5KRHA

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with 16-benzylidene estrone
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
244
structure length
231
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Systems Structural Biology Analysis of Ligand Effects on ER alpha Predicts Cellular Response to Environmental Estrogens and Anti-hormone Therapies.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Transcription
source organism Homo sapiens
total genus 86
structure length 231
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5krhA00
1T5ZA 3VHUA 4POJA 2OAXA 3HQ5A 4X1FA 2Q70A 3MNOA 1FM6A 4XTAA 5DV8A 3ADVA 1FD0A 1WM0X 5LGAA 4ZJRA 1XPCA 2QSEA 2QMVA 3PO9A 3GN8A 2I0GA 1FCYA 2R40A 2G44A 3G9EA 3SP9A 1S0ZA 3VJTA 5DVVA 5G3JA 1XB7A 1E3GA 2ZBSA 4OEZA 5ACCA 3AUNA 4RMDA 5AAUA 5ICKA 2PIPL 1Y9RA 3DY6A 5DIGA 3IA6A 5FQSA 1EREA 3FEIA 2AX7A 2PIXA 4ZJWA 1Z5XU 4KZJA 5EJVA 1X7BA 3BC5A 3L03A 1YINA 2JF9A 4ITFA 4OJBA 4OZRU 5DWIA 4DQMA 5DY8A 5GIDA 5DXBA 3L3ZA 4YMQA 1X7JA 3AURA 1I7IA 2PIOA 1Q4XA 5C4UA 2HASA 2P15A 1GS4A 2Q7IA 2P7AA 3OSIA 1NRLA 4LTWA 4JGVA 5DZ0A 3WFGA 1XJ7A 5ETHA 5KRJA 2AMAA 4L98A 2AO6A 4IWCA 5AWJA 1XAPA 5DZ1A 2ZXZA 2PINA 5E0WA 2QZOB 2ZK1A 1XVPB 2ZLAA 2NV7A 2ZNOA 4K6IA 5FQPA 5DXMA 4LBDA 2QXMA 3D90A 5EI1A 4J5WC 3VT8A 3G0WA 3O1DA 2J14A 3P89A 1S9QA 3OZ0A 4XT9A 3L0JA 2REWA 2IHQA 2XYWA 3N00A 4RZGA 3VSPA 3F7DA 3KBAA 1K74D 4WLBA 3ZR7A 4DORA 1YJEA 1MZNA 3AUQA 1FCZA 3A9EB 3CS4A 3R5MA 4S15A 2ZXMA 2ZKCA 3F5CA 1NHZA 2HARA 1LBDA 2P54A 2Q8SA 2AA2A 5DL4A 4Y29A 2GL8A 2YLQA 4IA2A 3CLDA 1X7EA 4P6XA 3OKHA 2QA6A 5E15A 5LWPA 3UUAB 1T7TA 5DZ3A 5DX3B 4QK4A 2P7GA 5B5BA 4IV4A 3HLVA 4WQPA 5DIDA 3OSAA 2ACLB 3CTBA 3OS9A 4IV2A 5DLRA 5HJSA 5L7HA 4ZOMA 4IU7A 4PP6A 3OKIA 4KZMA 2ZK3A 4FN9A 2XYXA 3E00D 1YA3A 2I4ZA 4RMCA 3L0LA 1FCXA 2PITA 4REFA 1NQ2A 1R20A 2G0HA 1SJ0A 5DWEA 5L7GA 2QZOA 3U9QA 3E00A 1XVPA 1T7FA 5APKA 5DWLA 5DMFA 1G1UA 1T73A 4IA7A 1GWRA 2NXXE 3TKMA 1H9UA 2VV0A 4OIUA 3VT6A 3ADWA 4K7AA 1XNXA 4RZFA 1PZLA 4REEA 4PRGA 1YOWA 3B0TA 3D6DA 4OEYA 5DXQA 5DXEA 5KCDA 3L0EA 2HAMA 4S14A 4PPPA 2ZXNA 2YLPA 5FQVA 5DZIA 5JJMB 2J7YA 5CJ6A 5G43A 3A9EA 3OLLA 5DP0A 4HLWA 1M7WA 2QE4A 2VV2A 3CS8A 4N8RA 4XHDA 1M13A 5DXGA 2Q5PA 5K13A 5L11A 1QKMA 3VTCA 1N4HA 2HC4A 2PIVA 3GBKA 4ZO1B 1YYEA 3V9TA 3ADXA 4CI5A 5KCCA 4MG6A 1OVLB 5DYBA 3ZQTA 4FGYA 1U3QA 3UUAA 2B23A 5DX3A 3W5TA 3O1EA 1ILHA 5G44A 2ZK5A 3W0GA 2JFAA 3DT3A 3A2IA 3AZ3A 4YNKA 3P0UA 2ACLA 3V49A 3AFRA 3PEQA 3OAPA 2PKLA 4WHGA 4N5GA 2AA6A 4MGAB 2VSRA 1TFCA 5EITA 4J5XA 1ZKYA 2AX9A 4L96A 3VJSA 4X1GA 3D24A 3IXPD 3CDSA 5APHA 3GD2A 3AN3A 1XQ3A 3R29A 3B66A 4TV1B 3FLIA 3H0AD 3JZCA 2Q1HA 3KDUA 3KMRA 1UHLB 3Q95B 3UUCA 5KCUA 2HVCA 3BQDA 4R06A 3DZUD 3W0AA 3ZRAA 2E2RA 2GIUA 4OZTE 2OVHA 4ZNVA 4DMAA 3IPUA 3SZ1A 5DUEA 4KZIA 2I0JA 1A52A 5C4SA 5HJPB 3VRWA 2Q3YA 4BCRA 3F5CB 3HODA 3MNEA 5JJMA 1EXXA 1UPVA 1K74A 1NAXA 1BSXA 1R6GA 3CWDA 3WT7A 3GYUA 2J7XA 4JYHA 3B65A 3TY0A 3VHWA 4IA1A 1NYXA 2R6WA 4IA3A 3VT4A 1KV6A 2AB2A 4IVYA 5AK2A 1ZH7A 4JAZA 3W0JA 1OVLA 4NB6A 3L1BA 3S9SA 3G8IA 4PLDA 3OGTA 2J4AA 5G5WA 5KCFA 3OLFA 1EXAA 1FM9D 1NQ0A 3V9YA 5DU5A 4QE6A 2ZK0A 5DWGA 3HVLA 4MGAA 4G1YA 4RUPA 2POGA 2ZASA 3PLZA 3W5PA 3NOAA 4ZI1A 1MV9A 1L2IA 4EMAA 4TV1A 4G2IA 4JYIA 2IOKA 4IW8A 2Q1VA 3L3XA 3UU7B 3W5QA 3UP0A 1UHLA 3Q95A 1ERRA 1XP1A 4FNEA 5JI0D 2OUZA 5KRHA 4LNWA 1N46A 3EYBA 3ET2A 4MG5A 5KRKA 4APUA 5DK9A 3DCUA 3G8OA 3R5NA 1G5YA 4TUZB 5HZCA 2VV3A 3DCTA 3WWRA 5HJPA 3TKCA 2YFEA 1S19A 3D5FA 3IPSA 1XNNA 1DB1A 3CJWA 3P8XA 1IE9A 2AWHA 4LNXA 4QL8A 3WJ5A 5KCEA 5FQRA 2XHSA 1XP6A 4J5XC 4M8HA 4RZEA 4ZNSA 3FEJA 3GZ9A 2P1UA 4OEDA 2PIRA 3AX8A 3HM1A 3HZFA 4ZNUA 5DTVA 3VN2A 1YY4A 3B68A 5DKGA 2B1ZA 1XIUA 3A2JA 3P88A 3ET3A 4MGDB 3ZRBA 3FUGA 4PP5A 4S0SA 3R2AA 3IMYA 2JFAB 3UUDB 5KROA 2V0VA 1U3RA 4OKBA 4OKWA 2PIWA 4PXMA 1G2NA 3QT0A 1T7RA 2AMBA 4Q0AC 4UDBA 5KRFA 2P7ZA 2QXSA 1PCGA 2QA8B 2O4JA 2B1VA 5DYDA 4Q13A 3SP6A 4XUHA 4OFUA 1R5KA 4K4JA 3HO0A 3RUUA 1PQCA 5H1EA 1A28A 4OH6A 2OCFA 1T7MA 5HYKA 4N73A 3IXPA 4OHAA 3CS6A 3UU7A 3PRGA 1DKFA 3VHVA 1Z95A 4DK8A 5IAWA 3OOFA 1GWXA 1NQ7A 2Q7LA 2FAIA 1Z5XE 1FBYA 2AXAA 3D57A 3WMHA 2Q5GA 4YPQA 1KKQA 2O4RA 2HCDA 2YHDA 4OH5A 4OZRE 1ZUCA 4QE8A 4PP3A 3ADSA 3IPQA 2Q5SA 4IWFA 3AZ1A 2Z4JA 3W5RA 3B67A 4TUZA 1RKHA 3PCUA 4XAOA 3JZBA 3OMMA 1XP9A 4RWVA 4J24A 