2JFAB

Estrogen receptor alpha lbd in complex with an affinity-selected corepressor peptide
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
223
structure length
222
Chain Sequence
LALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into Corepressor Recognition by Antagonist-Bound Estrogen Receptors.
pubmed doi rcsb
molecule keywords ESTROGEN RECEPTOR
molecule tags Transcription
source organism Homo sapiens
total genus 85
structure length 222
sequence length 223
ec nomenclature
pdb deposition date 2007-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2jfaB00
3BC5A 2YATA 2Q7KA 3AFRA 1NDEA 3B3KA 3ET1A 3W0HA 1YINA 2Q59B 4JGVA 2E2RA 2J4AA 5G46A 2PIRA 3W5PA 4MG8B 3VSPA 4J5WC 2AX9A 4PLDA 4OZRE 3MNEA 3VRUA 5IAWA 4IA1A 4B7WA 5JJMB 2ACLB 4REEA 1Z5XU 4MGCA 4OGHA 3VT7A 5G43A 5DUEA 4KZIA 2YFEA 1UPVA 4QJRA 3DZYA 4MG9A 4OKWA 3W5TA 3FUGA 4E4QA 4Q13A 2BAWA 4ZJWA 3U9QA 1MZNA 1UHLA 2QTUA 4FHHA 4IS8A 5DZIA 1YY4A 2JFAA 3O1EA 2VV4B 1XVPB 3D57A 3FALA 3GN8A 3GBKA 1T65A 1X76A 3VT8A 1RDTA 1XOWA 2GPUA 2PKLA 4OH5A 5DWIA 2QW4A 3KMZA 3UVVB 4MGDA 5DI7A 2J7XA 3UUDB 4S0TA 1XIUA 5DL4A 1PQCA 1ZH7A 1RJKA 2R6WA 3CDPA 5DSHA 4G2IA 1I7IA 1MVCA 3FURA 3H0AD 5APHA 5AZVA 2OCFA 4UDBA 1GS4A 2G44A 1OSHA 5E1CA 3D5FA 5ETHA 1DKFB 4RWVA 3OMMA 1PQ9A 2GPVA 1U9EA 3LMPA 5AK2A 5EITA 1XNXA 3BQDA 1ZAFA 4N1YA 4XAOA 5DXGA 4OFRA 2NXXA 1ERRA 2P4YA 3ADVA 2NW4A 3VT4A 5AAVB 5DUHA 3X36A 4IUIA 3VJHA 2QA8A 2QGWA 1SJ0A 2GL8A 4XI3A 1R6GA 4APUA 5B5BA 5AAVA 2HB8A 2Q7LA 2ZK5A 3OGTA 3OKIA 3OLFA 1OSVA 3ET0A 5DWLA 3VJIA 5G45A 5CJ6A 3VRWA 3HC6A 2ZFXA 3ZRBA 2XKWA 4ZOMA 3E00A 5FQSA 1TFCA 5KCWA 5L7EA 3CLDA 5HZCA 4NY9A 3TY0A 5DMCA 1NUOA 2P7AA 1PRGA 3WGPA 2ZK4A 3SZ1A 5K13A 4JL4A 2P1TA 4IWFA 3UU7B 4OEAA 2VSRA 2GIUA 2OVMA 4PP6A 1OVLA 4OJBA 2ZMHA 5DXBB 3VTDA 3VTBA 5KYAA 4IV4A 4OKTA 1N83A 4O8FA 2QZOB 5E14A 3K23A 3A2IA 3VSOA 2ZY0A 5C4SA 1R5KA 4G2HA 3WT5A 2QZOA 3P0UA 1XLSA 5G44A 3F7DA 2VV1A 4J5XA 5DIGA 5KCCA 2AYRA 1RKHA 5HJPB 3K22A 3E00D 1X7RA 3HVLA 1ZDTA 2YLYA 4S15A 1A52A 5JI0D 3V9TA 5KROA 3FEJA 3DZUD 2B23A 4P6XA 2ZMIA 2AMBA 1XAPA 5ICKA 3HLVA 1XJ7A 4E4KA 5DWJA 2AM9A 5DK9A 1XPCA 2PIOA 3B66A 3G8IA 3MNPA 4KZMA 4OARA 3R8AA 3VN2A 4ZI1A 3ADTA 2NXXE 1U3SA 5F9BA 3VRVA 1L2JA 2HFPA 3F5CB 5EC9A 4PVUA 2ZNOA 3ADWA 4ZNTA 4X1FA 1YOWA 4XUHA 4DK8A 3FC6B 3ZR7A 1GWRA 3FS1A 1GWXA 3HC5A 5KRHA 4ZNHA 4EMAA 1ZEOA 4ZNUA 1FCYA 5KD9A 3FC6A 4ONIA 2ZLAA 4MG7A 4G21A 3W5QA 4J5WA 3FLIA 5DTVA 3WFGA 4BCRA 3IPSA 3R2AA 2Q6RA 4IVWA 3KYTA 4L98A 2PRGA 2ZK2A 3ZQTA 2G0HA 4XHDA 4RZEA 4RZGA 4ZJRA 5DZ3A 3WJ5A 1ILGA 1K4WA 3IXPA 3L0LA 2O4RA 4S14A 1XZXX 4RMDA 1PZLA 5C4UA 1NRLA 1Q4XA 2GPPA 5DWEA 1NQ2A 1E3GA 4RUPA 1G5YA 5DXMA 2HAMA 4RUOX 2V7CA 5A86A 2NPAA 1S0XA 4TV1A 4NB6A 5DYBA 3H0AA 4OK1A 4ZO1B 3E94A 5FQPA 1S19A 2HASA 1XP9A 4IA7A 4POJA 4NQAB 3P89A 5DKEA 4RE8A 4JYIA 4JAZA 4DORA 2GWXA 4MG9B 2HVCA 2QXMA 2AWHA 1NAVA 2JJ3A 5DXEA 1T7MA 1XLSE 4OLMA 3TKCA 1XDKA 3M7RA 1UHLB 2A3IA 3PO9A 4OILA 2B1VA 1P93A 3OOKA 2JFAB 1LBDA 4REFA 3B1MA 5DV3A 3VRTA 1XB7A 2QE4A 3FALB 4MGAA 3UP3A 3DR1A 4OEZA 5FQTA 5KCTA 2H77A 4F9MA 1X7JA 3R8IA 2I4JA 4MGDB 1UPWA 1TXIA 1Y9RA 2VSTA 5DIDA 5DRJA 4YPQA 4ZN9A 2POGA 3D6DA 3IXPD 4M8EA 3OS9A 4POHA 2R40A 3ILZA 4R6SA 3VTCA 4IV2A 2NV7A 5HYKA 1I7GA 5L7GA 3QT0A 1YMTA 2Q1VA 4YT1A 2Q6SA 3OZJA 4DM6A 4S0SA 1Z5XE 2ZMJA 2PINA 2AXAA 1RK3A 5DXRA 4ZN7A 3LBDA 5LWPA 2Q61A 1YA3A 3B0RA 5DX3A 3Q95A 3CS6A 2QH6A 1YJEA 2G0GA 2Q5SA 2HWRA 2Q8SA 4OFUA 3X1HA 3W0CA 1EXXA 3RLJA 2G5OA 2YHDA 3DCTA 1X7EA 5DVVA 2QA8B 2XYWA 5DVCA 1EXAA 1L2IA 5I4VA 3D24A 4NUFA 3AN3A 2ZVTA 3FXVA 1XP6A 1U3RA 2QNVA 4LSJA 1XV9A 5E7VA 3KDUA 4TUZA 4IVYA 1XQCA 2QA6A 2ZNPA 3ERDA 5IZ0A 3ZRAA 5KCEA 5DZ0A 3HQ5A 4IWCA 1DB1A 3SP9A 5KCFA 2EWPA 5GICA 2ZASA 2PJLA 4RMEA 2ABIA 3RUUA 2AA2A 1I37A 2R40D 2OAXA 3VT9A 4FN9A 4CSJA 5B41A 3R29A 4Q50A 3DZUA 5DZHA 1YUCA 1EREA 2P54A 1NAXA 2Z4JA 5E0WA 4LNWA 2GPOA 2R6YA 4NIEA 4QM0A 3B0WA 5AAUA 3GWXA 3W0YA 4ZO1X 2O9IA 1OVLB 1T79A 5H1EA 1R20D 2Q70A 4XUMA 5DXPA 1G2NA 2IHQA 1ZKYA 5KRLA 3JZCA 4IW8A 2PIUA 3B0QA 1K7LA 5G5WA 2JF9A 3OLLA 1T76A 3ET3A 4PWLA 3RY9A 4YMQA 4XTAA 1NYXA 1YP0A 3AZ1A 3DT3A 1IE8A 5E0XA 2VV1B 4CI5A 1N46A 1QKTA 1R1KD 5C4OA 4JYGA 4L96A 4G20A 3V4AA 2ZBSA 3KBAA 3KDTA 1XNNA 3HO0A 5DLRA 3RVFA 1X78A 5AVLA 1M2ZA 5DVSA 2ZXZA 3G8OA 3UUAA 3W0GA 5IXKA 4XT9A 5KRJA 1NHZA 1XQ3A 1MV9A 1E3KA 3G0WA 4N8RA 1YYEA 1OT7A 4ZNSA 5AYGA 3WT7A 3OSIA 3D90A 5FQRA 4Q0AC 3VJTA 3X1IA 4PLEA 1KV6A 2Q60A 1N4HA 2YJAB 3OOFA 3PLZA 4MGBA 3W0AA 2AAXA 1T63A 3G9EA 4OJ9A 4CI4A 1I38A 5LGAA 2J14A 5L11A 3WJ4A 4K7AA 1IE9A 1ZDUA 4N5GA 3ERTA 4UDCA 2P7ZA 3VI8A 2HCDA 2YLPA 1FD0A 3A9EA 4G1DA 2ZK6A 3R8DA 2AA6A 2XYXA 3UP0A 4MG7B 3VHWA 1T74A 4Y29A 2BJ4A 2FSZA 3FEIA 3OSAA 4IU7A 1U3QA 2PIXA 4OKBA 3K6PA 4QE8A 1FBYA 1LV2A 2H79A 2PITA 3A2JA 3AN4A 5AWJA 2VV3A 3OLSA 4LTWA 2ZK1A 3CTBA 3MNOA 3IMYA 5DKBA 2HB7A 2HARA 4G1YA 3WMHA 5DY8A 2Q5PA 4FHIA 3IPQA 2B50A 4OJ4A 3WFFA 5SYZA 1ZGYA 2QABA 1HJ1A 4K6IA 4OZTU 5DV8A 4WLBA 4ZNVA 4PP3A 1H9UA 4TV1B 5APKA 3PBAA 3AX8A 3DCUA 4YNKA 3VT6A 3OMOA 3AZ3A 3GYUA 4HLWA 3KPZA 3L3XA 4J26A 3OS8C 5DRMA 2AA5A 2P1UA 5DXQA 4X1GA 2OUZA 3B67A 1XDKB 2OM9A 1PCGA 3WT6A 4IQRA 3EYBA 3CJWA 4A4VA 4OZRU 1T73A 1FCZA 4QL8A 5KRIA 3P88A 4MGAB 2YLQA 3GWSX 2ZNNA 4OZTE 3AUNA 4DMAA 5GIEA 2GP7A 5DV6A 3W0IA 2Z4BA 4DK7A 2PIQA 3ADSA 5DKSA 3CS8A 2ZL9A 3V3QA 3A78A 4P6WA 1Y0SA 1QKMA 3AZ2A 1NQ7A 1M13A 4PXMA 3W5RA 5GIDA 3KFCA 1K74A 3H52A 2YJDA 1T5ZA 4M8HA 1RKGA 2HWQA 5DYDA 5AWKA 1GWQA 2VV0A 5DIEA 3OSWA 4PRGA 4FNEA 1G50A 5DX3B 2IOKA 3Q95B 2Q59A 2ZKCA 4QE6A 1FCXA 3V9VA 1S0ZA 4WVDA 2IOGA 2ZXMA 3B68A 4MG8A 5DZ1A 3NSPA 4A2JA 2ACLA 2PNUA 5JJMA 1R20A 3OMPA 2ZLCA 1HG4A 1T7RA 3B5RA 4IW6A 4LNXA 5G42A 4N73A 1KKQA 5KCDA 3RLLA 1XV9B 4TUZB 2OVHA 3NSQA 5DXKA 1Y0XX 3OMKA 5EJVA 3X31A 3ADUA 3CQVA 3L0JA 1SR7A 2ATHA 2VV4A 4UDAA 2I4ZA 1XVPA 1P8DA 5DMFA 1R1KA 5KYJA 2I4PA 3WTQA 2AX6A 3P8XA 3JZBA 5EGVA 3VT5A 2ZNQA 4WPFA 2PIWA 3KMGA 4QK4A 1K74D 2FAIA 2V0VA 3AURA 3NOAA 4R06A 2REWA 4WQPA 3UVVA 3UUDA 5KR9A 3WWRA 2XYJA 3O1DA 1FM6A 2AX7A 4K4JA 2GTKA 4WHFA 3SP6A 4PP5A 3ET2A 2ZK3A 3GZ9A 3L0EA 4RZFA 3PEQA 3BEJA 4RUJA 2Q1HA 3V3EA 1DKFA 3UUCA 3W0JA 2Q6JA 3A3ZX 4FGYA 3T03A 5AZTA 3DZYD 4PPPA 2Q3YA 4A4WA 1BSXA 5DKGA 3B65A 4R2UA 3CDSA 1M7WA 5DWGA 2B1ZA 4MG5A 4EM9A 2QGTA 5HYRA 4OEDA 1RDTD 3VJSA 4IA2A 5JY3A 1XP1A 2AA7A 2AB2A 4OH6A 3RUTA 3TKMA 5C4TA 5KRKA 5GT4A 2I0GA 3PCUA 5AVIA 5G3JA 3UUAB 2QMVA 3VHVA 2QXSA 3V49A 2HC4A 1T7FA 1S9PA 3A40X 5APJA 5DU5A 2QSEA 4MDDA 3V9YA 3L03A 3HM1A 1G1UA 1FM6D 2XHSA 2Q5GA 4KZJA 4LBDA 2I0JA 4OIVA 5DUGA 5KRAA 4MGBB 2AX8A 1QKNA 3KMRA 3CS4A 3GD2A 2PIPL 3OAPA 3OMQA 4IA3A 5E19A 2PIVA 4OKXA 3UU7A 4HEEX 1SKXA 2ZXNA 5KCUA 5HCVA 5KRCA 1A28A 3A9EB 4XLDA 5DXBA 3KWYA 3B0TA 4ZNWA 3VHUA 1FM9A 3TX7B 2BJ4B 2P15A 3A2HA 3R5MA 3GYTA 5EI1A 4DM8A 4RMCA 1PQ6A 3K8SA 1Z95A 4G1ZA 1PK5A 3IPUA 3OS8A 1YIMA 4DQMA 4E2JA 1YOKA 1QKUA 3PRGA 2AO6A 3S9SA 5L7HA 2ZK0A 3OZ0A 4PF3A 4PPSA 2O4JA 5FQVA 3R5NA 2AMAA 3IA6A 4MG6A 5HJPA 5DP0A 4RFWA 4OEYA 5KRMA 1ILHA 1KNUA 4J24A 1UOMA 2QPYA 2VV2A 1WM0X 1SQNA 4OHAA 1X7BA 3OKHA 4UDDA 2HBHA 3VT3A 3HZFA 3HODA 2P1VA 3L1BA 2Q7IA 3F5CA 3L3ZA 2F4BA 2J7YA 4JYHA 4J5XC 3CWDA 1VJBA 2POBA 2OZ7A 3E7CA 1FM9D 3N00A 1NQ0A 5EHJA 2W8YA 4OIUA 1PDUA 3ADXA 2Q7JA 2FVJA 4OC7A 4ITFA 2P7GA 4RAKA 5E15A 5KRFA 1S9QA 1T7TA 4ITEA 2YLOA 5ACCA 1ZUCA 2QR9A 2LBDA 1NQ1A 4DOSA 4WHGA 5M96A 3AUQA 5HJSA 3DY6A
