB A;  1ZAF A;  2HWR A;  2G0G A;  4FHH A;  3VTD A;  3FS1 A;  3E00 D;  3AZ1 A;  1NQ0 A;  3E00 A;  4IA1 A;  4A4W A;  1GWR A;  1ILH A;  1RKH A;  4G2H A;  3GYT A;  3VRT A;  1P93 A;  4QK4 A;  5DXE A;  3G8O A;  4RE8 A;  5AAV A;  1ZEO A;  3ADU A;  3B1M A;  3FAL A;  4CI5 A;  3KWY A;  4FNE A;  2REW A;  2QA6 A;  3VI8 A;  3W5R A;  3CJW A;  3AZ2 A;  4OED A;  4R06 A;  4G1Y A;  2V7C A;  2PNU A;  4WPF A;  1MV9 A;  2NV7 A;  3V4A A;  4B7W A;  3VT6 A;  4G2I A;  1UHL B;  1ZUC A;  2P1U A;  2QH6 A;  1X7E A;  2YHD A;  1RDT A;  2ZMH A;  4G20 A;  2QSE A;  1FCX A;  4WLB A;  3WJ5 A;  3WTQ A;  5G43 A;  4IWF A;  2EWP A;  5EHJ A;  3WFF A;  5E0X A;  1BSX A;  1K4W A;  1Y0X X;  1TFC A;  4OK1 A;  5DZ1 A;  1L2I A;  1XP9 A;  3KMG A;  1HJ1 A;  2Q1V A;  2ZMJ A;  5DV6 A;  2AMB A;  1XNX A;  3B0R A;  2YFE A;  3LBD A;  1A52 A;  5G46 A;  2QXS A;  2Q70 A;  5DUG A;  4DQM A;  1XOW A;  1FM9 D;  2YJD A;  2XHS A;  1PDU A;  3ERT A;  3GWX A;  3JZB A;  5DK9 A;  3VT8 A;  3HVL A;  2AA2 A;  4MG6 A;  4OEZ A;  1XQ3 A;  5CJ6 A;  2QGT A;  3VHV A;  3OZ0 A;  4YPQ A;  4K7A A;  5KCW A;  1XP1 A;  2YJA B;  4WHG A;  2PRG A;  3VJH A;  1ERE A;  4ZOM A;  4J5X A;  4WQP A;  3VHW A;  5K13 A;  1T5Z A;  3HC5 A;  5G45 A;  3V3E A;  3UP0 A;  2Q60 A;  3LMP A;  4Q13 A;  4XI3 A;  3UU7 B;  3B65 A;  3WWR A;  2I0G A;  5HJS A;  5KRI A;  2ZBS A;  1XNN A;  2ATH A;  3KMR A;  4PPS A;  2O4R A;  2P1V A;  4XUH A;  3B66 A;  1PCG A;  3FXV A;  2FSZ A;  4BCR A;  3A3Z X;  5DVC A;  4TV1 A;  3X1H A;  3VJS A;  5L7G A;  3OMO A;  1GS4 A;  2HCD A;  5DVV A;  3UUA B;  4IA2 A;  2Q8S A;  4S14 A;  1GWQ A;  1XLS E;  3DT3 A;  3K22 A;  4RAK A;  4RFW A;  4RMC A;  2Q1H A;  4NUF A;  1R5K A;  3NSP A;  2OZ7 A;  1Z5X E;  1E3K A;  3L0L A;  2ZK2 A;  3F5C A;  5JJM A;  1QKU A;  4ZNW A;  3ADS A;  3KDU A;  3W0J A;  5KRM A;  4S0T A;  2ZK1 A;  5KRJ A;  4RUJ A;  1XAP A;  2P7G A;  3R5M A;  4OFU A;  3ADW A;  4QE6 A;  4S15 A;  4F9M A;  2G5O A;  5AZV A;  2G44 A;  4LNX A;  4N8R A;  3DY6 A;  3P8X A;  4POH A;  1YP0 A;  2HWQ A;  2VST A;  2IOG A;  2AMA A;  3ADX A;  2HB8 A;  4RUP A;  4E4K A;  4XT9 A;  2BJ4 B;  3IPS A;  1XVP A;  4G21 A;  4JGV A;  1XV9 A;  5GT4 A;  3PEQ A;  1SR7 A;  1E3G A;  1EXA A;  3W5P A;  1P8D A;  1YOK A;  3OMQ A;  1OVL A;  1NQ7 A;  4LNW A;  5DXG A;  3V3Q A;  2B50 A;  1Z95 A;  5L7E A;  1NQ2 A;  2R40 D;  3FC6 B;  4APU A;  2IOK A;  3TKC A;  1S0X A;  3B0W A;  2R40 A;  1QKM A;  2NXX A;  1XJ7 A;  1R6G A;  1ZDT A;  2AA6 A;  3OKH A;  4OKX A;  3V9Y A;  2R6Y A;  4ZNV A;  3PRG A;  3VN2 A;  4PVU A;  5APK A;  2GIU A;  2HB7 A;  1K74 D;  4NIE A;  2I4J A;  4OLM A;  5DXM A;  4ZNT A;  5KCT A;  1N83 A;  4QL8 A;  5KCE A;  1G5Y A;  1K74 A;  1XDK A;  5AK2 A;  5AAV B;  3A9E A;  5KYA A;  3OS8 A;  3FAL B;  5DKS A;  4IVY A;  4OJB A;  3ADT A;  3K23 A;  4OKT A;  4MG5 A;  4RWV A;  2JF9 A;  3TY0 A;  1G1U A;  2NW4 A;  5EGV A;  2QW4 A;  2YAT A;  3WMH A;  3E94 A;  1S9Q A;  2J7Y A;  3A2H A;  3HO0 A;  4YMQ A;  5L11 A;  2ZKC A;  2AWH A;  2XYX A;  4MGB B;  4OHA A;  2GPV A;  4IUI A;  1UPW A;  2ZL9 A;  2VV2 A;  4N73 A;  3VTC A;  3K6P A;  1Y9R A;  4PLD A;  3SP9 A;  4IW6 A;  5GID A;  2OM9 A;  2HAM A;  4OJ4 A;  2YLY A;  1XLS A;  1G50 A;  2VV0 A;  1U3Q A;  3OMP A;  5DUH A;  4WHF A;  4EMA A;  1X7B A;  5DVS A;  4IW8 A;  4OH5 A;  4OZR U;  3WJ4 A;  1RJK A;  4LSJ A;  5DMC A;  1U3R A;  3CDP A;  1QKT A;  4OKB A;  5E19 A;  5FQP A;  2PIQ A;  3WT7 A;  2Q7L A;  4MDD A;  5DXB A;  1NDE A;  3FLI A;  4OFR A;  5EIT A;  3A78 A;  3DZY A;  1RDT D;  5DY8 A;  1K7L A;  2ZK0 A;  4RMD A;  4OEY A;  4J5X C;  5B41 A;  2HFP A;  1S9P A;  5APJ A;  5FQR A;  3VRU A;  2J7X A;  2ZY0 A;  4L98 A;  3IPQ A;  1PQ6 A;  2XYW A;  1MVC A;  2A3I A;  3OLS A;  1NQ1 A;  2OAX A;  1RK3 A;  1YJE A;  4TV1 B;  3VT9 A;  5AAU A;  5HYR A;  5FQV A;  2GPU A;  4RZE A;  4XTA A;  4ZO1 X;  1T74 A;  4E2J A;  5I4V A;  4LTW A;  3A40 X;  3RUU A;  1N4H A;  1VJB A;  4IVW A;  1YOW A;  5AVI A;  5GIE A;  5KRO A;  2NXX E;  1T7R A;  3MNE A;  5DYD A;  5B5B A;  3F5C B;  5JJM B;  5ACC A;  1L2J A;  1T65 A;  1X7J A;  4PF3 A;  2OVH A;  1I37 A;  3D5F A;  3RUT A;  3OMK A;  3UUD A;  2Q59 A;  2I4P A;  5DXP A;  1FM6 A;  3A2I A;  1H9U A;  1U3S A;  3DR1 A;  5DMF A;  4LBD A;  5HJP A;  4G1D A;  3D24 A;  2HAS A;  3UP3 A;  3WT5 A;  3RLL A;  4QJR A;  1EXX A;  1G2N A;  5KRC A;  3V49 A;  4ITF A;  2QA8 A;  2ZVT A;  4DOS A;  5JY3 A;  3U9Q A;  1XVP B;  4ITE A;  5EI1 A;  3TX7 B;  1XV9 B;  2B1Z A;  1S19 A;  2PIW A;  3VTB A;  3VT4 A;  1YY4 