1I7GA 1T63A 5APJA 3KDTA 4OILA 3ADUA 3AZ2A 2GPUA 2AAXA 1XOWA 2QGWA 3WT6A 3OOKA 2AX8A 2HWRA 3LMPA 2HB7A 1L2JA 5DVCA 4ZNHA 1R1KD 4IS8A 2ZK6A 3B1MA 2P1VA 5AVLA 2FVJA 1RDTD 4POHA 4ZNTA 3X36A 4CI4A 4MGDA 5G46A 4MG9B 3WT5A 3UUDA 4DK7A 3ERDA 1K4WA 3K8SA 1RJKA 3LBDA 5DXKA 5KYAA 3FALB 2BAWA 1XLSE 3B0RA 2QABA 3NSPA 4G20A 1KNUA 2QA8A 3DZYD 1P8DA 5AZVA 4A4VA 3VI8A 1Y0XX 5AAVA 1PQ9A 1YUCA 5IZ0A 2ZMJA 2V7CA 1HG4A 3KMGA 4Q50A 5E7VA 2OVMA 2Q7JA 1VJBA 4RUOX 4PVUA 4E4KA 2H79A 1NDEA 4QM0A 4E4QA 2VSTA 5M96A 3HC5A 2GWXA 2OZ7A 4NUFA 3V3QA 3W0CA 5EC9A 5DKEA 1T76A 5KRLA 3R8IA 4UDDA 4G1ZA 2QW4A 3CQVA 4N1YA 5AVIA 1LV2A 4PPSA 4S0TA 2NXXA 5DI7A 1I38A 1PK5A 2ZMHA 4OKTA 2A3IA 5DV6A 5HCVA 1UOMA 2GPPA 4OLMA 5GICA 5L7EA 4PF3A 2AA7A 4RUJA 2ZFXA 2YATA 2G5OA 2VV1B 4RE8A 1OT7A 1NQ1A 3OMOA 4MG9A 3WGPA 3VSOA 3PBAA 3V9VA 2BJ4B 3OSWA 1XZXX 1QKUA 1NUOA 3FALA 1SKXA 4P6WA 2Q61A 1OSVA 4OIVA 4CSJA 2XYJA 5E19A 3VRTA 2ZNQA 1M2ZA 2QR9A 3RY9A 4IW6A 5AZTA 4ZO1X 3X1HA 5SYZA 1PDUA 1DKFB 3X31A 3NSQA 3AN4A 3B0QA 3E7CA 1G50A 1QKNA 4NIEA 1T74A 3B3KA 4RMEA 4A4WA 2AX6A 3ET0A 4F9MA 3W0IA 4ITEA 3UVVB 2O9IA 2HFPA 5FQTA 4YT1A 3K22A 2Q6JA 4MDDA 4OARA 2PNUA 5DRMA 3WJ4A 5JY3A 1XLSA 2PRGA 4IQRA 4PWLA 4FHHA 4XUMA 3W0YA 1U9EA 5C4TA 1NAVA 1RKGA 2QTUA 3B5RA 1P93A 3OZJA 4NY9A 1FM6D 4O8FA 2OM9A 2AM9A 3VT7A 2GTKA 2YLYA 2P4YA 1ZAFA 1RK3A 1IE8A 5DIEA 3W0HA 1YP0A 3KYTA 1X7RA 2R40D 2JJ3A 3B0WA 4G2HA 3VTDA 3VRUA 4QJRA 4ZN9A 5EGVA 3MNPA 4MGCA 1UPWA 3V3EA 5DXPA 4E2JA 3VT9A 4OKXA 4RFWA 1R1KA 2VV1A 4MGBB 1ZGYA 3A2HA 3V4AA 3VJHA 3GWSX 5KRMA 1RDTA 1S0XA 1X76A 4G1DA 3FS1A 1N83A 1T79A 2B50A 2BJ4A 3E94A 3GWXA 2QPYA 3OMQA 3OS8A 2GPOA 1HJ1A 4A2JA 3KMZA 2Q59B 3ET1A 3KPZA 4OJ4A 4R2UA 3R8DA 3VJIA 1XV9B 1XQCA 4OZTU 3RLJA 5AAVB 2W8YA 1SQNA 2R6YA 4UDAA 4DOSA 5G42A 4OEAA 1ZDTA 3M7RA 3DZYA 3FURA 5KRAA 1S9PA 5DWJA 3FXVA 3H0AA 4M8EA 2POBA 1SR7A 2H77A 2HBHA 4WHFA 4ONIA 3UVVA 3DZUA 4MG8B 5EHJA 3FC6B 2P1TA 1XDKB 5DSHA 2F4BA 2YLOA 2YJDA 3OMKA 4ZN7A 5KCTA 4IVWA 3R8AA 2Q60A 2VV4B 2Q6RA 3WFFA 1U3SA 5DVSA 1OSHA 5AYGA 4MG7B 5I4VA 3VT3A 5C4OA 4EM9A 2AYRA 4OC7A 5E14A 5B41A 4WPFA 2HB8A 2I4JA 4HEEX 4IUIA 1QKTA 1TXIA 4WVDA 1X78A 3A3ZX 