chains in the Genus database with same CATH superfamily
3BC5A 2YATA 2Q7KA 3AFRA 1NDEA 3B3KA 3ET1A 3W0HA 1YINA 2Q59B 4JGVA 2E2RA 2J4AA 5G46A 2PIRA 3W5PA 4MG8B 3VSPA 4J5WC 2AX9A 4PLDA 4OZRE 3MNEA 3VRUA 5IAWA 4IA1A 4B7WA 5JJMB 2ACLB 4REEA 1Z5XU 4MGCA 4OGHA 3VT7A 5G43A 5DUEA 4KZIA 2YFEA 1UPVA 4QJRA 3DZYA 4MG9A 4OKWA 3W5TA 3FUGA 4E4QA 4Q13A 2BAWA 4ZJWA 3U9QA 1MZNA 1UHLA 2QTUA 4FHHA 4IS8A 5DZIA 1YY4A 2JFAA 3O1EA 2VV4B 1XVPB 3D57A 3FALA 3GN8A 3GBKA 1T65A 1X76A 3VT8A 1RDTA 1XOWA 2GPUA 2PKLA 4OH5A 5DWIA 2QW4A 3KMZA 3UVVB 4MGDA 5DI7A 2J7XA 3UUDB 4S0TA 1XIUA 5DL4A 1PQCA 1ZH7A 1RJKA 2R6WA 3CDPA 5DSHA 4G2IA 1I7IA 1MVCA 3FURA 3H0AD 5APHA 5AZVA 2OCFA 4UDBA 1GS4A 2G44A 1OSHA 5E1CA 3D5FA 5ETHA 1DKFB 4RWVA 3OMMA 1PQ9A 2GPVA 1U9EA 3LMPA 5AK2A 5EITA 1XNXA 3BQDA 1ZAFA 4N1YA 4XAOA 5DXGA 4OFRA 2NXXA 1ERRA 2P4YA 3ADVA 2NW4A 3VT4A 5AAVB 5DUHA 3X36A 4IUIA 3VJHA 2QA8A 2QGWA 1SJ0A 2GL8A 4XI3A 1R6GA 4APUA 5B5BA 5AAVA 2HB8A 2Q7LA 2ZK5A 3OGTA 3OKIA 3OLFA 1OSVA 3ET0A 5DWLA 3VJIA 5G45A 5CJ6A 3VRWA 3HC6A 2ZFXA 3ZRBA 2XKWA 4ZOMA 3E00A 5FQSA 1TFCA 5KCWA 5L7EA 3CLDA 5HZCA 4NY9A 3TY0A 5DMCA 1NUOA 2P7AA 1PRGA 3WGPA 2ZK4A 3SZ1A 5K13A 4JL4A 2P1TA 4IWFA 3UU7B 4OEAA 2VSRA 2GIUA 2OVMA 4PP6A 1OVLA 4OJBA 2ZMHA 5DXBB 3VTDA 3VTBA 5KYAA 4IV4A 4OKTA 1N83A 4O8FA 2QZOB 5E14A 3K23A 3A2IA 3VSOA 2ZY0A 5C4SA 1R5KA 4G2HA 3WT5A 2QZOA 3P0UA 1XLSA 5G44A 3F7DA 2VV1A 4J5XA 5DIGA 5KCCA 2AYRA 1RKHA 5HJPB 3K22A 3E00D 1X7RA 3HVLA 1ZDTA 2YLYA 4S15A 1A52A 5JI0D 3V9TA 5KROA 3FEJA 3DZUD 2B23A 4P6XA 2ZMIA 2AMBA 1XAPA 5ICKA 3HLVA 1XJ7A 4E4KA 5DWJA 2AM9A 5DK9A 1XPCA 2PIOA 3B66A 3G8IA 3MNPA 4KZMA 4OARA 3R8AA 3VN2A 4ZI1A 3ADTA 2NXXE 1U3SA 5F9BA 3VRVA 1L2JA 2HFPA 3F5CB 5EC9A 4PVUA 2ZNOA 3ADWA 4ZNTA 4X1FA 1YOWA 4XUHA 4DK8A 3FC6B 3ZR7A 1GWRA 3FS1A 1GWXA 3HC5A 5KRHA 4ZNHA 4EMAA 1ZEOA 4ZNUA 1FCYA 5KD9A 3FC6A 4ONIA 2ZLAA 4MG7A 4G21A 3W5QA 4J5WA 3FLIA 5DTVA 3WFGA 4BCRA 3IPSA 3R2AA 2Q6RA 4IVWA 3KYTA 4L98A 2PRGA 2ZK2A 3ZQTA 2G0HA 4XHDA 4RZEA 4RZGA 4ZJRA 5DZ3A 3WJ5A 1ILGA 1K4WA 3IXPA 3L0LA 2O4RA 4S14A 1XZXX 4RMDA 1PZLA 5C4UA 1NRLA 1Q4XA 2GPPA 5DWEA 1NQ2A 1E3GA 4RUPA 1G5YA 5DXMA 2HAMA 4RUOX 2V7CA 5A86A 2NPAA 1S0XA 4TV1A 4NB6A 5DYBA 3H0AA 4OK1A 4ZO1B 3E94A 5FQPA 1S19A 2HASA 1XP9A 4IA7A 4POJA 4NQAB 3P89A 5DKEA 4RE8A 4JYIA 4JAZA 4DORA 2GWXA 4MG9B 2HVCA 2QXMA 2AWHA 1NAVA 2JJ3A 5DXEA 1T7MA 1XLSE 4OLMA 3TKCA 1XDKA 3M7RA 1UHLB 2A3IA 3PO9A 4OILA 2B1VA 1P93A 3OOKA 2JFAB 1LBDA 4REFA 3B1MA 5DV3A 3VRTA 1XB7A 2QE4A 3FALB 4MGAA 3UP3A 3DR1A 4OEZA 5FQTA 5KCTA 2H77A 4F9MA 1X7JA 3R8IA 2I4JA 4MGDB 1UPWA 1TXIA 1Y9RA 2VSTA 5DIDA 5DRJA 4YPQA 4ZN9A 2POGA 3D6DA 3IXPD 4M8EA 3OS9A 4POHA 2R40A 3ILZA 4R6SA 3VTCA 4IV2A 2NV7A 5HYKA 1I7GA 5L7GA 3QT0A 1YMTA 2Q1VA 4YT1A 2Q6SA 3OZJA 4DM6A 4S0SA 1Z5XE 2ZMJA 2PINA 2AXAA 1RK3A 5DXRA 4ZN7A 3LBDA 5LWPA 2Q61A 1YA3A 3B0RA 5DX3A 3Q95A 3CS6A 2QH6A 1YJEA 2G0GA 2Q5SA 2HWRA 2Q8SA 4OFUA 3X1HA 3W0CA 1EXXA 3RLJA 2G5OA 2YHDA 3DCTA 1X7EA 5DVVA 2QA8B 2XYWA 5DVCA 1EXAA 1L2IA 5I4VA 3D24A 4NUFA 3AN3A 2ZVTA 3FXVA 1XP6A 1U3RA 2QNVA 4LSJA 1XV9A 5E7VA 3KDUA 4TUZA 4IVYA 1XQCA 2QA6A 2ZNPA 3ERDA 5IZ0A 3ZRAA 5KCEA 5DZ0A 3HQ5A 4IWCA 1DB1A 3SP9A 5KCFA 2EWPA 5GICA 2ZASA 2PJLA 4RMEA 2ABIA 3RUUA 2AA2A 1I37A 2R40D 2OAXA 3VT9A 4FN9A 4CSJA 5B41A 3R29A 4Q50A 3DZUA 5DZHA 1YUCA 1EREA 2P54A 1NAXA 2Z4JA 5E0WA 4LNWA 2GPOA 2R6YA 4NIEA 4QM0A 3B0WA 5AAUA 3GWXA 3W0YA 4ZO1X 2O9IA 1OVLB 1T79A 5H1EA 1R20D 2Q70A 4XUMA 5DXPA 1G2NA 2IHQA 1ZKYA 5KRLA 3JZCA 4IW8A 2PIUA 3B0QA 1K7LA 5G5WA 2JF9A 3OLLA 1T76A 3ET3A 4PWLA 3RY9A 4YMQA 4XTAA 1NYXA 1YP0A 3AZ1A 3DT3A 1IE8A 5E0XA 2VV1B 4CI5A 1N46A 1QKTA 1R1KD 5C4OA 4JYGA 4L96A 4G20A 3V4AA 2ZBSA 3KBAA 3KDTA 1XNNA 3HO0A 5DLRA 3RVFA 1X78A 5AVLA 1M2ZA 5DVSA 2ZXZA 3G8OA 3UUAA 3W0GA 5IXKA 4XT9A 5KRJA 1NHZA 1XQ3A 1MV9A 1E3KA 3G0WA 4N8RA 1YYEA 1OT7A 4ZNSA 5AYGA 3WT7A 3OSIA 3D90A 5FQRA 4Q0AC 3VJTA 3X1IA 4PLEA 1KV6A 2Q60A 1N4HA 2YJAB 3OOFA 3PLZA 4MGBA 3W0AA 2AAXA 1T63A 3G9EA 4OJ9A 4CI4A 1I38A 5LGAA 2J14A 5L11A 3WJ4A 4K7AA 1IE9A 1ZDUA 4N5GA 3ERTA 4UDCA 2P7ZA 3VI8A 2HCDA 2YLPA 1FD0A 3A9EA 4G1DA 2ZK6A 3R8DA 2AA6A 2XYXA 3UP0A 4MG7B 3VHWA 1T74A 4Y29A 2BJ4A 2FSZA 3FEIA 3OSAA 4IU7A 1U3QA 2PIXA 4OKBA 3K6PA 4QE8A 1FBYA 1LV2A 2H79A 2PITA 3A2JA 3AN4A 5AWJA 2VV3A 3OLSA 4LTWA 2ZK1A 3CTBA 3MNOA 3IMYA 5DKBA 2HB7A 2HARA 4G1YA 3WMHA 5DY8A 2Q5PA 4FHIA 3IPQA 2B50A 4OJ4A 3WFFA 5SYZA 1ZGYA 2QABA 1HJ1A 4K6IA 4OZTU 5DV8A 4WLBA 4ZNVA 4PP3A 1H9UA 4TV1B 5APKA 3PBAA 3AX8A 3DCUA 4YNKA 3VT6A 3OMOA 3AZ3A 3GYUA 4HLWA 3KPZA 3L3XA 4J26A 3OS8C 5DRMA 2AA5A 2P1UA 5DXQA 4X1GA 2OUZA 3B67A 1XDKB 2OM9A 1PCGA 3WT6A 4IQRA 3EYBA 3CJWA 4A4VA 4OZRU 1T73A 1FCZA 4QL8A 5KRIA 3P88A 4MGAB 2YLQA 3GWSX 2ZNNA 4OZTE 3AUNA 4DMAA 5GIEA 2GP7A 5DV6A 3W0IA 2Z4BA 4DK7A 2PIQA 3ADSA 5DKSA 3CS8A 2ZL9A 3V3QA 3A78A 4P6WA 1Y0SA 1QKMA 3AZ2A 1NQ7A 1M13A 4PXMA 3W5RA 5GIDA 3KFCA 1K74A 3H52A 2YJDA 1T5ZA 4M8HA 1RKGA 2HWQA 5DYDA 5AWKA 1GWQA 2VV0A 5DIEA 3OSWA 4PRGA 4FNEA 1G50A 5DX3B 2IOKA 3Q95B 2Q59A 2ZKCA 4QE6A 1FCXA 3V9VA 1S0ZA 4WVDA 2IOGA 2ZXMA 3B68A 4MG8A 5DZ1A 3NSPA 4A2JA 2ACLA 2PNUA 5JJMA 1R20A 3OMPA 2ZLCA 1HG4A 1T7RA 3B5RA 4IW6A 4LNXA 5G42A 4N73A 1KKQA 5KCDA 3RLLA 1XV9B 4TUZB 2OVHA 3NSQA 5DXKA 1Y0XX 3OMKA 5EJVA 3X31A 3ADUA 3CQVA 3L0JA 1SR7A 2ATHA 2VV4A 4UDAA 2I4ZA 1XVPA 1P8DA 5DMFA 1R1KA 5KYJA 2I4PA 3WTQA 2AX6A 3P8XA 3JZBA 5EGVA 3VT5A 2ZNQA 4WPFA 2PIWA 3KMGA 4QK4A 1K74D 2FAIA 2V0VA 3AURA 3NOAA 4R06A 2REWA 4WQPA 3UVVA 3UUDA 5KR9A 3WWRA 2XYJA 3O1DA 1FM6A 2AX7A 4K4JA 2GTKA 4WHFA 3SP6A 4PP5A 3ET2A 2ZK3A 3GZ9A 3L0EA 4RZFA 3PEQA 