A;  2XKW A;  1PRG A;  2ZXZ A;  4REE A;  2J4A A;  4PLE A;  5DXR A;  4FHI A;  3R5N A;  4KZI A;  4RZG A;  1OVL B;  3HQ5 A;  4ZI1 A;  5KCC A;  3HOD A;  5G44 A;  1NHZ A;  2W8Y A;  4TUZ A;  2LBD A;  5DKB A;  4P6W A;  2AA7 A;  1A28 A;  2NPA A;  5DKE A;  5DRM A;  3WGP A;  4DK8 A;  2Z4B A;  2ZNO A;  3W0I A;  3R2A A;  4XUM A;  1R1K A;  1UOM A;  2POB A;  5HCV A;  4OIL A;  3D6D A;  2AAX A;  1XDK B;  1MZN A;  3A9E B;  4PRG A;  5GIC A;  2B1V A;  4IU7 A;  1R20 A;  5KR9 A;  2R6W A;  3R8D A;  5DWG A;  3OMM A;  2ZK3 A;  5DWE A;  3VSP A;  4X1F A;  4OJ9 A;  5SYZ A;  1NAX A;  2ZXN A;  4UDD A;  5JI0 D;  4NB6 A;  3OS8 C;  3PCU A;  1FD0 A;  2OCF A;  2VV3 A;  2JFA A;  4MG9 A;  3HZF A;  1FCZ A;  2QXM A;  1XQC A;  3AUR A;  3HM1 A;  3L0J A;  4J24 A;  2PIX A;  3MNO A;  2HAR A;  3KDT A;  1NRL A;  1ILG A;  3X36 A;  2QGW A;  3OS9 A;  1XP6 A;  3HC6 A;  1ZKY A;  4XHD A;  4PXM A;  5DZ3 A;  5C4T A;  3ET1 A;  1PQ9 A;  5DX3 A;  5KYJ A;  3O1D A;  4HLW A;  2P54 A; 
#chains in the Genus database with same CATH homology
 2VV4 A;  4IV4 A;  2HBH A;  4Q0A C;  5DI7 A;  1N46 A;  3ZR7 A;  3FUG A;  3PO9 A;  2GPP A;  4JYG A;  1PK5 A;  5E1C A;  2P15 A;  4DK7 A;  3OGT A;  2QTU A;  4MGD A;  5FQS A;  3FEI A;  2YLP A;  3OKI A;  4RME A;  3W5T A;  2XYJ A;  3S9S A;  1FBY A;  3PBA A;  3EYB A;  4XLD A;  3H0A D;  2B23 A;  5KRK A;  3BQD A;  1YMT A;  5DXB B;  4S0S A;  2Q61 A;  3H0A A;  2AX9 A;  3CDS A;  5H1E A;  2Q6J A;  4ONI A;  3K8S A;  3AUN A;  4FN9 A;  4MG7 A;  3DCT A;  4NY9 A;  3FUR A;  3IPU A;  4K6I A;  2Q6R A;  4KZM A;  3GN8 A;  4OIV A;  4OZR E;  4WVD A;  4QM0 A;  3W0Y A;  3IA6 A;  2AO6 A;  2VV1 A;  3OSW A;  2QZO A;  3R29 A;  3B0T A;  2JJ3 A;  3DCU A;  5DYB A;  1XPC A;  4KZJ A;  3X31 A;  3HLV A;  4M8E A;  3VRV A;  1OSH A;  4CI4 A;  4J5W A;  3OLF A;  4OEA A;  4JL4 A;  3ET0 A;  4NQA B;  1IE9 A;  1M7W A;  2ZK5 A;  5AZT A;  1I7G A;  3ZRA A;  2QNV A;  2ZXM A;  3IMY A;  1X78 A;  3FEJ A;  5DXQ A;  1T7T A;  5AVL A;  3UVV A;  2ABI A;  3ILZ A;  5ICK A;  3VHU A;  1YA3 A;  5KRA A;  2GPO A;  2ZNN A;  3B68 A;  1T7M A;  2ZNQ A;  3AN3 A;  4PPP A;  1S0Z A;  5DID A;  3VRW A;  4RZF A;  3Q95 A;  3X1I A;  4UDA A;  3RY9 A;  1M13 A;  2AA5 A;  3UUD B;  2YLO A;  2Q59 B;  4OZT U;  