3K23A 1PRGA 4UDCA 3DR1A 4XI3A 5DV3A 5DMCA 5KRIA 3A40X 5GIEA 5IXKA 1YIMA 1T65A 1YMTA 4ZNWA 5KD9A 3H52A 5GT4A 2EWPA 4MGBA 2ZY0A 3KFCA 5E1CA 1ZDUA 2ZNNA 3RLLA 3WTQA 5HYRA 3RVFA 5DZHA 5KR9A 4LSJA 4J5WA 3GYTA 5G45A 3BEJA 4R6SA 2ZLCA 5DUHA 5KYJA 1FM9A 2Q59A 4FHIA 4RAKA 3A78A 3RUTA 1XV9A 1YOKA 2Q7KA 2ZNPA 5F9BA 2NPAA 5DKSA 4PLEA 2IOGA 3CDPA 5DXBB 3T03A 3VRVA 2ZK4A 3ERTA 4OK1A 2ATHA 2ZK2A 1MVCA 2Q6SA 3HC6A 2XKWA 1ILGA 5KCWA 3VT5A 2ZL9A 2PIQA 4G21A 2I4PA 2QH6A 1R20D 2QNVA 3K6PA 4OGHA 2NW4A 3VTBA 2Z4BA 3TX7B 5DRJA 2GPVA 3X1IA 2PJLA 5DUGA 3KWYA 1GWQA 4MG8A 4JL4A 2HWQA 5A86A 3UP3A 3FC6A 2G0GA 1I37A 5KRCA 3OMPA 1XDKA 2AA5A 5DKBA 5DXRA 5AWKA 4DM8A 4NQAB 1PQ6A 2ZMIA 2GP7A 2LBDA 4OJ9A 2ZVTA 3ADTA 5E0XA 2VV4A 4B7WA 4XLDA 3ILZA 2QGTA 1ZEOA 4J26A 1K7LA 1Y0SA 2FSZA 2PIUA 2YJAB 3OLSA 3OS8C 1E3KA 4JYGA 4MG7A 4OFRA 2ABIA 4DM6A
chains in the Genus database with same CATH superfamily
1T5ZA 3VHUA 4POJA 2OAXA 3HQ5A 4X1FA 2Q70A 3MNOA 1FM6A 4XTAA 5DV8A 3ADVA 1FD0A 1WM0X 5LGAA 4ZJRA 1XPCA 2QSEA 2QMVA 3PO9A 3GN8A 2I0GA 1FCYA 2R40A 2G44A 3G9EA 3SP9A 1S0ZA 3VJTA 5DVVA 5G3JA 1XB7A 1E3GA 2ZBSA 4OEZA 5ACCA 3AUNA 4RMDA 5AAUA 5ICKA 2PIPL 1Y9RA 3DY6A 5DIGA 3IA6A 5FQSA 1EREA 3FEIA 2AX7A 2PIXA 4ZJWA 1Z5XU 4KZJA 5EJVA 1X7BA 3BC5A 3L03A 1YINA 2JF9A 4ITFA 4OJBA 4OZRU 5DWIA 4DQMA 5DY8A 5GIDA 5DXBA 3L3ZA 4YMQA 1X7JA 3AURA 1I7IA 2PIOA 1Q4XA 5C4UA 2HASA 2P15A 1GS4A 2Q7IA 2P7AA 3OSIA 1NRLA 4LTWA 4JGVA 5DZ0A 3WFGA 1XJ7A 5ETHA 5KRJA 2AMAA 4L98A 2AO6A 4IWCA 5AWJA 1XAPA 5DZ1A 2ZXZA 2PINA 5E0WA 2QZOB 2ZK1A 1XVPB 2ZLAA 2NV7A 2ZNOA 4K6IA 5FQPA 5DXMA 4LBDA 2QXMA 3D90A 5EI1A 4J5WC 3VT8A 3G0WA 3O1DA 2J14A 3P89A 1S9QA 3OZ0A 4XT9A 3L0JA 2REWA 2IHQA 2XYWA 3N00A 4RZGA 3VSPA 3F7DA 3KBAA 1K74D 4WLBA 3ZR7A 4DORA 1YJEA 1MZNA 3AUQA 1FCZA 3A9EB 3CS4A 3R5MA 4S15A 2ZXMA 2ZKCA 3F5CA 1NHZA 2HARA 1LBDA 2P54A 2Q8SA 2AA2A 5DL4A 4Y29A 2GL8A 2YLQA 4IA2A 3CLDA 1X7EA 4P6XA 3OKHA 2QA6A 5E15A 5LWPA 3UUAB 1T7TA 5DZ3A 5DX3B 4QK4A 2P7GA 5B5BA 4IV4A 3HLVA 4WQPA 5DIDA 3OSAA 2ACLB 3CTBA 3OS9A 4IV2A 5DLRA 5HJSA 5L7HA 4ZOMA 4IU7A 4PP6A 3OKIA 4KZMA 2ZK3A 4FN9A 2XYXA 3E00D 1YA3A 2I4ZA 4RMCA 3L0LA 1FCXA 2PITA 