3BEJA 4RUJA 2Q1HA 3V3EA 1DKFA 3UUCA 3W0JA 2Q6JA 3A3ZX 4FGYA 3T03A 5AZTA 3DZYD 4PPPA 2Q3YA 4A4WA 1BSXA 5DKGA 3B65A 4R2UA 3CDSA 1M7WA 5DWGA 2B1ZA 4MG5A 4EM9A 2QGTA 5HYRA 4OEDA 1RDTD 3VJSA 4IA2A 5JY3A 1XP1A 2AA7A 2AB2A 4OH6A 3RUTA 3TKMA 5C4TA 5KRKA 5GT4A 2I0GA 3PCUA 5AVIA 5G3JA 3UUAB 2QMVA 3VHVA 2QXSA 3V49A 2HC4A 1T7FA 1S9PA 3A40X 5APJA 5DU5A 2QSEA 4MDDA 3V9YA 3L03A 3HM1A 1G1UA 1FM6D 2XHSA 2Q5GA 4KZJA 4LBDA 2I0JA 4OIVA 5DUGA 5KRAA 4MGBB 2AX8A 1QKNA 3KMRA 3CS4A 3GD2A 2PIPL 3OAPA 3OMQA 4IA3A 5E19A 2PIVA 4OKXA 3UU7A 4HEEX 1SKXA 2ZXNA 5KCUA 5HCVA 5KRCA 1A28A 3A9EB 4XLDA 5DXBA 3KWYA 3B0TA 4ZNWA 3VHUA 1FM9A 3TX7B 2BJ4B 2P15A 3A2HA 3R5MA 3GYTA 5EI1A 4DM8A 4RMCA 1PQ6A 3K8SA 1Z95A 4G1ZA 1PK5A 3IPUA 3OS8A 1YIMA 4DQMA 4E2JA 1YOKA 1QKUA 3PRGA 2AO6A 3S9SA 5L7HA 2ZK0A 3OZ0A 4PF3A 4PPSA 2O4JA 5FQVA 3R5NA 2AMAA 3IA6A 4MG6A 5HJPA 5DP0A 4RFWA 4OEYA 5KRMA 1ILHA 1KNUA 4J24A 1UOMA 2QPYA 2VV2A 1WM0X 1SQNA 4OHAA 1X7BA 3OKHA 4UDDA 2HBHA 3VT3A 3HZFA 3HODA 2P1VA 3L1BA 2Q7IA 3F5CA 3L3ZA 2F4BA 2J7YA 4JYHA 4J5XC 3CWDA 1VJBA 2POBA 2OZ7A 3E7CA 1FM9D 3N00A 1NQ0A 5EHJA 2W8YA 4OIUA 1PDUA 3ADXA 2Q7JA 2FVJA 4OC7A 4ITFA 2P7GA 4RAKA 5E15A 5KRFA 1S9QA 1T7TA 4ITEA 2YLOA 5ACCA 1ZUCA 2QR9A 2LBDA 1NQ1A 4DOSA 4WHGA 5M96A 3AUQA 5HJSA 3DY6A
chains in the Genus database with same CATH topology
3BC5A 2YATA 2Q7KA 3AFRA 1NDEA 3B3KA 3ET1A 3W0HA 1YINA 2Q59B 4JGVA 2E2RA 2J4AA 5G46A 2PIRA 3W5PA 4MG8B 3VSPA 4J5WC 2AX9A 4PLDA 4OZRE 3MNEA 3VRUA 5IAWA 4IA1A 4B7WA 5JJMB 2ACLB 4REEA 1Z5XU 4MGCA 4OGHA 3VT7A 5G43A 5DUEA 4KZIA 2YFEA 1UPVA 4QJRA 3DZYA 4MG9A 4OKWA 3W5TA 3FUGA 4E4QA 4Q13A 2BAWA 4ZJWA 3U9QA 1MZNA 1UHLA 2QTUA 4FHHA 4IS8A 5DZIA 1YY4A 2JFAA 3O1EA 2VV4B 1XVPB 3D57A 3FALA 3GN8A 3GBKA 1T65A 1X76A 3VT8A 1RDTA 1XOWA 2GPUA 2PKLA 4OH5A 5DWIA 2QW4A 3KMZA 3UVVB 4MGDA 5DI7A 2J7XA 3UUDB 4S0TA 1XIUA 5DL4A 1PQCA 1ZH7A 1RJKA 2R6WA 3CDPA 5DSHA 4G2IA 1I7IA 1MVCA 3FURA 3H0AD 5APHA 5AZVA 2OCFA 4UDBA 1GS4A 2G44A 1OSHA 5E1CA 3D5FA 5ETHA 1DKFB 4RWVA 3OMMA 1PQ9A 2GPVA 1U9EA 3LMPA 5AK2A 5EITA 1XNXA 3BQDA 1ZAFA 4N1YA 4XAOA 5DXGA 4OFRA 2NXXA 1ERRA 2P4YA 3ADVA 2NW4A 3VT4A 5AAVB 5DUHA 3X36A 4IUIA 3VJHA 2QA8A 2QGWA 1SJ0A 2GL8A 4XI3A 1R6GA 4APUA 5B5BA 5AAVA 2HB8A 2Q7LA 2ZK5A 3OGTA 3OKIA 3OLFA 1OSVA 3ET0A 5DWLA 3VJIA 5G45A 5CJ6A 3VRWA 3HC6A 2ZFXA 3ZRBA 2XKWA 4ZOMA 3E00A 5FQSA 1TFCA 5KCWA 5L7EA 3CLDA 5HZCA 4NY9A 3TY0A 5DMCA 1NUOA 2P7AA 1PRGA 3WGPA 2ZK4A 3SZ1A 5K13A 4JL4A 2P1TA 4IWFA 3UU7B 4OEAA 2VSRA 2GIUA 2OVMA 4PP6A 1OVLA 4OJBA 2ZMHA 5DXBB 3VTDA 3VTBA 5KYAA 4IV4A 4OKTA 1N83A 4O8FA 2QZOB 5E14A 3K23A 3A2IA 3VSOA 2ZY0A 5C4SA 1R5KA 4G2HA 3WT5A 2QZOA 3P0UA 1XLSA 5G44A 3F7DA 2VV1A 4J5XA 5DIGA 5KCCA 2AYRA 1RKHA 5HJPB 3K22A 3E00D 1X7RA 3HVLA 1ZDTA 2YLYA 4S15A 1A52A 5JI0D 3V9TA 5KROA 3FEJA 3DZUD 2B23A 4P6XA 2ZMIA 2AMBA 1XAPA 5ICKA 3HLVA 1XJ7A 4E4KA 5DWJA 2AM9A 5DK9A 1XPCA 2PIOA 3B66A 3G8IA 3MNPA 4KZMA 4OARA 3R8AA 3VN2A 4ZI1A 3ADTA 2NXXE 1U3SA 5F9BA 3VRVA 1L2JA 2HFPA 3F5CB 5EC9A 4PVUA 2ZNOA 3ADWA 4ZNTA 4X1FA 1YOWA 4XUHA 4DK8A 3FC6B 3ZR7A 1GWRA 3FS1A 1GWXA 3HC5A 5KRHA 4ZNHA 4EMAA 1ZEOA 4ZNUA 1FCYA 5KD9A 3FC6A 4ONIA 2ZLAA 4MG7A 4G21A 3W5QA 4J5WA 3FLIA 5DTVA 3WFGA 4BCRA 3IPSA 3R2AA 2Q6RA 4IVWA 3KYTA 4L98A 2PRGA 2ZK2A 3ZQTA 2G0HA 4XHDA 4RZEA 4RZGA 4ZJRA 5DZ3A 3WJ5A 1ILGA 1K4WA 3IXPA 3L0LA 2O4RA 4S14A 1XZXX 4RMDA 1PZLA 5C4UA 1NRLA 1Q4XA 2GPPA 5DWEA 1NQ2A 1E3GA 4RUPA 1G5YA 5DXMA 2HAMA 4RUOX 2V7CA 5A86A 2NPAA 1S0XA 4TV1A 4NB6A 5DYBA 3H0AA 4OK1A 4ZO1B 3E94A 5FQPA 1S19A 2HASA 1XP9A 4IA7A 4POJA 4NQAB 3P89A 5DKEA 4RE8A 4JYIA 4JAZA 4DORA 2GWXA 4MG9B 2HVCA 2QXMA 2AWHA 1NAVA 2JJ3A 5DXEA 1T7MA 1XLSE 4OLMA 3TKCA 1XDKA 3M7RA 1UHLB 2A3IA 3PO9A 4OILA 2B1VA 1P93A 3OOKA 2JFAB 1LBDA 4REFA 3B1MA 5DV3A 3VRTA 1XB7A 2QE4A 3FALB 4MGAA 3UP3A 3DR1A 4OEZA 5FQTA 5KCTA 2H77A 4F9MA 1X7JA 3R8IA 2I4JA 4MGDB 1UPWA 1TXIA 1Y9RA 2VSTA 5DIDA 5DRJA 4YPQA 4ZN9A 2POGA 3D6DA 3IXPD 4M8EA 3OS9A 4POHA 2R40A 3ILZA 4R6SA 3VTCA 4IV2A 2NV7A 5HYKA 1I7GA 5L7GA 3QT0A 1YMTA 2Q1VA 4YT1A 2Q6SA 3OZJA 4DM6A 4S0SA 1Z5XE 2ZMJA 2PINA 2AXAA 1RK3A 5DXRA 4ZN7A 3LBDA 5LWPA 2Q61A 1YA3A 3B0RA 5DX3A 3Q95A 3CS6A 2QH6A 1YJEA 2G0GA 2Q5SA 2HWRA 2Q8SA 4OFUA 3X1HA 3W0CA 1EXXA 3RLJA 2G5OA 2YHDA 3DCTA 1X7EA 5DVVA 2QA8B 2XYWA 5DVCA 1EXAA 1L2IA 5I4VA 3D24A 4NUFA 3AN3A 2ZVTA 3FXVA 1XP6A 1U3RA 2QNVA 4LSJA 1XV9A 5E7VA 3KDUA 4TUZA 4IVYA 1XQCA 2QA6A 2ZNPA 3ERDA 5IZ0A 3ZRAA 5KCEA 5DZ0A 3HQ5A 4IWCA 1DB1A 3SP9A 5KCFA 2EWPA 5GICA 2ZASA 2PJLA 4RMEA 2ABIA 3RUUA 2AA2A 1I37A 2R40D 2OAXA 3VT9A 4FN9A 4CSJA 5B41A 3R29A 4Q50A 3DZUA 5DZHA 1YUCA 1EREA 2P54A 1NAXA 2Z4JA 5E0WA 4LNWA 2GPOA 2R6YA 4NIEA 4QM0A 3B0WA 5AAUA 3GWXA 3W0YA 4ZO1X 2O9IA 1OVLB 1T79A 5H1EA 1R20D 2Q70A 4XUMA 5DXPA 1G2NA 2IHQA 1ZKYA 5KRLA 3JZCA 4IW8A 2PIUA 3B0QA 1K7LA 5G5WA 2JF9A 3OLLA 1T76A 3ET3A 4PWLA 3RY9A 4YMQA 4XTAA 1NYXA 1YP0A 3AZ1A 3DT3A 1IE8A 5E0XA 2VV1B 4CI5A 1N46A 1QKTA 1R1KD 5C4OA 4JYGA 4L96A 4G20A 3V4AA 2ZBSA 3KBAA 3KDTA 1XNNA 3HO0A 5DLRA 3RVFA 1X78A 5AVLA 1M2ZA 5DVSA 2ZXZA 3G8OA 3UUAA 3W0GA 5IXKA 4XT9A 5KRJA 1NHZA 1XQ3A 1MV9A 1E3KA 3G0WA 4N8RA 1YYEA 1OT7A 4ZNSA 5AYGA 3WT7A 3OSIA 3D90A 5FQRA 4Q0AC 3VJTA 3X1IA 4PLEA 1KV6A 2Q60A 1N4HA 2YJAB 3OOFA 3PLZA 4MGBA 3W0AA 2AAXA 1T63A 3G9EA 4OJ9A 4CI4A 1I38A 5LGAA 2J14A 5L11A 3WJ4A 4K7AA 1IE9A 1ZDUA 4N5GA 3ERTA 4UDCA 2P7ZA 3VI8A 2HCDA 2YLPA 1FD0A 3A9EA 4G1DA 2ZK6A 3R8DA 2AA6A 2XYXA 3UP0A 4MG7B 3VHWA 1T74A 4Y29A 2BJ4A 2FSZA 3FEIA 3OSAA 4IU7A 1U3QA 2PIXA 4OKBA 3K6PA 4QE8A 1FBYA 1LV2A 2H79A 2PITA 3A2JA 3AN4A 5AWJA 2VV3A 3OLSA 4LTWA 2ZK1A 3CTBA 3MNOA 3IMYA 5DKBA 2HB7A 2HARA 4G1YA 3WMHA 5DY8A 2Q5PA 4FHIA 3IPQA 2B50A 4OJ4A 3WFFA 5SYZA 1ZGYA 2QABA 1HJ1A 4K6IA 4OZTU 5DV8A 4WLBA 4ZNVA 4PP3A 1H9UA 4TV1B 5APKA 3PBAA 3AX8A 3DCUA 4YNKA 3VT6A 3OMOA 3AZ3A 3GYUA 4HLWA 3KPZA 3L3XA 4J26A 3OS8C 5DRMA 2AA5A 2P1UA 5DXQA 4X1GA 2OUZA 3B67A 1XDKB 2OM9A 1PCGA 3WT6A 4IQRA 3EYBA 3CJWA 4A4VA 4OZRU 1T73A 1FCZA 4QL8A 5KRIA 3P88A 4MGAB 2YLQA 3GWSX 2ZNNA 4OZTE 3AUNA 4DMAA 5GIEA 2GP7A 5DV6A 3W0IA 2Z4BA 4DK7A 2PIQA 3ADSA 5DKSA 3CS8A 2ZL9A 3V3QA 3A78A 4P6WA 1Y0SA 1QKMA 3AZ2A 1NQ7A 1M13A 4PXMA 3W5RA 5GIDA 3KFCA 1K74A 3H52A 2YJDA 1T5ZA 4M8HA 1RKGA 2HWQA 5DYDA 5AWKA 1GWQA 2VV0A 5DIEA 3OSWA 4PRGA 4FNEA 1G50A 5DX3B 2IOKA 3Q95B 2Q59A 2ZKCA 4QE6A 1FCXA 3V9VA 1S0ZA 4WVDA 2IOGA 2ZXMA 3B68A 4MG8A 5DZ1A 3NSPA 4A2JA 2ACLA 2PNUA 5JJMA 1R20A 3OMPA 2ZLCA 1HG4A 1T7RA 3B5RA 4IW6A 4LNXA 5G42A 4N73A 1KKQA 5KCDA 3RLLA 1XV9B 4TUZB 2OVHA 3NSQA 