3CLD A;  5DV8 A;  4IA3 A;  3B5R A;  3DZY D;  4DM8 A;  4G1Z A;  5LWP A;  1Q4X A;  2FAI A;  1I38 A;  5HJP B;  5LGA A;  4UDB A;  3D57 A;  3H52 A;  3L1B A;  3CWD A;  3W0H A;  4EM9 A;  4PP5 A;  2BAW A;  4X1G A;  2V0V A;  5KD9 A;  2OVM A;  4MGA A;  2ACL A;  2PIN A;  2QA8 B;  5G3J A;  5G5W A;  5KCU A;  2HVC A;  2QMV A;  1U9E A;  3ADV A;  3OOK A;  5C4S A;  4JYH A;  4MGC A;  4MG8 A;  1NYX A;  3ERD A;  2P7Z A;  5DIE A;  1Y0S A;  3B0Q A;  3G0W A;  3KMZ A;  4A4V A;  1KV6 A;  2POG A;  2Q3Y A;  1DKF A;  2Z4J A;  3NOA A;  4JAZ A;  5FQT A;  5L7H A;  3WT6 A;  5HZC A;  4ZNS A;  4TUZ B;  5EC9 A;  1T79 A;  5AWK A;  3OLL A;  3W0A A;  1XZX X;  3P89 A;  3CS6 A;  2O4J A;  1NUO A;  1OSV A;  5ETH A;  2J14 A;  3GBK A;  3GYU A;  1HG4 A;  4MGB A;  4N5G A;  4OKW A;  5EJV A;  4E4Q A;  1FM6 D;  1ZH7 A;  2ZNP A;  1DB1 A;  1TXI A;  4HEE X;  5AYG A;  1T73 A;  4ZN7 A;  3L0E A;  3G8I A;  2QPY A;  4ZNH A;  1LBD A;  5C4O A;  3BEJ A;  5IXK A;  2OUZ A;  1KKQ A;  2Q7I A;  4N1Y A;  4PP3 A;  3R8I A;  3V9T A;  3AN4 A;  1SQN A;  2AX7 A;  2YLQ A;  4OIU A;  3V9V A;  2FVJ A;  3VT5 A;  2JFA B;  3B67 A;  3GD2 A;  4FGY A;  4MG9 B;  5DU5 A;  4ZJW A;  1T7F A;  4P6X A;  2PIV A;  5DZH A;  1FM9 A;  5DSH A;  2P1T A;  1YIM A;  3VT3 A;  3KYT A;  3CTB A;  4UDC A;  4CSJ A;  3ZRB A;  2GTK A;  4DMA A;  5DWJ A;  5DKG A;  4XAO A;  4IQR A;  3AX8 A;  5DX3 B;  2QE4 A;  3VJI A;  4POJ A;  3SP6 A;  3E7C A;  3MNP A;  2VV4 B;  3IXP D;  3D90 A;  3CS4 A;  4PP6 A;  5C4U A;  5DXK A;  5DIG A;  4ZN9 A;  2GL8 A;  3IXP A;  1R1K D;  5KRL A;  3P0U A;  1UHL A;  2ZLA A;  4IWC A;  3W0C A;  1YIN A;  3OOF A;  4OC7 A;  4R6S A;  5IAW A;  5KRH A;  5DWI A;  5APH A;  5M96 A;  3P88 A;  1R20 D;  4MGD B;  3CS8 A;  3DZU D;  1QKN A;  2GWX A;  4JYI A;  5E15 A;  4M8H A;  3QT0 A;  3OZJ A;  1M2Z A;  2Q5S A;  3DZU A;  2O9I A;  2QR9 A;  5KRF A;  1ZDU A;  2HC4 A;  4PWL A;  2P4Y A;  3B3K A;  2PIT A;  4MG7 B;  5IZ0 A;  4Y29 A;  4YT1 A;  1FCY A;  4J26 A;  3RLJ A;  2G0H A;  2Q6S A;  1RKG A;  2PIP L;  2VV1 B;  4R2U A;  4O8F A;  4L96 A;  2QZO B;  3SZ1 A;  4IA7 A;  3VJT A;  4ZJR A;  3GZ9 A;  4IS8 A;  1T63 A;  3KBA A;  3M7R A;  5DLR A;  2Q7J A;  1UPV A;  1LV2 A;  3TKM A;  3OAP A;  5KCF A;  3T03 A;  2AX8 A;  