4REFA 1NQ2A 1R20A 2G0HA 1SJ0A 5DWEA 5L7GA 2QZOA 3U9QA 3E00A 1XVPA 1T7FA 5APKA 5DWLA 5DMFA 1G1UA 1T73A 4IA7A 1GWRA 2NXXE 3TKMA 1H9UA 2VV0A 4OIUA 3VT6A 3ADWA 4K7AA 1XNXA 4RZFA 1PZLA 4REEA 4PRGA 1YOWA 3B0TA 3D6DA 4OEYA 5DXQA 5DXEA 5KCDA 3L0EA 2HAMA 4S14A 4PPPA 2ZXNA 2YLPA 5FQVA 5DZIA 5JJMB 2J7YA 5CJ6A 5G43A 3A9EA 3OLLA 5DP0A 4HLWA 1M7WA 2QE4A 2VV2A 3CS8A 4N8RA 4XHDA 1M13A 5DXGA 2Q5PA 5K13A 5L11A 1QKMA 3VTCA 1N4HA 2HC4A 2PIVA 3GBKA 4ZO1B 1YYEA 3V9TA 3ADXA 4CI5A 5KCCA 4MG6A 1OVLB 5DYBA 3ZQTA 4FGYA 1U3QA 3UUAA 2B23A 5DX3A 3W5TA 3O1EA 1ILHA 5G44A 2ZK5A 3W0GA 2JFAA 3DT3A 3A2IA 3AZ3A 4YNKA 3P0UA 2ACLA 3V49A 3AFRA 3PEQA 3OAPA 2PKLA 4WHGA 4N5GA 2AA6A 4MGAB 2VSRA 1TFCA 5EITA 4J5XA 1ZKYA 2AX9A 4L96A 3VJSA 4X1GA 3D24A 3IXPD 3CDSA 5APHA 3GD2A 3AN3A 1XQ3A 3R29A 3B66A 4TV1B 3FLIA 3H0AD 3JZCA 2Q1HA 3KDUA 3KMRA 1UHLB 3Q95B 3UUCA 5KCUA 2HVCA 3BQDA 4R06A 3DZUD 3W0AA 3ZRAA 2E2RA 2GIUA 4OZTE 2OVHA 4ZNVA 4DMAA 3IPUA 3SZ1A 5DUEA 4KZIA 2I0JA 1A52A 5C4SA 5HJPB 3VRWA 2Q3YA 4BCRA 3F5CB 3HODA 3MNEA 5JJMA 1EXXA 1UPVA 1K74A 1NAXA 1BSXA 1R6GA 3CWDA 3WT7A 3GYUA 2J7XA 4JYHA 3B65A 3TY0A 3VHWA 4IA1A 1NYXA 2R6WA 4IA3A 3VT4A 1KV6A 2AB2A 4IVYA 5AK2A 1ZH7A 4JAZA 3W0JA 1OVLA 4NB6A 3L1BA 3S9SA 3G8IA 4PLDA 3OGTA 2J4AA 5G5WA 5KCFA 3OLFA 1EXAA 1FM9D 1NQ0A 3V9YA 5DU5A 4QE6A 2ZK0A 5DWGA 3HVLA 4MGAA 4G1YA 4RUPA 2POGA 2ZASA 3PLZA 3W5PA 3NOAA 4ZI1A 1MV9A 1L2IA 4EMAA 4TV1A 4G2IA 4JYIA 2IOKA 4IW8A 2Q1VA 3L3XA 3UU7B 3W5QA 3UP0A 1UHLA 3Q95A 1ERRA 1XP1A 4FNEA 5JI0D 2OUZA 5KRHA 4LNWA 1N46A 3EYBA 3ET2A 4MG5A 5KRKA 4APUA 5DK9A 3DCUA 3G8OA 3R5NA 1G5YA 4TUZB 5HZCA 2VV3A 3DCTA 3WWRA 5HJPA 3TKCA 2YFEA 1S19A 3D5FA 3IPSA 1XNNA 1DB1A 3CJWA 3P8XA 1IE9A 2AWHA 4LNXA 4QL8A 3WJ5A 5KCEA 5FQRA 2XHSA 1XP6A 4J5XC 4M8HA 4RZEA 4ZNSA 3FEJA 3GZ9A 2P1UA 4OEDA 2PIRA 3AX8A 3HM1A 3HZFA 4ZNUA 5DTVA 3VN2A 1YY4A 3B68A 5DKGA 2B1ZA 1XIUA 3A2JA 3P88A 3ET3A 4MGDB 3ZRBA 3FUGA 4PP5A 4S0SA 3R2AA 3IMYA 2JFAB 3UUDB 5KROA 2V0VA 1U3RA 4OKBA 4OKWA 2PIWA 4PXMA 1G2NA 3QT0A 1T7RA 2AMBA 4Q0AC 4UDBA 5KRFA 2P7ZA 2QXSA 1PCGA 2QA8B 2O4JA 2B1VA 5DYDA 4Q13A 3SP6A 4XUHA 4OFUA 1R5KA 4K4JA 3HO0A 3RUUA 1PQCA 5H1EA 1A28A 4OH6A 