5DXKA 1Y0XX 3OMKA 5EJVA 3X31A 3ADUA 3CQVA 3L0JA 1SR7A 2ATHA 2VV4A 4UDAA 2I4ZA 1XVPA 1P8DA 5DMFA 1R1KA 5KYJA 2I4PA 3WTQA 2AX6A 3P8XA 3JZBA 5EGVA 3VT5A 2ZNQA 4WPFA 2PIWA 3KMGA 4QK4A 1K74D 2FAIA 2V0VA 3AURA 3NOAA 4R06A 2REWA 4WQPA 3UVVA 3UUDA 5KR9A 3WWRA 2XYJA 3O1DA 1FM6A 2AX7A 4K4JA 2GTKA 4WHFA 3SP6A 4PP5A 3ET2A 2ZK3A 3GZ9A 3L0EA 4RZFA 3PEQA 3BEJA 4RUJA 2Q1HA 3V3EA 1DKFA 3UUCA 3W0JA 2Q6JA 3A3ZX 4FGYA 3T03A 5AZTA 3DZYD 4PPPA 2Q3YA 4A4WA 1BSXA 5DKGA 3B65A 4R2UA 3CDSA 1M7WA 5DWGA 2B1ZA 4MG5A 4EM9A 2QGTA 5HYRA 4OEDA 1RDTD 3VJSA 4IA2A 5JY3A 1XP1A 2AA7A 2AB2A 4OH6A 3RUTA 3TKMA 5C4TA 5KRKA 5GT4A 2I0GA 3PCUA 5AVIA 5G3JA 3UUAB 2QMVA 3VHVA 2QXSA 3V49A 2HC4A 1T7FA 1S9PA 3A40X 5APJA 5DU5A 2QSEA 4MDDA 3V9YA 3L03A 3HM1A 1G1UA 1FM6D 2XHSA 2Q5GA 4KZJA 4LBDA 2I0JA 4OIVA 5DUGA 5KRAA 4MGBB 2AX8A 1QKNA 3KMRA 3CS4A 3GD2A 2PIPL 3OAPA 3OMQA 4IA3A 5E19A 2PIVA 4OKXA 3UU7A 4HEEX 1SKXA 2ZXNA 5KCUA 5HCVA 5KRCA 1A28A 3A9EB 4XLDA 5DXBA 3KWYA 3B0TA 4ZNWA 3VHUA 1FM9A 3TX7B 2BJ4B 2P15A 3A2HA 3R5MA 3GYTA 5EI1A 4DM8A 4RMCA 1PQ6A 3K8SA 1Z95A 4G1ZA 1PK5A 3IPUA 3OS8A 1YIMA 4DQMA 4E2JA 1YOKA 1QKUA 3PRGA 2AO6A 3S9SA 5L7HA 2ZK0A 3OZ0A 4PF3A 4PPSA 2O4JA 5FQVA 3R5NA 2AMAA 3IA6A 4MG6A 5HJPA 5DP0A 4RFWA 4OEYA 5KRMA 1ILHA 1KNUA 4J24A 1UOMA 2QPYA 2VV2A 1WM0X 1SQNA 4OHAA 1X7BA 3OKHA 4UDDA 2HBHA 3VT3A 3HZFA 3HODA 2P1VA 3L1BA 2Q7IA 3F5CA 3L3ZA 2F4BA 2J7YA 4JYHA 4J5XC 3CWDA 1VJBA 2POBA 2OZ7A 3E7CA 1FM9D 3N00A 1NQ0A 5EHJA 2W8YA 4OIUA 1PDUA 3ADXA 2Q7JA 2FVJA 4OC7A 4ITFA 2P7GA 4RAKA 5E15A 5KRFA 1S9QA 1T7TA 4ITEA 2YLOA 5ACCA 1ZUCA 2QR9A 2LBDA 1NQ1A 4DOSA 4WHGA 5M96A 3AUQA 5HJSA 3DY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BC5 A;  2YAT A;  2Q7K A;  3AFR A;  1NDE A;  3B3K A;  3ET1 A;  3W0H A;  1YIN A;  2Q59 B;  4JGV A;  2E2R A;  2J4A A;  5G46 A;  2PIR A;  3W5P A;  4MG8 B;  3VSP A;  4J5W C;  2AX9 A;  4PLD A;  4OZR E;  3MNE A;  3VRU A;  5IAW A;  4IA1 A;  4B7W A;  5JJM B;  2ACL B;  4REE A;  1Z5X U;  4MGC A;  4OGH A;  3VT7 A;  5G43 A;  5DUE A;  4KZI A;  2YFE A;  1UPV A;  4QJR A;  3DZY A;  4MG9 A;  4OKW A;  3W5T A;  3FUG A;  4E4Q A;  4Q13 A;  2BAW A;  4ZJW A;  3U9Q A;  1MZN A;  1UHL A;  2QTU A;  4FHH A;  4IS8 A;  5DZI A;  1YY4 A;  2JFA A;  3O1E A;  2VV4 B;  1XVP B;  3D57 A;  3FAL A;  3GN8 A;  3GBK A;  1T65 A;  1X76 A;  3VT8 A;  1RDT A;  1XOW A;  2GPU A;  2PKL A;  4OH5 A;  5DWI A;  2QW4 A;  3KMZ A;  3UVV B;  4MGD A;  5DI7 A;  2J7X A;  3UUD B;  4S0T A;  1XIU A;  5DL4 A;  1PQC A;  1ZH7 A;  1RJK A;  2R6W A;  3CDP A;  5DSH A;  4G2I A;  1I7I A;  1MVC A;  3FUR A;  3H0A D;  5APH A;  5AZV A;  2OCF A;  4UDB A;  1GS4 A;  2G44 A;  1OSH A;  5E1C A;  3D5F A;  5ETH A;  1DKF B;  4RWV A;  3OMM A;  1PQ9 A;  2GPV A;  1U9E A;  3LMP A;  5AK2 A;  5EIT A;  1XNX A;  3BQD A;  1ZAF A;  4N1Y A;  4XAO A;  5DXG A;  4OFR A;  2NXX A;  1ERR A;  2P4Y A;  3ADV A;  2NW4 A;  3VT4 A;  5AAV B;  5DUH A;  3X36 A;  4IUI A;  3VJH A;  2QA8 A;  2QGW A;  1SJ0 A;  2GL8 A;  4XI3 A;  1R6G A;  4APU A;  5B5B A;  5AAV A;  2HB8 A;  2Q7L A;  2ZK5 A;  3OGT A;  3OKI A;  3OLF A;  1OSV A;  3ET0 A;  5DWL A;  3VJI A;  5G45 A;  5CJ6 A;  3VRW A;  3HC6 A;  2ZFX A;  3ZRB A;  2XKW A;  4ZOM A;  3E00 A;  5FQS A;  1TFC A;  5KCW A;  5L7E A;  3CLD A;  5HZC A;  4NY9 A;  3TY0 A;  5DMC A;  1NUO A;  2P7A A;  1PRG A;  3WGP A;  2ZK4 A;  3SZ1 A;  5K13 A;  4JL4 A;  2P1T A;  4IWF A;  3UU7 B;  4OEA A;  2VSR A;  2GIU A;  2OVM A;  4PP6 A;  1OVL A;  4OJB A;  2ZMH A;  5DXB B;  3VTD A;  3VTB A;  5KYA A;  4IV4 A;  4OKT A;  1N83 A;  4O8F A;  2QZO B;  5E14 A;  3K23 A;  3A2I A;  3VSO A;  2ZY0 A;  5C4S A;  1R5K A;  4G2H A;  3WT5 A;  2QZO A;  3P0U A;  1XLS A;  5G44 A;  3F7D A;  2VV1 A;  4J5X A;  5DIG A;  5KCC A;  2AYR A;  1RKH A;  5HJP B;  3K22 A;  3E00 D;  1X7R A;  3HVL A;  1ZDT A;  2YLY A;  4S15 A;  1A52 A;  5JI0 D;  3V9T A;  5KRO A;  3FEJ A;  3DZU D;  2B23 A;  4P6X A;  2ZMI A;  2AMB A;  1XAP A;  5ICK A;  3HLV A;  1XJ7 A;  4E4K A;  5DWJ A;  2AM9 A;  5DK9 A;  1XPC A;  2PIO A;  3B66 A;  3G8I A;  3MNP A;  4KZM A;  4OAR A;  3R8A A;  3VN2 A;  4ZI1 A;  3ADT A;  2NXX E;  1U3S A;  5F9B A;  3VRV A;  1L2J A;  2HFP A;  3F5C B;  5EC9 A;  4PVU A;  2ZNO A;  3ADW A;  4ZNT A;  4X1F A;  1YOW A;  4XUH A;  4DK8 A;  3FC6 B;  3ZR7 A;  1GWR A;  3FS1 A;  1GWX A;  3HC5 A;  5KRH A;  4ZNH A;  4EMA A;  1ZEO A;  4ZNU A;  1FCY A;  5KD9 A;  3FC6 A;  4ONI A;  2ZLA A;  4MG7 A;  4G21 A;  3W5Q A;  4J5W A;  3FLI A;  5DTV A;  3WFG A;  4BCR A;  3IPS A;  3R2A A;  2Q6R A;  4IVW A;  3KYT A;  4L98 A;  2PRG A;  2ZK2 A;  3ZQT A;  2G0H A;  4XHD A;  4RZE A;  4RZG A;  4ZJR A;  5DZ3 A;  3WJ5 A;  1ILG A;  1K4W A;  3IXP A;  3L0L A;  2O4R A;  4S14 A;  1XZX X;  4RMD A;  1PZL A;  5C4U A;  1NRL A;  1Q4X A;  2GPP A;  5DWE A;  1NQ2 A;  1E3G A;  4RUP A;  1G5Y A;  5DXM A;  2HAM A;  4RUO X;  2V7C A;  5A86 A;  2NPA A;  1S0X A;  4TV1 A;  4NB6 A;  5DYB A;  3H0A A;  4OK1 A;  4ZO1 B;  3E94 A;  5FQP A;  1S19 A;  2HAS A;  1XP9 A;  4IA7 A;  4POJ A;  4NQA B;  3P89 A;  5DKE A;  4RE8 A;  4JYI A;  4JAZ A;  4DOR A;  2GWX A;  4MG9 B;  2HVC A;  2QXM A;  2AWH A;  1NAV A;  2JJ3 A;  5DXE A;  1T7M A;  1XLS E;  4OLM A;  3TKC A;  1XDK A;  3M7R A;  1UHL B;  2A3I A;  3PO9 A;  4OIL A;  2B1V A;  1P93 A;  3OOK A;  2JFA B;  1LBD A;  4REF A;  3B1M A;  5DV3 A;  3VRT A;  1XB7 A;  2QE4 A;  3FAL B;  4MGA A;  3UP3 A;  3DR1 A;  4OEZ A;  5FQT A;  5KCT A;  2H77 A;  4F9M A;  1X7J A;  3R8I A;  2I4J A;  4MGD B;  1UPW A;  1TXI A;  1Y9R A;  2VST A;  5DID A;  5DRJ A;  4YPQ A;  4ZN9 A;  2POG A;  3D6D A;  3IXP D;  4M8E A;  3OS9 A;  4POH A;  2R40 A;  3ILZ A;  4R6S A;  3VTC A;  4IV2 A;  2NV7 A;  5HYK A;  1I7G A;  5L7G A;  3QT0 A;  1YMT A;  2Q1V A;  4YT1 A;  2Q6S A;  3OZJ A;  4DM6 A;  4S0S A;  1Z5X E;  2ZMJ A;  2PIN A;  2AXA A;  1RK3 A;  5DXR A;  4ZN7 A;  3LBD A;  5LWP A;  2Q61 A;  1YA3 A;  3B0R A;  5DX3 A;  3Q95 A;  3CS6 A;  2QH6 A;  1YJE A;  2G0G A;  2Q5S A;  2HWR A;  2Q8S A;  4OFU A;  3X1H A;  3W0C A;  1EXX A;  3RLJ A;  2G5O A;  2YHD A;  3DCT A;  1X7E A;  5DVV A;  2QA8 B;  2XYW A;  5DVC A;  1EXA A;  1L2I A;  5I4V A;  3D24 A;  4NUF A;  3AN3 A;  2ZVT A;  3FXV A;  1XP6 A;  1U3R A;  2QNV A;  4LSJ A;  1XV9 A;  5E7V A;  3KDU A;  4TUZ A;  4IVY A;  1XQC A;  2QA6 A;  2ZNP A;  3ERD A;  5IZ0 A;  3ZRA A;  5KCE A;  5DZ0 A;  3HQ5 A;  4IWC A;  1DB1 A;  3SP9 A;  5KCF A;  2EWP A;  5GIC A;  2ZAS A;  2PJL A;  4RME A;  2ABI A;  3RUU A;  2AA2 A;  1I37 A;  2R40 D;  2OAX A;  