5DP0 A;  2ZMI A;  2Q7K A;  2PIO A;  5DUE A;  4QE8 A;  3ET2 A;  5E0W A;  3AUQ A;  2H79 A;  1WM0 X;  2F4B A;  3UU7 A;  3UVV B;  3F7D A;  2PJL A;  4J5W C;  2AM9 A;  2ZFX A;  1Z5X U;  3AFR A;  2ZK4 A;  2I4Z A;  3Q95 B;  1ZGY A;  4ZNU A;  1I7I A;  2E2R A;  3NSQ A;  3KPZ A;  4K4J A;  1X76 A;  3WFG A;  3BC5 A;  3W5Q A;  5G42 A;  1YYE A;  4YNK A;  1PZL A;  1SKX A;  2VSR A;  3UUA A;  5HYK A;  5DRJ A;  2AYR A;  3ET3 A;  5DZ0 A;  1KNU A;  3RVF A;  2I0J A;  2GP7 A;  3OSI A;  4MGA B;  1IE8 A;  2ACL B;  4RUO X;  4DM6 A;  2IHQ A;  4DOR A;  1GWX A;  2ZAS A;  5DZI A;  5AWJ A;  2Q5P A;  5KCD A;  1OT7 A;  5A86 A;  2P7A A;  1XIU A;  5DL4 A;  4MG8 B;  4OZT E;  5F9B A;  3JZC A;  3A2J A;  3O1E A;  1PQC A;  2AXA A;  4OGH A;  3L03 A;  3VSO A;  3GWS X;  2AB2 A;  3N00 A;  3OSA A;  4OAR A;  1DKF B;  5DV3 A;  1SJ0 A;  4A2J A;  3UUC A;  1NAV A;  3R8A A;  3PLZ A;  3KFC A;  2BJ4 A;  3W0G A;  2AX6 A;  3L3Z A;  1XB7 A;  1T76 A;  2Q5G A;  1YUC A;  3ZQT A;  1ERR A;  5E7V A;  1X7R A;  4OH6 A;  2ZLC A;  4IV2 A;  2H77 A;  3AZ3 A;  4Q50 A;  4ZO1 B;  2PIU A;  5DWL A;  3CQV A;  2ZK6 A;  2PIR A;  2PKL A;  3L3X A;  3G9E A;  5DTV A;  5E14 A;  3FC6 A;  4REF A;  3VT7 A;  2QAB A;  1ZAF A;  2HWR A;  2G0G A;  4FHH A;  3VTD A;  3FS1 A;  3E00 D;  3AZ1 A;  1NQ0 A;  3E00 A;  4IA1 A;  4A4W A;  1GWR A;  1ILH A;  1RKH A;  4G2H A;  3GYT A;  3VRT A;  1P93 A;  4QK4 A;  5DXE A;  3G8O A;  4RE8 A;  5AAV A;  1ZEO A;  3ADU A;  3B1M A;  3FAL A;  4CI5 A;  3KWY A;  4FNE A;  2REW A;  2QA6 A;  3VI8 A;  3W5R A;  3CJW A;  3AZ2 A;  4OED A;  4R06 A;  4G1Y A;  2V7C A;  2PNU A;  4WPF A;  1MV9 A;  2NV7 A;  3V4A A;  4B7W A;  3VT6 A;  4G2I A;  1UHL B;  1ZUC A;  2P1U A;  2QH6 A;  1X7E A;  2YHD A;  1RDT A;  2ZMH A;  4G20 A;  2QSE A;  1FCX A;  4WLB A;  3WJ5 A;  3WTQ A;  5G43 A;  4IWF A;  2EWP A;  5EHJ A;  3WFF A;  5E0X A;  1BSX A;  1K4W A;  1Y0X X;  1TFC A;  4OK1 A;  5DZ1 A;  1L2I A;  1XP9 A;  3KMG A;  1HJ1 A;  2Q1V A;  2ZMJ A;  5DV6 A;  2AMB A;  1XNX A;  3B0R A;  2YFE A;  3LBD A;  1A52 A;  5G46 A;  2QXS A;  2Q70 A;  5DUG A;  4DQM A;  1XOW A;  1FM9 D;  2YJD A;  2XHS A;  1PDU A;  3ERT A;  3GWX A;  3JZB A;  5DK9 A;  3VT8 A;  3HVL A;  2AA2 A;  4MG6 A;  4OEZ A;  1XQ3 A;  5CJ6 A;  