2OCFA 1T7MA 5HYKA 4N73A 3IXPA 4OHAA 3CS6A 3UU7A 3PRGA 1DKFA 3VHVA 1Z95A 4DK8A 5IAWA 3OOFA 1GWXA 1NQ7A 2Q7LA 2FAIA 1Z5XE 1FBYA 2AXAA 3D57A 3WMHA 2Q5GA 4YPQA 1KKQA 2O4RA 2HCDA 2YHDA 4OH5A 4OZRE 1ZUCA 4QE8A 4PP3A 3ADSA 3IPQA 2Q5SA 4IWFA 3AZ1A 2Z4JA 3W5RA 3B67A 4TUZA 1RKHA 3PCUA 4XAOA 3JZBA 3OMMA 1XP9A 4RWVA 4J24A 1I7GA 1T63A 5APJA 3KDTA 4OILA 3ADUA 3AZ2A 2GPUA 2AAXA 1XOWA 2QGWA 3WT6A 3OOKA 2AX8A 2HWRA 3LMPA 2HB7A 1L2JA 5DVCA 4ZNHA 1R1KD 4IS8A 2ZK6A 3B1MA 2P1VA 5AVLA 2FVJA 1RDTD 4POHA 4ZNTA 3X36A 4CI4A 4MGDA 5G46A 4MG9B 3WT5A 3UUDA 4DK7A 3ERDA 1K4WA 3K8SA 1RJKA 3LBDA 5DXKA 5KYAA 3FALB 2BAWA 1XLSE 3B0RA 2QABA 3NSPA 4G20A 1KNUA 2QA8A 3DZYD 1P8DA 5AZVA 4A4VA 3VI8A 1Y0XX 5AAVA 1PQ9A 1YUCA 5IZ0A 2ZMJA 2V7CA 1HG4A 3KMGA 4Q50A 5E7VA 2OVMA 2Q7JA 1VJBA 4RUOX 4PVUA 4E4KA 2H79A 1NDEA 4QM0A 4E4QA 2VSTA 5M96A 3HC5A 2GWXA 2OZ7A 4NUFA 3V3QA 3W0CA 5EC9A 5DKEA 1T76A 5KRLA 3R8IA 4UDDA 4G1ZA 2QW4A 3CQVA 4N1YA 5AVIA 1LV2A 4PPSA 4S0TA 2NXXA 5DI7A 1I38A 1PK5A 2ZMHA 4OKTA 2A3IA 5DV6A 5HCVA 1UOMA 2GPPA 4OLMA 5GICA 5L7EA 4PF3A 2AA7A 4RUJA 2ZFXA 2YATA 2G5OA 2VV1B 4RE8A 1OT7A 1NQ1A 3OMOA 4MG9A 3WGPA 3VSOA 3PBAA 3V9VA 2BJ4B 3OSWA 1XZXX 1QKUA 1NUOA 3FALA 1SKXA 4P6WA 2Q61A 1OSVA 4OIVA 4CSJA 2XYJA 5E19A 3VRTA 2ZNQA 1M2ZA 2QR9A 3RY9A 4IW6A 5AZTA 4ZO1X 3X1HA 5SYZA 1PDUA 1DKFB 3X31A 3NSQA 3AN4A 3B0QA 3E7CA 1G50A 1QKNA 4NIEA 1T74A 3B3KA 4RMEA 4A4WA 2AX6A 3ET0A 4F9MA 3W0IA 4ITEA 3UVVB 2O9IA 2HFPA 5FQTA 4YT1A 3K22A 2Q6JA 4MDDA 4OARA 2PNUA 5DRMA 3WJ4A 5JY3A 1XLSA 2PRGA 4IQRA 4PWLA 4FHHA 4XUMA 3W0YA 1U9EA 5C4TA 1NAVA 1RKGA 2QTUA 3B5RA 1P93A 3OZJA 4NY9A 1FM6D 4O8FA 2OM9A 2AM9A 3VT7A 2GTKA 2YLYA 2P4YA 1ZAFA 1RK3A 1IE8A 5DIEA 3W0HA 1YP0A 3KYTA 1X7RA 2R40D 2JJ3A 3B0WA 4G2HA 3VTDA 3VRUA 4QJRA 4ZN9A 5EGVA 3MNPA 4MGCA 1UPWA 3V3EA 5DXPA 4E2JA 3VT9A 4OKXA 4RFWA 1R1KA 2VV1A 4MGBB 1ZGYA 3A2HA 3V4AA 3VJHA 3GWSX 5KRMA 1RDTA 1S0XA 1X76A 4G1DA 3FS1A 1N83A 1T79A 2B50A 2BJ4A 3E94A 3GWXA 2QPYA 3OMQA 3OS8A 2GPOA 1HJ1A 4A2JA 3KMZA 2Q59B 3ET1A 3KPZA 4OJ4A 4R2UA 3R8DA 3VJIA 1XV9B 1XQCA 4OZTU 3RLJA 5AAVB 2W8YA 1SQNA 2R6YA 4UDAA 4DOSA 5G42A 4OEAA 1ZDTA 3M7RA 3DZYA 3FURA 5KRAA 1S9PA 