3VT9 A;  4FN9 A;  4CSJ A;  5B41 A;  3R29 A;  4Q50 A;  3DZU A;  5DZH A;  1YUC A;  1ERE A;  2P54 A;  1NAX A;  2Z4J A;  5E0W A;  4LNW A;  2GPO A;  2R6Y A;  4NIE A;  4QM0 A;  3B0W A;  5AAU A;  3GWX A;  3W0Y A;  4ZO1 X;  2O9I A;  1OVL B;  1T79 A;  5H1E A;  1R20 D;  2Q70 A;  4XUM A;  5DXP A;  1G2N A;  2IHQ A;  1ZKY A;  5KRL A;  3JZC A;  4IW8 A;  2PIU A;  3B0Q A;  1K7L A;  5G5W A;  2JF9 A;  3OLL A;  1T76 A;  3ET3 A;  4PWL A;  3RY9 A;  4YMQ A;  4XTA A;  1NYX A;  1YP0 A;  3AZ1 A;  3DT3 A;  1IE8 A;  5E0X A;  2VV1 B;  4CI5 A;  1N46 A;  1QKT A;  1R1K D;  5C4O A;  4JYG A;  4L96 A;  4G20 A;  3V4A A;  2ZBS A;  3KBA A;  3KDT A;  1XNN A;  3HO0 A;  5DLR A;  3RVF A;  1X78 A;  5AVL A;  1M2Z A;  5DVS A;  2ZXZ A;  3G8O A;  3UUA A;  3W0G A;  5IXK A;  4XT9 A;  5KRJ A;  1NHZ A;  1XQ3 A;  1MV9 A;  1E3K A;  3G0W A;  4N8R A;  1YYE A;  1OT7 A;  4ZNS A;  5AYG A;  3WT7 A;  3OSI A;  3D90 A;  5FQR A;  4Q0A C;  3VJT A;  3X1I A;  4PLE A;  1KV6 A;  2Q60 A;  1N4H A;  2YJA B;  3OOF A;  3PLZ A;  4MGB A;  3W0A A;  2AAX A;  1T63 A;  3G9E A;  4OJ9 A;  4CI4 A;  1I38 A;  5LGA A;  2J14 A;  5L11 A;  3WJ4 A;  4K7A A;  1IE9 A;  1ZDU A;  4N5G A;  3ERT A;  4UDC A;  2P7Z A;  3VI8 A;  2HCD A;  2YLP A;  1FD0 A;  3A9E A;  4G1D A;  2ZK6 A;  3R8D A;  2AA6 A;  2XYX A;  3UP0 A;  4MG7 B;  3VHW A;  1T74 A;  4Y29 A;  2BJ4 A;  2FSZ A;  3FEI A;  3OSA A;  4IU7 A;  1U3Q A;  2PIX A;  4OKB A;  3K6P A;  4QE8 A;  1FBY A;  1LV2 A;  2H79 A;  2PIT A;  3A2J A;  3AN4 A;  5AWJ A;  2VV3 A;  3OLS A;  4LTW A;  2ZK1 A;  3CTB A;  3MNO A;  3IMY A;  5DKB A;  2HB7 A;  2HAR A;  4G1Y A;  3WMH A;  5DY8 A;  2Q5P A;  4FHI A;  3IPQ A;  2B50 A;  4OJ4 A;  3WFF A;  5SYZ A;  1ZGY A;  2QAB A;  1HJ1 A;  4K6I A;  4OZT U;  5DV8 A;  4WLB A;  4ZNV A;  4PP3 A;  1H9U A;  4TV1 B;  5APK A;  3PBA A;  3AX8 A;  3DCU A;  4YNK A;  3VT6 A;  3OMO A;  3AZ3 A;  3GYU A;  4HLW A;  3KPZ A;  3L3X A;  4J26 A;  3OS8 C;  5DRM A;  2AA5 A;  2P1U A;  5DXQ A;  4X1G A;  2OUZ A;  3B67 A;  1XDK B;  2OM9 A;  1PCG A;  3WT6 A;  4IQR A;  3EYB A;  3CJW A;  4A4V A;  4OZR U;  1T73 A;  1FCZ A;  4QL8 A;  5KRI A;  3P88 A;  4MGA B;  2YLQ A;  3GWS X;  2ZNN A;  4OZT E;  3AUN A;  4DMA A;  5GIE A;  2GP7 A;  5DV6 A;  3W0I A;  2Z4B A;  4DK7 A;  2PIQ A;  3ADS A;  5DKS A;  3CS8 A;  2ZL9 A;  3V3Q A;  3A78 A;  4P6W A;  1Y0S A;  1QKM A;  3AZ2 A;  1NQ7 A;  1M13 A;  4PXM A;  3W5R A;  5GID A;  3KFC A;  1K74 A;  3H52 A;  2YJD A;  1T5Z A;  4M8H A;  1RKG A;  2HWQ A;  5DYD A;  5AWK A;  1GWQ A;  2VV0 A;  5DIE A;  3OSW A;  4PRG A;  4FNE A;  1G50 A;  5DX3 B;  2IOK A;  3Q95 B;  2Q59 A;  2ZKC A;  4QE6 A;  1FCX A;  3V9V A;  1S0Z A;  4WVD A;  2IOG A;  2ZXM A;  3B68 A;  4MG8 A;  5DZ1 A;  3NSP A;  4A2J A;  2ACL A;  2PNU A;  5JJM A;  1R20 A;  3OMP A;  2ZLC A;  1HG4 A;  1T7R A;  3B5R A;  4IW6 A;  4LNX A;  5G42 A;  4N73 A;  1KKQ A;  5KCD A;  3RLL A;  1XV9 B;  4TUZ B;  2OVH A;  3NSQ A;  5DXK A;  1Y0X X;  3OMK A;  5EJV A;  3X31 A;  3ADU A;  3CQV A;  3L0J A;  1SR7 A;  2ATH A;  2VV4 A;  4UDA A;  2I4Z A;  1XVP A;  1P8D A;  5DMF A;  1R1K A;  5KYJ A;  2I4P A;  3WTQ A;  2AX6 A;  3P8X A;  3JZB A;  5EGV A;  3VT5 A;  2ZNQ A;  4WPF A;  2PIW A;  3KMG A;  4QK4 A;  1K74 D;  2FAI A;  2V0V A;  3AUR A;  3NOA A;  4R06 A;  2REW A;  4WQP A;  3UVV A;  3UUD A;  5KR9 A;  3WWR A;  2XYJ A;  3O1D A;  1FM6 A;  2AX7 A;  4K4J A;  2GTK A;  4WHF A;  3SP6 A;  4PP5 A;  3ET2 A;  2ZK3 A;  3GZ9 A;  3L0E A;  4RZF A;  3PEQ A;  3BEJ A;  4RUJ A;  2Q1H A;  3V3E A;  1DKF A;  3UUC A;  3W0J A;  2Q6J A;  3A3Z X;  4FGY A;  3T03 A;  5AZT A;  3DZY D;  4PPP A;  2Q3Y A;  4A4W A;  1BSX A;  5DKG A;  3B65 A;  4R2U A;  3CDS A;  1M7W A;  5DWG A;  2B1Z A;  4MG5 A;  4EM9 A;  2QGT A;  5HYR A;  4OED A;  1RDT D;  3VJS A;  4IA2 A;  5JY3 A;  1XP1 A;  2AA7 A;  2AB2 A;  4OH6 A;  3RUT A;  3TKM A;  5C4T A;  5KRK A;  5GT4 A;  2I0G A;  3PCU A;  5AVI A;  5G3J A;  3UUA B;  2QMV A;  3VHV A;  2QXS A;  3V49 A;  2HC4 A;  1T7F A;  1S9P A;  3A40 X;  5APJ A;  5DU5 A;  2QSE A;  4MDD A;  3V9Y A;  3L03 A;  3HM1 A;  1G1U A;  1FM6 D;  2XHS A;  2Q5G A;  4KZJ A;  4LBD A;  2I0J A;  4OIV A;  5DUG A;  5KRA A;  4MGB B;  2AX8 A;  1QKN A;  3KMR A;  3CS4 A;  3GD2 A;  2PIP L;  3OAP A;  3OMQ A;  4IA3 A;  5E19 A;  2PIV A;  4OKX A;  3UU7 A;  4HEE X;  1SKX A;  2ZXN A;  5KCU A;  5HCV A;  5KRC A;  1A28 A;  3A9E B;  4XLD A;  5DXB A;  3KWY A;  3B0T A;  4ZNW A;  3VHU A;  1FM9 A;  3TX7 B;  2BJ4 B;  2P15 A;  3A2H A;  3R5M A;  3GYT A;  5EI1 A;  4DM8 A;  4RMC A;  1PQ6 A;  3K8S A;  1Z95 A;  4G1Z A;  1PK5 A;  3IPU A;  3OS8 A;  1YIM A;  4DQM A;  4E2J A;  1YOK A;  1QKU A;  3PRG A;  2AO6 A;  3S9S A;  5L7H A;  2ZK0 A;  3OZ0 A;  4PF3 A;  4PPS A;  2O4J A;  5FQV A;  3R5N A;  2AMA A;  3IA6 A;  4MG6 A;  5HJP A;  5DP0 A;  4RFW A;  4OEY A;  5KRM A;  1ILH A;  1KNU A;  4J24 A;  1UOM A;  2QPY A;  2VV2 A;  1WM0 X;  1SQN A;  4OHA A;  1X7B A;  3OKH A;  4UDD A;  2HBH A;  3VT3 A;  3HZF A;  3HOD A;  2P1V A;  3L1B A;  2Q7I A;  3F5C A;  3L3Z A;  2F4B A;  2J7Y A;  4JYH A;  4J5X C;  3CWD A;  1VJB A;  2POB A;  2OZ7 A;  3E7C A;  1FM9 D;  3N00 A;  1NQ0 A;  5EHJ A;  2W8Y A;  4OIU A;  1PDU A;  3ADX A;  2Q7J A;  2FVJ A;  4OC7 A;  4ITF A;  2P7G A;  4RAK A;  5E15 A;  5KRF A;  1S9Q A;  1T7T A;  4ITE A;  2YLO A;  5ACC A;  1ZUC A;  2QR9 A;  2LBD A;  1NQ1 A;  4DOS A;  4WHG A;  5M96 A;  3AUQ A;  5HJS A;  3DY6 A; 
#chains in the Genus database with same CATH topology
 3BC5 A;  2YAT A;  2Q7K A;  3AFR A;  1NDE A;  3B3K A;  3ET1 A;  3W0H A;  1YIN A;  2Q59 B;  4JGV A;  2E2R A;  2J4A A;  5G46 A;  2PIR A;  3W5P A;  4MG8 B;  3VSP A;  4J5W C;  2AX9 A;  4PLD A;  4OZR E;  3MNE A;  3VRU A;  5IAW A;  4IA1 A;  4B7W A;  5JJM B;  2ACL B;  4REE A;  1Z5X U;  4MGC A;  4OGH A;  3VT7 A;  5G43 A;  5DUE A;  4KZI A;  2YFE A;  1UPV A;  4QJR A;  3DZY A;  4MG9 A;  4OKW A;  3W5T A;  3FUG A;  4E4Q A;  4Q13 A;  2BAW A;  4ZJW A;  3U9Q A;  1MZN A;  1UHL A;  2QTU A;  4FHH A;  4IS8 A;  5DZI A;  1YY4 A;  2JFA A;  3O1E A;  2VV4 B;  1XVP B;  3D57 A;  3FAL A;  3GN8 A;  3GBK A;  1T65 A;  1X76 A;  3VT8 A;  1RDT A;  1XOW A;  2GPU A;  2PKL A;  4OH5 A;  5DWI A;  2QW4 A;  3KMZ A;  3UVV B;  4MGD A;  5DI7 A;  2J7X A;  3UUD B;  4S0T A;  1XIU A;  5DL4 A;  1PQC A;  1ZH7 A;  1RJK A;  2R6W A;  3CDP A;  5DSH A;  4G2I A;  1I7I A;  1MVC A;  3FUR A;  3H0A D;  5APH A;  5AZV A;  2OCF A;  4UDB A;  1GS4 A;  2G44 A;  1OSH A;  5E1C A;  3D5F A;  5ETH A;  1DKF B;  4RWV A;  3OMM A;  