2QGT A;  3VHV A;  3OZ0 A;  4YPQ A;  4K7A A;  5KCW A;  1XP1 A;  2YJA B;  4WHG A;  2PRG A;  3VJH A;  1ERE A;  4ZOM A;  4J5X A;  4WQP A;  3VHW A;  5K13 A;  1T5Z A;  3HC5 A;  5G45 A;  3V3E A;  3UP0 A;  2Q60 A;  3LMP A;  4Q13 A;  4XI3 A;  3UU7 B;  3B65 A;  3WWR A;  2I0G A;  5HJS A;  5KRI A;  2ZBS A;  1XNN A;  2ATH A;  3KMR A;  4PPS A;  2O4R A;  2P1V A;  4XUH A;  3B66 A;  1PCG A;  3FXV A;  2FSZ A;  4BCR A;  3A3Z X;  5DVC A;  4TV1 A;  3X1H A;  3VJS A;  5L7G A;  3OMO A;  1GS4 A;  2HCD A;  5DVV A;  3UUA B;  4IA2 A;  2Q8S A;  4S14 A;  1GWQ A;  1XLS E;  3DT3 A;  3K22 A;  4RAK A;  4RFW A;  4RMC A;  2Q1H A;  4NUF A;  1R5K A;  3NSP A;  2OZ7 A;  1Z5X E;  1E3K A;  3L0L A;  2ZK2 A;  3F5C A;  5JJM A;  1QKU A;  4ZNW A;  3ADS A;  3KDU A;  3W0J A;  5KRM A;  4S0T A;  2ZK1 A;  5KRJ A;  4RUJ A;  1XAP A;  2P7G A;  3R5M A;  4OFU A;  3ADW A;  4QE6 A;  4S15 A;  4F9M A;  2G5O A;  5AZV A;  2G44 A;  4LNX A;  4N8R A;  3DY6 A;  3P8X A;  4POH A;  1YP0 A;  2HWQ A;  2VST A;  2IOG A;  2AMA A;  3ADX A;  2HB8 A;  4RUP A;  4E4K A;  4XT9 A;  2BJ4 B;  3IPS A;  1XVP A;  4G21 A;  4JGV A;  1XV9 A;  5GT4 A;  3PEQ A;  1SR7 A;  1E3G A;  1EXA A;  3W5P A;  1P8D A;  1YOK A;  3OMQ A;  1OVL A;  1NQ7 A;  4LNW A;  5DXG A;  3V3Q A;  2B50 A;  1Z95 A;  5L7E A;  1NQ2 A;  2R40 D;  3FC6 B;  4APU A;  2IOK A;  3TKC A;  1S0X A;  3B0W A;  2R40 A;  1QKM A;  2NXX A;  1XJ7 A;  1R6G A;  1ZDT A;  2AA6 A;  3OKH A;  4OKX A;  3V9Y A;  2R6Y A;  4ZNV A;  3PRG A;  3VN2 A;  4PVU A;  5APK A;  2GIU A;  2HB7 A;  1K74 D;  4NIE A;  2I4J A;  4OLM A;  5DXM A;  4ZNT A;  5KCT A;  1N83 A;  4QL8 A;  5KCE A;  1G5Y A;  1K74 A;  1XDK A;  5AK2 A;  5AAV B;  3A9E A;  5KYA A;  3OS8 A;  3FAL B;  5DKS A;  4IVY A;  4OJB A;  3ADT A;  3K23 A;  4OKT A;  4MG5 A;  4RWV A;  2JF9 A;  3TY0 A;  1G1U A;  2NW4 A;  5EGV A;  2QW4 A;  2YAT A;  3WMH A;  3E94 A;  1S9Q A;  2J7Y A;  3A2H A;  3HO0 A;  4YMQ A;  5L11 A;  2ZKC A;  2AWH A;  2XYX A;  4MGB B;  4OHA A;  2GPV A;  4IUI A;  1UPW A;  2ZL9 A;  2VV2 A;  4N73 A;  3VTC A;  3K6P A;  1Y9R A;  4PLD A;  3SP9 A;  4IW6 A;  5GID A;  2OM9 A;  2HAM A;  4OJ4 A;  2YLY A;  1XLS A;  1G50 A;  2VV0 A;  1U3Q A;  3OMP A;  5DUH A;  4WHF A;  4EMA A;  1X7B A;  5DVS A;  4IW8 A;  4OH5 