5DWJA 3FXVA 3H0AA 4M8EA 2POBA 1SR7A 2H77A 2HBHA 4WHFA 4ONIA 3UVVA 3DZUA 4MG8B 5EHJA 3FC6B 2P1TA 1XDKB 5DSHA 2F4BA 2YLOA 2YJDA 3OMKA 4ZN7A 5KCTA 4IVWA 3R8AA 2Q60A 2VV4B 2Q6RA 3WFFA 1U3SA 5DVSA 1OSHA 5AYGA 4MG7B 5I4VA 3VT3A 5C4OA 4EM9A 2AYRA 4OC7A 5E14A 5B41A 4WPFA 2HB8A 2I4JA 4HEEX 4IUIA 1QKTA 1TXIA 4WVDA 1X78A 3A3ZX 3K23A 1PRGA 4UDCA 3DR1A 4XI3A 5DV3A 5DMCA 5KRIA 3A40X 5GIEA 5IXKA 1YIMA 1T65A 1YMTA 4ZNWA 5KD9A 3H52A 5GT4A 2EWPA 4MGBA 2ZY0A 3KFCA 5E1CA 1ZDUA 2ZNNA 3RLLA 3WTQA 5HYRA 3RVFA 5DZHA 5KR9A 4LSJA 4J5WA 3GYTA 5G45A 3BEJA 4R6SA 2ZLCA 5DUHA 5KYJA 1FM9A 2Q59A 4FHIA 4RAKA 3A78A 3RUTA 1XV9A 1YOKA 2Q7KA 2ZNPA 5F9BA 2NPAA 5DKSA 4PLEA 2IOGA 3CDPA 5DXBB 3T03A 3VRVA 2ZK4A 3ERTA 4OK1A 2ATHA 2ZK2A 1MVCA 2Q6SA 3HC6A 2XKWA 1ILGA 5KCWA 3VT5A 2ZL9A 2PIQA 4G21A 2I4PA 2QH6A 1R20D 2QNVA 3K6PA 4OGHA 2NW4A 3VTBA 2Z4BA 3TX7B 5DRJA 2GPVA 3X1IA 2PJLA 5DUGA 3KWYA 1GWQA 4MG8A 4JL4A 2HWQA 5A86A 3UP3A 3FC6A 2G0GA 1I37A 5KRCA 3OMPA 1XDKA 2AA5A 5DKBA 5DXRA 5AWKA 4DM8A 4NQAB 1PQ6A 2ZMIA 2GP7A 2LBDA 4OJ9A 2ZVTA 3ADTA 5E0XA 2VV4A 4B7WA 4XLDA 3ILZA 2QGTA 1ZEOA 4J26A 1K7LA 1Y0SA 2FSZA 2PIUA 2YJAB 3OLSA 3OS8C 1E3KA 4JYGA 4MG7A 4OFRA 2ABIA 4DM6A
chains in the Genus database with same CATH topology
1T5ZA 3VHUA 4POJA 2OAXA 3HQ5A 4X1FA 2Q70A 3MNOA 1FM6A 4XTAA 5DV8A 3ADVA 1FD0A 1WM0X 5LGAA 4ZJRA 1XPCA 2QSEA 2QMVA 3PO9A 3GN8A 2I0GA 1FCYA 2R40A 2G44A 3G9EA 3SP9A 1S0ZA 3VJTA 5DVVA 5G3JA 1XB7A 1E3GA 2ZBSA 4OEZA 5ACCA 3AUNA 4RMDA 5AAUA 5ICKA 2PIPL 1Y9RA 3DY6A 5DIGA 3IA6A 5FQSA 1EREA 3FEIA 2AX7A 2PIXA 4ZJWA 1Z5XU 4KZJA 5EJVA 1X7BA 3BC5A 3L03A 1YINA 2JF9A 4ITFA 4OJBA 4OZRU 5DWIA 4DQMA 5DY8A 5GIDA 5DXBA 3L3ZA 4YMQA 1X7JA 3AURA 1I7IA 2PIOA 1Q4XA 5C4UA 2HASA 2P15A 1GS4A 2Q7IA 2P7AA 3OSIA 1NRLA 4LTWA 4JGVA 5DZ0A 3WFGA 1XJ7A 5ETHA 5KRJA 2AMAA 4L98A 2AO6A 4IWCA 5AWJA 1XAPA 5DZ1A 2ZXZA 2PINA 5E0WA 2QZOB 2ZK1A 1XVPB 2ZLAA 2NV7A 2ZNOA 4K6IA 5FQPA 5DXMA 4LBDA 2QXMA 3D90A 5EI1A 4J5WC 3VT8A 3G0WA 3O1DA 2J14A 3P89A 1S9QA 3OZ0A 4XT9A 3L0JA 2REWA 2IHQA 2XYWA 3N00A 4RZGA 3VSPA 3F7DA 3KBAA 1K74D 4WLBA 3ZR7A 4DORA 1YJEA 1MZNA 3AUQA 1FCZA 3A9EB 3CS4A 3R5MA 4S15A 2ZXMA 2ZKCA 3F5CA 