1PQ9 A;  2GPV A;  1U9E A;  3LMP A;  5AK2 A;  5EIT A;  1XNX A;  3BQD A;  1ZAF A;  4N1Y A;  4XAO A;  5DXG A;  4OFR A;  2NXX A;  1ERR A;  2P4Y A;  3ADV A;  2NW4 A;  3VT4 A;  5AAV B;  5DUH A;  3X36 A;  4IUI A;  3VJH A;  2QA8 A;  2QGW A;  1SJ0 A;  2GL8 A;  4XI3 A;  1R6G A;  4APU A;  5B5B A;  5AAV A;  2HB8 A;  2Q7L A;  2ZK5 A;  3OGT A;  3OKI A;  3OLF A;  1OSV A;  3ET0 A;  5DWL A;  3VJI A;  5G45 A;  5CJ6 A;  3VRW A;  3HC6 A;  2ZFX A;  3ZRB A;  2XKW A;  4ZOM A;  3E00 A;  5FQS A;  1TFC A;  5KCW A;  5L7E A;  3CLD A;  5HZC A;  4NY9 A;  3TY0 A;  5DMC A;  1NUO A;  2P7A A;  1PRG A;  3WGP A;  2ZK4 A;  3SZ1 A;  5K13 A;  4JL4 A;  2P1T A;  4IWF A;  3UU7 B;  4OEA A;  2VSR A;  2GIU A;  2OVM A;  4PP6 A;  1OVL A;  4OJB A;  2ZMH A;  5DXB B;  3VTD A;  3VTB A;  5KYA A;  4IV4 A;  4OKT A;  1N83 A;  4O8F A;  2QZO B;  5E14 A;  3K23 A;  3A2I A;  3VSO A;  2ZY0 A;  5C4S A;  1R5K A;  4G2H A;  3WT5 A;  2QZO A;  3P0U A;  1XLS A;  5G44 A;  3F7D A;  2VV1 A;  4J5X A;  5DIG A;  5KCC A;  2AYR A;  1RKH A;  5HJP B;  3K22 A;  3E00 D;  1X7R A;  3HVL A;  1ZDT A;  2YLY A;  4S15 A;  1A52 A;  5JI0 D;  3V9T A;  5KRO A;  3FEJ A;  3DZU D;  2B23 A;  4P6X A;  2ZMI A;  2AMB A;  1XAP A;  5ICK A;  3HLV A;  1XJ7 A;  4E4K A;  5DWJ A;  2AM9 A;  5DK9 A;  1XPC A;  2PIO A;  3B66 A;  3G8I A;  3MNP A;  4KZM A;  4OAR A;  3R8A A;  3VN2 A;  4ZI1 A;  3ADT A;  2NXX E;  1U3S A;  5F9B A;  3VRV A;  1L2J A;  2HFP A;  3F5C B;  5EC9 A;  4PVU A;  2ZNO A;  3ADW A;  4ZNT A;  4X1F A;  1YOW A;  4XUH A;  4DK8 A;  3FC6 B;  3ZR7 A;  1GWR A;  3FS1 A;  1GWX A;  3HC5 A;  5KRH A;  4ZNH A;  4EMA A;  1ZEO A;  4ZNU A;  1FCY A;  5KD9 A;  3FC6 A;  4ONI A;  2ZLA A;  4MG7 A;  4G21 A;  3W5Q A;  4J5W A;  3FLI A;  5DTV A;  3WFG A;  4BCR A;  3IPS A;  3R2A A;  2Q6R A;  4IVW A;  3KYT A;  4L98 A;  2PRG A;  2ZK2 A;  3ZQT A;  2G0H A;  4XHD A;  4RZE A;  4RZG A;  4ZJR A;  5DZ3 A;  3WJ5 A;  1ILG A;  1K4W A;  3IXP A;  3L0L A;  2O4R A;  4S14 A;  1XZX X;  4RMD A;  1PZL A;  5C4U A;  1NRL A;  1Q4X A;  2GPP A;  5DWE A;  1NQ2 A;  1E3G A;  4RUP A;  1G5Y A;  5DXM A;  2HAM A;  4RUO X;  2V7C A;  5A86 A;  2NPA A;  1S0X A;  4TV1 A;  4NB6 A;  5DYB A;  3H0A A;  4OK1 A;  4ZO1 B;  3E94 A;  5FQP A;  1S19 A;  2HAS A;  1XP9 A;  4IA7 A;  4POJ A;  4NQA B;  3P89 A;  5DKE A;  4RE8 A;  4JYI A;  4JAZ A;  4DOR A;  2GWX A;  4MG9 B;  2HVC A;  2QXM A;  2AWH A;  1NAV A;  2JJ3 A;  5DXE A;  1T7M A;  1XLS E;  4OLM A;  3TKC A;  1XDK A;  3M7R A;  1UHL B;  2A3I A;  3PO9 A;  4OIL A;  2B1V A;  1P93 A;  3OOK A;  2JFA B;  1LBD A;  4REF A;  3B1M A;  5DV3 A;  3VRT A;  1XB7 A;  2QE4 A;  3FAL B;  4MGA A;  3UP3 A;  3DR1 A;  4OEZ A;  5FQT A;  5KCT A;  2H77 A;  4F9M A;  1X7J A;  3R8I A;  2I4J A;  4MGD B;  1UPW A;  1TXI A;  1Y9R A;  2VST A;  5DID A;  5DRJ A;  4YPQ A;  4ZN9 A;  2POG A;  3D6D A;  3IXP D;  4M8E A;  3OS9 A;  4POH A;  2R40 A;  3ILZ A;  4R6S A;  3VTC A;  4IV2 A;  2NV7 A;  5HYK A;  1I7G A;  5L7G A;  3QT0 A;  1YMT A;  2Q1V A;  4YT1 A;  2Q6S A;  3OZJ A;  4DM6 A;  4S0S A;  1Z5X E;  2ZMJ A;  2PIN A;  2AXA A;  1RK3 A;  5DXR A;  4ZN7 A;  3LBD A;  5LWP A;  2Q61 A;  1YA3 A;  3B0R A;  5DX3 A;  3Q95 A;  3CS6 A;  2QH6 A;  1YJE A;  2G0G A;  2Q5S A;  2HWR A;  2Q8S A;  4OFU A;  3X1H A;  3W0C A;  1EXX A;  3RLJ A;  2G5O A;  2YHD A;  3DCT A;  1X7E A;  5DVV A;  2QA8 B;  2XYW A;  5DVC A;  1EXA A;  1L2I A;  5I4V A;  3D24 A;  4NUF A;  3AN3 A;  2ZVT A;  3FXV A;  1XP6 A;  1U3R A;  2QNV A;  4LSJ A;  1XV9 A;  5E7V A;  3KDU A;  4TUZ A;  4IVY A;  1XQC A;  2QA6 A;  2ZNP A;  3ERD A;  5IZ0 A;  3ZRA A;  5KCE A;  5DZ0 A;  3HQ5 A;  4IWC A;  1DB1 A;  3SP9 A;  5KCF A;  2EWP A;  5GIC A;  2ZAS A;  2PJL A;  4RME A;  2ABI A;  3RUU A;  2AA2 A;  1I37 A;  2R40 D;  2OAX A;  3VT9 A;  4FN9 A;  4CSJ A;  5B41 A;  3R29 A;  4Q50 A;  3DZU A;  5DZH A;  1YUC A;  1ERE A;  2P54 A;  1NAX A;  2Z4J A;  5E0W A;  4LNW A;  2GPO A;  2R6Y A;  4NIE A;  4QM0 A;  3B0W A;  5AAU A;  3GWX A;  3W0Y A;  4ZO1 X;  2O9I A;  1OVL B;  1T79 A;  5H1E A;  1R20 D;  2Q70 A;  4XUM A;  5DXP A;  1G2N A;  2IHQ A;  1ZKY A;  5KRL A;  3JZC A;  4IW8 A;  2PIU A;  3B0Q A;  1K7L A;  5G5W A;  2JF9 A;  3OLL A;  1T76 A;  3ET3 A;  4PWL A;  3RY9 A;  4YMQ A;  4XTA A;  1NYX A;  1YP0 A;  3AZ1 A;  3DT3 A;  1IE8 A;  5E0X A;  2VV1 B;  4CI5 A;  1N46 A;  1QKT A;  1R1K D;  5C4O A;  4JYG A;  4L96 A;  4G20 A;  3V4A A;  2ZBS A;  3KBA A;  3KDT A;  1XNN A;  3HO0 A;  5DLR A;  3RVF A;  1X78 A;  5AVL A;  1M2Z A;  5DVS A;  2ZXZ A;  3G8O A;  3UUA A;  3W0G A;  5IXK A;  4XT9 A;  5KRJ A;  1NHZ A;  1XQ3 A;  1MV9 A;  1E3K A;  3G0W A;  4N8R A;  1YYE A;  1OT7 A;  4ZNS A;  5AYG A;  3WT7 A;  3OSI A;  3D90 A;  5FQR A;  4Q0A C;  3VJT A;  3X1I A;  4PLE A;  1KV6 A;  2Q60 A;  1N4H A;  2YJA B;  3OOF A;  3PLZ A;  4MGB A;  3W0A A;  2AAX A;  1T63 A;  3G9E A;  4OJ9 A;  4CI4 A;  1I38 A;  5LGA A;  2J14 A;  5L11 A;  3WJ4 A;  4K7A A;  1IE9 A;  1ZDU A;  4N5G A;  3ERT A;  4UDC A;  2P7Z A;  3VI8 A;  2HCD A;  2YLP A;  1FD0 A;  3A9E A;  4G1D A;  2ZK6 A;  3R8D A;  2AA6 A;  2XYX A;  3UP0 A;  4MG7 B;  3VHW A;  1T74 A;  4Y29 A;  2BJ4 A;  2FSZ A;  3FEI A;  3OSA A;  4IU7 A;  1U3Q A;  2PIX A;  4OKB A;  3K6P A;  4QE8 A;  1FBY A;  1LV2 A;  2H79 A;  2PIT A;  3A2J A;  3AN4 A;  5AWJ A;  2VV3 A;  3OLS A;  4LTW A;  2ZK1 A;  3CTB A;  3MNO A;  3IMY A;  5DKB A;  2HB7 A;  2HAR A;  4G1Y A;  3WMH A;  5DY8 A;  2Q5P A;  4FHI A;  3IPQ A;  2B50 A;  4OJ4 A;  3WFF A;  5SYZ A;  1ZGY A;  2QAB A;  1HJ1 A;  4K6I A;  4OZT U;  5DV8 A;  4WLB A;  4ZNV A;  4PP3 A;  1H9U A;  4TV1 B;  5APK A;  3PBA A;  3AX8 A;  3DCU A;  4YNK A;  3VT6 A;  3OMO A;  3AZ3 A;  3GYU A;  4HLW A;  3KPZ A;  3L3X A;  4J26 A;  3OS8 C;  5DRM A;  2AA5 A;  2P1U A;  5DXQ A;  4X1G A;  2OUZ A;  3B67 A;  1XDK B;  2OM9 A;  1PCG A;  3WT6 A;  4IQR A;  3EYB A;  3CJW A;  4A4V A;  4OZR U;  1T73 A;  1FCZ A;  4QL8 A;  5KRI A;  3P88 A;  4MGA B;  2YLQ A;  3GWS X;  2ZNN A;  4OZT E;  3AUN A;  4DMA A;  5GIE A;  2GP7 A;  5DV6 A;  3W0I A;  2Z4B A;  4DK7 A;  2PIQ A;  3ADS A;  5DKS A;  3CS8 A;  2ZL9 A;  3V3Q A;  3A78 A;  4P6W A;  1Y0S A;  1QKM A;  3AZ2 A;  1NQ7 A;  1M13 A;  4PXM A;  3W5R A;  5GID A;  3KFC A;  1K74 A;  3H52 A;  2YJD A;  1T5Z A;  4M8H A;  1RKG A;  2HWQ A;  5DYD A;  5AWK A;  1GWQ A;  2VV0 A;  5DIE A;  3OSW A;  4PRG A;  4FNE A;  1G50 A;  5DX3 B;  2IOK A;  3Q95 B;  2Q59 A;  2ZKC A;  4QE6 A;  1FCX A;  3V9V A;  1S0Z A;  4WVD A;  2IOG A;  2ZXM A;  3B68 A;  4MG8 A;  5DZ1 A;  