A;  4OZR U;  3WJ4 A;  1RJK A;  4LSJ A;  5DMC A;  1U3R A;  3CDP A;  1QKT A;  4OKB A;  5E19 A;  5FQP A;  2PIQ A;  3WT7 A;  2Q7L A;  4MDD A;  5DXB A;  1NDE A;  3FLI A;  4OFR A;  5EIT A;  3A78 A;  3DZY A;  1RDT D;  5DY8 A;  1K7L A;  2ZK0 A;  4RMD A;  4OEY A;  4J5X C;  5B41 A;  2HFP A;  1S9P A;  5APJ A;  5FQR A;  3VRU A;  2J7X A;  2ZY0 A;  4L98 A;  3IPQ A;  1PQ6 A;  2XYW A;  1MVC A;  2A3I A;  3OLS A;  1NQ1 A;  2OAX A;  1RK3 A;  1YJE A;  4TV1 B;  3VT9 A;  5AAU A;  5HYR A;  5FQV A;  2GPU A;  4RZE A;  4XTA A;  4ZO1 X;  1T74 A;  4E2J A;  5I4V A;  4LTW A;  3A40 X;  3RUU A;  1N4H A;  1VJB A;  4IVW A;  1YOW A;  5AVI A;  5GIE A;  5KRO A;  2NXX E;  1T7R A;  3MNE A;  5DYD A;  5B5B A;  3F5C B;  5JJM B;  5ACC A;  1L2J A;  1T65 A;  1X7J A;  4PF3 A;  2OVH A;  1I37 A;  3D5F A;  3RUT A;  3OMK A;  3UUD A;  2Q59 A;  2I4P A;  5DXP A;  1FM6 A;  3A2I A;  1H9U A;  1U3S A;  3DR1 A;  5DMF A;  4LBD A;  5HJP A;  4G1D A;  3D24 A;  2HAS A;  3UP3 A;  3WT5 A;  3RLL A;  4QJR A;  1EXX A;  1G2N A;  5KRC A;  3V49 A;  4ITF A;  2QA8 A;  2ZVT A;  4DOS A;  5JY3 A;  3U9Q A;  1XVP B;  4ITE A;  5EI1 A;  3TX7 B;  1XV9 B;  2B1Z A;  1S19 A;  2PIW A;  3VTB A;  3VT4 A;  1YY4 A;  2XKW A;  1PRG A;  2ZXZ A;  4REE A;  2J4A A;  4PLE A;  5DXR A;  4FHI A;  3R5N A;  4KZI A;  4RZG A;  1OVL B;  3HQ5 A;  4ZI1 A;  5KCC A;  3HOD A;  5G44 A;  1NHZ A;  2W8Y A;  4TUZ A;  2LBD A;  5DKB A;  4P6W A;  2AA7 A;  1A28 A;  2NPA A;  5DKE A;  5DRM A;  3WGP A;  4DK8 A;  2Z4B A;  2ZNO A;  3W0I A;  3R2A A;  4XUM A;  1R1K A;  1UOM A;  2POB A;  5HCV A;  4OIL A;  3D6D A;  2AAX A;  1XDK B;  1MZN A;  3A9E B;  4PRG A;  5GIC A;  2B1V A;  4IU7 A;  1R20 A;  5KR9 A;  2R6W A;  3R8D A;  5DWG A;  3OMM A;  2ZK3 A;  5DWE A;  3VSP A;  4X1F A;  4OJ9 A;  5SYZ A;  1NAX A;  2ZXN A;  4UDD A;  5JI0 D;  4NB6 A;  3OS8 C;  3PCU A;  1FD0 A;  2OCF A;  2VV3 A;  2JFA A;  4MG9 A;  3HZF A;  1FCZ A;  2QXM A;  1XQC A;  3AUR A;  3HM1 A;  3L0J A;  4J24 A;  2PIX A;  3MNO A;  2HAR A;  3KDT A;  1NRL A;  1ILG A;  3X36 A;  2QGW A;  3OS9 A;  1XP6 A;  3HC6 A;  1ZKY A;  4XHD A;  4PXM A;  5DZ3 A;  5C4T A;  3ET1 A;  1PQ9 A;  5DX3 A;  5KYJ A;  3O1D A;  4HLW A;  2P54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...