3NSP A;  4A2J A;  2ACL A;  2PNU A;  5JJM A;  1R20 A;  3OMP A;  2ZLC A;  1HG4 A;  1T7R A;  3B5R A;  4IW6 A;  4LNX A;  5G42 A;  4N73 A;  1KKQ A;  5KCD A;  3RLL A;  1XV9 B;  4TUZ B;  2OVH A;  3NSQ A;  5DXK A;  1Y0X X;  3OMK A;  5EJV A;  3X31 A;  3ADU A;  3CQV A;  3L0J A;  1SR7 A;  2ATH A;  2VV4 A;  4UDA A;  2I4Z A;  1XVP A;  1P8D A;  5DMF A;  1R1K A;  5KYJ A;  2I4P A;  3WTQ A;  2AX6 A;  3P8X A;  3JZB A;  5EGV A;  3VT5 A;  2ZNQ A;  4WPF A;  2PIW A;  3KMG A;  4QK4 A;  1K74 D;  2FAI A;  2V0V A;  3AUR A;  3NOA A;  4R06 A;  2REW A;  4WQP A;  3UVV A;  3UUD A;  5KR9 A;  3WWR A;  2XYJ A;  3O1D A;  1FM6 A;  2AX7 A;  4K4J A;  2GTK A;  4WHF A;  3SP6 A;  4PP5 A;  3ET2 A;  2ZK3 A;  3GZ9 A;  3L0E A;  4RZF A;  3PEQ A;  3BEJ A;  4RUJ A;  2Q1H A;  3V3E A;  1DKF A;  3UUC A;  3W0J A;  2Q6J A;  3A3Z X;  4FGY A;  3T03 A;  5AZT A;  3DZY D;  4PPP A;  2Q3Y A;  4A4W A;  1BSX A;  5DKG A;  3B65 A;  4R2U A;  3CDS A;  1M7W A;  5DWG A;  2B1Z A;  4MG5 A;  4EM9 A;  2QGT A;  5HYR A;  4OED A;  1RDT D;  3VJS A;  4IA2 A;  5JY3 A;  1XP1 A;  2AA7 A;  2AB2 A;  4OH6 A;  3RUT A;  3TKM A;  5C4T A;  5KRK A;  5GT4 A;  2I0G A;  3PCU A;  5AVI A;  5G3J A;  3UUA B;  2QMV A;  3VHV A;  2QXS A;  3V49 A;  2HC4 A;  1T7F A;  1S9P A;  3A40 X;  5APJ A;  5DU5 A;  2QSE A;  4MDD A;  3V9Y A;  3L03 A;  3HM1 A;  1G1U A;  1FM6 D;  2XHS A;  2Q5G A;  4KZJ A;  4LBD A;  2I0J A;  4OIV A;  5DUG A;  5KRA A;  4MGB B;  2AX8 A;  1QKN A;  3KMR A;  3CS4 A;  3GD2 A;  2PIP L;  3OAP A;  3OMQ A;  4IA3 A;  5E19 A;  2PIV A;  4OKX A;  3UU7 A;  4HEE X;  1SKX A;  2ZXN A;  5KCU A;  5HCV A;  5KRC A;  1A28 A;  3A9E B;  4XLD A;  5DXB A;  3KWY A;  3B0T A;  4ZNW A;  3VHU A;  1FM9 A;  3TX7 B;  2BJ4 B;  2P15 A;  3A2H A;  3R5M A;  3GYT A;  5EI1 A;  4DM8 A;  4RMC A;  1PQ6 A;  3K8S A;  1Z95 A;  4G1Z A;  1PK5 A;  3IPU A;  3OS8 A;  1YIM A;  4DQM A;  4E2J A;  1YOK A;  1QKU A;  3PRG A;  2AO6 A;  3S9S A;  5L7H A;  2ZK0 A;  3OZ0 A;  4PF3 A;  4PPS A;  2O4J A;  5FQV A;  3R5N A;  2AMA A;  3IA6 A;  4MG6 A;  5HJP A;  5DP0 A;  4RFW A;  4OEY A;  5KRM A;  1ILH A;  1KNU A;  4J24 A;  1UOM A;  2QPY A;  2VV2 A;  1WM0 X;  1SQN A;  4OHA A;  1X7B A;  3OKH A;  4UDD A;  2HBH A;  3VT3 A;  3HZF A;  3HOD A;  2P1V A;  3L1B A;  2Q7I A;  3F5C A;  3L3Z A;  2F4B A;  2J7Y A;  4JYH A;  4J5X C;  3CWD A;  1VJB A;  2POB A;  2OZ7 A;  3E7C A;  1FM9 D;  3N00 A;  1NQ0 A;  5EHJ A;  2W8Y A;  4OIU A;  1PDU A;  3ADX A;  2Q7J A;  2FVJ A;  4OC7 A;  4ITF A;  2P7G A;  4RAK A;  5E15 A;  5KRF A;  1S9Q A;  1T7T A;  4ITE A;  2YLO A;  5ACC A;  1ZUC A;  2QR9 A;  2LBD A;  1NQ1 A;  4DOS A;  4WHG A;  5M96 A;  3AUQ A;  5HJS A;  3DY6 A; 
#chains in the Genus database with same CATH homology
 3BC5 A;  2YAT A;  2Q7K A;  3AFR A;  1NDE A;  3B3K A;  3ET1 A;  3W0H A;  1YIN A;  2Q59 B;  4JGV A;  2E2R A;  2J4A A;  5G46 A;  2PIR A;  3W5P A;  4MG8 B;  3VSP A;  4J5W C;  2AX9 A;  4PLD A;  4OZR E;  3MNE A;  3VRU A;  5IAW A;  4IA1 A;  4B7W A;  5JJM B;  2ACL B;  4REE A;  1Z5X U;  4MGC A;  4OGH A;  3VT7 A;  5G43 A;  5DUE A;  4KZI A;  2YFE A;  1UPV A;  4QJR A;  3DZY A;  4MG9 A;  4OKW A;  3W5T A;  3FUG A;  4E4Q A;  4Q13 A;  2BAW A;  4ZJW A;  3U9Q A;  1MZN A;  1UHL A;  2QTU A;  4FHH A;  4IS8 A;  5DZI A;  1YY4 A;  2JFA A;  3O1E A;  2VV4 B;  1XVP B;  3D57 A;  3FAL A;  3GN8 A;  3GBK A;  1T65 A;  1X76 A;  3VT8 A;  1RDT A;  1XOW A;  2GPU A;  2PKL A;  4OH5 A;  5DWI A;  2QW4 A;  3KMZ A;  3UVV B;  4MGD A;  5DI7 A;  2J7X A;  3UUD B;  4S0T A;  1XIU A;  5DL4 A;  1PQC A;  1ZH7 A;  1RJK A;  2R6W A;  3CDP A;  5DSH A;  4G2I A;  1I7I A;  1MVC A;  3FUR A;  3H0A D;  5APH A;  5AZV A;  2OCF A;  4UDB A;  1GS4 A;  2G44 A;  1OSH A;  5E1C A;  3D5F A;  5ETH A;  1DKF B;  4RWV A;  3OMM A;  1PQ9 A;  2GPV A;  1U9E A;  3LMP A;  5AK2 A;  5EIT A;  1XNX A;  3BQD A;  1ZAF A;  4N1Y A;  4XAO A;  5DXG A;  4OFR A;  2NXX A;  1ERR A;  2P4Y A;  3ADV A;  2NW4 A;  3VT4 A;  5AAV B;  5DUH A;  3X36 A;  4IUI A;  3VJH A;  2QA8 A;  2QGW A;  1SJ0 A;  2GL8 A;  4XI3 A;  1R6G A;  4APU A;  5B5B A;  5AAV A;  2HB8 A;  2Q7L A;  2ZK5 A;  3OGT A;  3OKI A;  3OLF A;  1OSV A;  3ET0 A;  5DWL A;  3VJI A;  5G45 A;  5CJ6 A;  3VRW A;  3HC6 A;  2ZFX A;  3ZRB A;  2XKW A;  4ZOM A;  3E00 A;  5FQS A;  1TFC A;  5KCW A;  5L7E A;  3CLD A;  5HZC A;  4NY9 A;  3TY0 A;  5DMC A;  1NUO A;  2P7A A;  1PRG A;  3WGP A;  2ZK4 A;  3SZ1 A;  5K13 A;  4JL4 A;  2P1T A;  4IWF A;  3UU7 B;  4OEA A;  2VSR A;  2GIU A;  2OVM A;  4PP6 A;  1OVL A;  4OJB A;  2ZMH A;  5DXB B;  3VTD A;  3VTB A;  5KYA A;  4IV4 A;  4OKT A;  1N83 A;  4O8F A;  2QZO B;  5E14 A;  3K23 A;  3A2I A;  3VSO A;  2ZY0 A;  5C4S A;  1R5K A;  4G2H A;  3WT5 A;  2QZO A;  3P0U A;  1XLS A;  5G44 A;  3F7D A;  2VV1 A;  4J5X A;  5DIG A;  5KCC A;  2AYR A;  1RKH A;  5HJP B;  3K22 A;  3E00 D;  1X7R A;  3HVL A;  1ZDT A;  2YLY A;  4S15 A;  1A52 A;  5JI0 D;  3V9T A;  5KRO A;  3FEJ A;  3DZU D;  2B23 A;  4P6X A;  2ZMI A;  2AMB A;  1XAP A;  5ICK A;  3HLV A;  1XJ7 A;  4E4K A;  5DWJ A;  2AM9 A;  5DK9 A;  1XPC A;  2PIO A;  3B66 A;  3G8I A;  3MNP A;  4KZM A;  4OAR A;  3R8A A;  3VN2 A;  4ZI1 A;  3ADT A;  2NXX E;  1U3S A;  5F9B A;  3VRV A;  1L2J A;  2HFP A;  3F5C B;  5EC9 A;  4PVU A;  2ZNO A;  3ADW A;  4ZNT A;  4X1F A;  1YOW A;  4XUH A;  4DK8 A;  3FC6 B;  3ZR7 A;  1GWR A;  3FS1 A;  1GWX A;  3HC5 A;  5KRH A;  4ZNH A;  4EMA A;  1ZEO A;  4ZNU A;  1FCY A;  5KD9 A;  3FC6 A;  4ONI A;  2ZLA A;  4MG7 A;  4G21 A;  3W5Q A;  4J5W A;  3FLI A;  5DTV A;  3WFG A;  4BCR A;  3IPS A;  3R2A A;  2Q6R A;  4IVW A;  3KYT A;  4L98 A;  2PRG A;  2ZK2 A;  3ZQT A;  2G0H A;  4XHD A;  4RZE A;  4RZG A;  4ZJR A;  5DZ3 A;  3WJ5 A;  1ILG A;  1K4W A;  3IXP A;  3L0L A;  2O4R A;  4S14 A;  1XZX X;  4RMD A;  1PZL A;  5C4U A;  1NRL A;  1Q4X A;  2GPP A;  5DWE A;  1NQ2 A;  1E3G A;  4RUP A;  1G5Y A;  5DXM A;  2HAM A;  4RUO X;  2V7C A;  5A86 A;  2NPA A;  1S0X A;  4TV1 A;  4NB6 A;  5DYB A;  3H0A A;  4OK1 A;  4ZO1 B;  3E94 A;  5FQP A;  1S19 A;  2HAS A;  1XP9 A;  4IA7 A;  4POJ A;  4NQA B;  3P89 A;  5DKE A;  4RE8 A;  4JYI A;  4JAZ A;  4DOR A;  2GWX A;  4MG9 B;  2HVC A;  2QXM A;  2AWH A;  1NAV A;  2JJ3 A;  5DXE A;  1T7M A;  1XLS E;  4OLM A;  3TKC A;  1XDK A;  3M7R A;  1UHL B;  2A3I A;  3PO9 A;  4OIL A;  2B1V A;  1P93 A;  3OOK A;  2JFA B;  1LBD A;  4REF A;  3B1M A;  5DV3 A;  3VRT A;  1XB7 A;  2QE4 A;  3FAL B;  4MGA A;  3UP3 A;  3DR1 A;  4OEZ A;  5FQT A;  5KCT A;  2H77 A;  4F9M A;  1X7J A;  3R8I A;  2I4J A;  4MGD B;  1UPW A;  1TXI A;  1Y9R A;  2VST A;  5DID A;  5DRJ A;  4YPQ A;  4ZN9 A;  2POG A;  3D6D A;  3IXP D;  4M8E A;  3OS9 A;  4POH A;  2R40 A;  3ILZ A;  4R6S A;  3VTC A;  4IV2 A;  2NV7 A;  5HYK A;  1I7G A;  5L7G A;  3QT0 A;  1YMT A;  2Q1V A;  4YT1 A;  2Q6S A;  3OZJ A;  4DM6 A;  4S0S A;  1Z5X E;  2ZMJ A;  2PIN A;  2AXA A;  1RK3 A;  5DXR A;  4ZN7 A;  3LBD A;  5LWP A;  2Q61 A;  1YA3 A;  3B0R A;  5DX3 A;  3Q95 A;  3CS6 A;  2QH6 A;  1YJE A;  2G0G A;  2Q5S A;  2HWR A;  2Q8S A;  4OFU A;  3X1H A;  3W0C A;  1EXX A;  3RLJ A;  2G5O A;  2YHD A;  3DCT A;  1X7E A;  5DVV A;  2QA8 B;  2XYW A;  5DVC A;  1EXA A;  1L2I A;  5I4V A;  3D24 A;  4NUF A;  3AN3 A;  2ZVT A;  3FXV A;  1XP6 A;  1U3R A;  2QNV A;  4LSJ A;  1XV9 A;  5E7V A;  3KDU A;  4TUZ A;  4IVY A;  1XQC A;  2QA6 A;  2ZNP A;  3ERD A;  5IZ0 A;  3ZRA A;  5KCE A;  5DZ0 A;  3HQ5 A;  4IWC A;  1DB1 A;  3SP9 A;  5KCF A;  2EWP A;  5GIC A;  2ZAS A;  2PJL A;  4RME A;  2ABI A;  3RUU A;  2AA2 A;  1I37 A;  2R40 D;  2OAX A;  3VT9 A;  4FN9 A;  4CSJ A;  5B41 A;  3R29 A;  4Q50 A;  3DZU A;  5DZH A;  1YUC A;  1ERE A;  2P54 A;  1NAX A;  2Z4J A;  5E0W A;  4LNW A;  2GPO A;  2R6Y A;  4NIE A;  4QM0 A;  3B0W A;  5AAU A;  3GWX A;  3W0Y A;  4ZO1 X;  2O9I A;  1OVL B;  1T79 A;  5H1E A;  1R20 D;  2Q70 A;  4XUM A;  5DXP A;  1G2N A;  2IHQ A;  1ZKY A;  5KRL A;  3JZC A;  4IW8 A;  2PIU A;  3B0Q A;  1K7L A;  5G5W A;  2JF9 A;  3OLL A;  1T76 A;  3ET3 A;  4PWL A;  3RY9 A;  4YMQ A;  4XTA A;  1NYX A;  1YP0 A;  3AZ1 A;  3DT3 A;  1IE8 A;  5E0X A;  2VV1 B;  4CI5 A;  1N46 A;  1QKT A;  1R1K D;  5C4O A;  4JYG A;  4L96 A;  4G20 A;  3V4A A;  2ZBS A;  3KBA A;  3KDT A;  1XNN A;  3HO0 A;  5DLR A;  3RVF A;  1X78 A;  5AVL A;  1M2Z A;  5DVS A;  2ZXZ A;  3G8O A;  3UUA A;  3W0G A;  5IXK A;  4XT9 A;  5KRJ A;  1NHZ A;  1XQ3 A;  1MV9 A;  1E3K A;  3G0W A;  4N8R A;  1YYE A;  1OT7 A;  4ZNS A;  5AYG A;  3WT7 A;  3OSI A;  3D90 A;  5FQR A;  4Q0A C;  3VJT A;  3X1I A;  4PLE A;  1KV6 A;  2Q60 A;  1N4H A;  2YJA B;  3OOF A;  3PLZ A;  4MGB A;  3W0A A;  2AAX A;  1T63 A;  3G9E A;  4OJ9 A;  4CI4 A;  1I38 A;  5LGA A;  2J14 A;  5L11 A;  3WJ4 A;  4K7A A;  1IE9 A;  1ZDU A;  4N5G A;  3ERT A;  4UDC A;  2P7Z A;  3VI8 A;  2HCD A;  2YLP A;  1FD0 A;  3A9E A;  4G1D A;  2ZK6 A;  3R8D A;  2AA6 A;  2XYX A;  3UP0 A;  4MG7 B;  3VHW A;  1T74 A;  4Y29 A;  2BJ4 A;  2FSZ A;  3FEI A;  3OSA A;  4IU7 A;  1U3Q A;  2PIX A;  4OKB A;  3K6P A;  4QE8 A;  1FBY A;  1LV2 A;  2H79 A;  2PIT A;  3A2J A;  3AN4 A;  5AWJ A;  2VV3 A;  3OLS A;  4LTW A;  2ZK1 A;  3CTB A;  3MNO A;  3IMY A;  5DKB A;  2HB7 A;  2HAR A;  4G1Y A;  3WMH A;  5DY8 A;  2Q5P A;  4FHI A;  3IPQ A;  2B50 A;  4OJ4 A;  3WFF A;  5SYZ A;  1ZGY A;  2QAB A;  1HJ1 A;  4K6I A;  4OZT U;  5DV8 A;  4WLB A;  4ZNV A;  4PP3 A;  1H9U A;  4TV1 B;  5APK A;  3PBA A;  3AX8 A;  3DCU A;  4YNK A;  3VT6 A;  3OMO A;  3AZ3 A;  3GYU A;  4HLW A;  3KPZ A;  3L3X A;  4J26 A;  3OS8 C;  5DRM A;  2AA5 A;  2P1U A;  5DXQ A;  4X1G A;  2OUZ A;  3B67 A;  1XDK B;  2OM9 A;  1PCG A;  3WT6 A;  4IQR A;  3EYB A;  3CJW A;  4A4V A;  4OZR U;  1T73 A;  1FCZ A;  4QL8 A;  5KRI A;  3P88 A;  4MGA B;  2YLQ A;  3GWS X;  2ZNN A;  4OZT E;  3AUN A;  4DMA A;  5GIE A;  2GP7 A;  5DV6 A;  3W0I A;  2Z4B A;  4DK7 A;  2PIQ A;  3ADS A;  5DKS A;  3CS8 A;  2ZL9 A;  3V3Q A;  3A78 A;  4P6W A;  1Y0S A;  1QKM A;  3AZ2 A;  1NQ7 A;  1M13 A;  4PXM A;  3W5R A;  5GID A;  3KFC A;  1K74 A;  3H52 A;  2YJD A;  1T5Z A;  4M8H A;  1RKG A;  2HWQ A;  5DYD A;  5AWK A;  1GWQ A;  2VV0 A;  5DIE A;  3OSW A;  4PRG A;  4FNE A;  1G50 A;  5DX3 B;  2IOK A;  3Q95 B;  2Q59 A;  2ZKC A;  4QE6 A;  1FCX A;  3V9V A;  1S0Z A;  4WVD A;  2IOG A;  2ZXM A;  3B68 A;  4MG8 A;  5DZ1 A;  3NSP A;  4A2J A;  2ACL A;  2PNU A;  5JJM A;  1R20 A;  3OMP A;  2ZLC A;  1HG4 A;  1T7R A;  3B5R A;  4IW6 A;  4LNX A;  5G42 A;  4N73 A;  1KKQ A;  5KCD A;  3RLL A;  1XV9 B;  4TUZ B;  2OVH A;  3NSQ A;  5DXK A;  1Y0X X;  3OMK A;  5EJV A;  3X31 A;  3ADU A;  3CQV A;  3L0J A;  1SR7 A;  2ATH A;  2VV4 A;  4UDA A;  2I4Z A;  1XVP A;  1P8D A;  5DMF A;  1R1K A;  5KYJ A;  2I4P A;  3WTQ A;  2AX6 A;  3P8X A;  3JZB A;  5EGV A;  3VT5 A;  2ZNQ A;  4WPF A;  2PIW A;  3KMG A;  4QK4 A;  1K74 D;  2FAI A;  2V0V A;  3AUR A;  3NOA A;  4R06 A;  2REW A;  4WQP A;  3UVV A;  3UUD A;  5KR9 A;  3WWR A;  2XYJ A;  3O1D A;  1FM6 A;  2AX7 A;  4K4J A;  2GTK A;  4WHF A;  3SP6 A;  4PP5 A;  3ET2 A;  2ZK3 A;  3GZ9 A;  3L0E A;  4RZF A;  3PEQ A;  3BEJ A;  4RUJ A;  2Q1H A;  3V3E A;  1DKF A;  3UUC A;  3W0J A;  2Q6J A;  3A3Z X;  4FGY A;  3T03 A;  5AZT A;  3DZY D;  4PPP A;  2Q3Y A;  4A4W A;  1BSX A;  5DKG A;  3B65 A;  4R2U A;  3CDS A;  1M7W A;  5DWG A;  2B1Z A;  4MG5 A;  4EM9 A;  2QGT A;  5HYR A;  4OED A;  1RDT D;  3VJS A;  4IA2 A;  5JY3 A;  1XP1 A;  2AA7 A;  2AB2 A;  4OH6 A;  3RUT A;  3TKM A;  5C4T A;  5KRK A;  5GT4 A;  2I0G A;  3PCU A;  5AVI A;  5G3J A;  3UUA B;  2QMV A;  3VHV A;  2QXS A;  3V49 A;  2HC4 A;  1T7F A;  1S9P A;  3A40 X;  5APJ A;  5DU5 A;  2QSE A;  4MDD A;  3V9Y A;  3L03 A;  3HM1 A;  1G1U A;  1FM6 D;  2XHS A;  2Q5G A;  4KZJ A;  4LBD A;  2I0J A;  4OIV A;  5DUG A;  5KRA A;  4MGB B;  2AX8 A;  1QKN A;  3KMR A;  3CS4 A;  3GD2 A;  2PIP L;  3OAP A;  3OMQ A;  4IA3 A;  5E19 A;  2PIV A;  4OKX A;  3UU7 A;  4HEE X;  1SKX A;  2ZXN A;  5KCU A;  5HCV A;  5KRC A;  1A28 A;  3A9E B;  4XLD A;  5DXB A;  3KWY A;  3B0T A;  4ZNW A;  3VHU A;  1FM9 A;  3TX7 B;  2BJ4 B;  2P15 A;  3A2H A;  3R5M A;  3GYT A;  5EI1 A;  4DM8 A;  4RMC A;  1PQ6 A;  3K8S A;  1Z95 A;  4G1Z A;  1PK5 A;  3IPU A;  3OS8 A;  1YIM A;  4DQM A;  4E2J A;  1YOK A;  1QKU A;  3PRG A;  2AO6 A;  3S9S A;  5L7H A;  2ZK0 A;  3OZ0 A;  4PF3 A;  4PPS A;  2O4J A;  5FQV A;  3R5N A;  2AMA A;  3IA6 A;  4MG6 A;  5HJP A;  5DP0 A;  4RFW A;  4OEY A;  5KRM A;  1ILH A;  1KNU A;  4J24 A;  1UOM A;  2QPY A;  2VV2 A;  1WM0 X;  1SQN A;  4OHA A;  1X7B A;  3OKH A;  4UDD A;  2HBH A;  3VT3 A;  3HZF A;  3HOD A;  2P1V A;  3L1B A;  2Q7I A;  3F5C A;  3L3Z A;  2F4B A;  2J7Y A;  4JYH A;  4J5X C;  3CWD A;  1VJB A;  2POB A;  2OZ7 A;  3E7C A;  1FM9 D;  3N00 A;  1NQ0 A;  5EHJ A;  2W8Y A;  4OIU A;  1PDU A;  3ADX A;  2Q7J A;  2FVJ A;  4OC7 A;  4ITF A;  2P7G A;  4RAK A;  5E15 A;  5KRF A;  1S9Q A;  1T7T A;  4ITE A;  2YLO A;  5ACC A;  1ZUC A;  2QR9 A;  2LBD A;  1NQ1 A;  4DOS A;  4WHG A;  5M96 A;  3AUQ A;  5HJS A;  3DY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...