1NHZA 2HARA 1LBDA 2P54A 2Q8SA 2AA2A 5DL4A 4Y29A 2GL8A 2YLQA 4IA2A 3CLDA 1X7EA 4P6XA 3OKHA 2QA6A 5E15A 5LWPA 3UUAB 1T7TA 5DZ3A 5DX3B 4QK4A 2P7GA 5B5BA 4IV4A 3HLVA 4WQPA 5DIDA 3OSAA 2ACLB 3CTBA 3OS9A 4IV2A 5DLRA 5HJSA 5L7HA 4ZOMA 4IU7A 4PP6A 3OKIA 4KZMA 2ZK3A 4FN9A 2XYXA 3E00D 1YA3A 2I4ZA 4RMCA 3L0LA 1FCXA 2PITA 4REFA 1NQ2A 1R20A 2G0HA 1SJ0A 5DWEA 5L7GA 2QZOA 3U9QA 3E00A 1XVPA 1T7FA 5APKA 5DWLA 5DMFA 1G1UA 1T73A 4IA7A 1GWRA 2NXXE 3TKMA 1H9UA 2VV0A 4OIUA 3VT6A 3ADWA 4K7AA 1XNXA 4RZFA 1PZLA 4REEA 4PRGA 1YOWA 3B0TA 3D6DA 4OEYA 5DXQA 5DXEA 5KCDA 3L0EA 2HAMA 4S14A 4PPPA 2ZXNA 2YLPA 5FQVA 5DZIA 5JJMB 2J7YA 5CJ6A 5G43A 3A9EA 3OLLA 5DP0A 4HLWA 1M7WA 2QE4A 2VV2A 3CS8A 4N8RA 4XHDA 1M13A 5DXGA 2Q5PA 5K13A 5L11A 1QKMA 3VTCA 1N4HA 2HC4A 2PIVA 3GBKA 4ZO1B 1YYEA 3V9TA 3ADXA 4CI5A 5KCCA 4MG6A 1OVLB 5DYBA 3ZQTA 4FGYA 1U3QA 3UUAA 2B23A 5DX3A 3W5TA 3O1EA 1ILHA 5G44A 2ZK5A 3W0GA 2JFAA 3DT3A 3A2IA 3AZ3A 4YNKA 3P0UA 2ACLA 3V49A 3AFRA 3PEQA 3OAPA 2PKLA 4WHGA 4N5GA 2AA6A 4MGAB 2VSRA 1TFCA 5EITA 4J5XA 1ZKYA 2AX9A 4L96A 3VJSA 4X1GA 3D24A 3IXPD 3CDSA 5APHA 3GD2A 3AN3A 1XQ3A 3R29A 3B66A 4TV1B 3FLIA 3H0AD 3JZCA 2Q1HA 3KDUA 3KMRA 1UHLB 3Q95B 3UUCA 5KCUA 2HVCA 3BQDA 4R06A 3DZUD 3W0AA 3ZRAA 2E2RA 2GIUA 4OZTE 2OVHA 4ZNVA 4DMAA 3IPUA 3SZ1A 5DUEA 4KZIA 2I0JA 1A52A 5C4SA 5HJPB 3VRWA 2Q3YA 4BCRA 3F5CB 3HODA 3MNEA 5JJMA 1EXXA 1UPVA 1K74A 1NAXA 1BSXA 1R6GA 3CWDA 3WT7A 3GYUA 2J7XA 4JYHA 3B65A 3TY0A 3VHWA 4IA1A 1NYXA 2R6WA 4IA3A 3VT4A 1KV6A 2AB2A 4IVYA 5AK2A 1ZH7A 4JAZA 3W0JA 1OVLA 4NB6A 3L1BA 3S9SA 3G8IA 4PLDA 3OGTA 2J4AA 5G5WA 5KCFA 3OLFA 1EXAA 1FM9D 1NQ0A 3V9YA 5DU5A 4QE6A 2ZK0A 5DWGA 3HVLA 4MGAA 4G1YA 4RUPA 2POGA 2ZASA 3PLZA 3W5PA 3NOAA 4ZI1A 1MV9A 1L2IA 4EMAA 4TV1A 4G2IA 4JYIA 2IOKA 4IW8A 2Q1VA 3L3XA 3UU7B 3W5QA 3UP0A 1UHLA 3Q95A 1ERRA 1XP1A 4FNEA 5JI0D 2OUZA 5KRHA 4LNWA 1N46A 3EYBA 3ET2A 4MG5A 5KRKA 4APUA 5DK9A 3DCUA 3G8OA 3R5NA 1G5YA 4TUZB 5HZCA 2VV3A 3DCTA 3WWRA 5HJPA 3TKCA 2YFEA 1S19A 3D5FA 3IPSA 1XNNA 1DB1A 3CJWA 3P8XA 1IE9A 2AWHA 4LNXA 4QL8A 3WJ5A 5KCEA 5FQRA 2XHSA 1XP6A 4J5XC 4M8HA 4RZEA 4ZNSA 3FEJA 3GZ9A 2P1UA 4OEDA 2PIRA 3AX8A 3HM1A 3HZFA 4ZNUA 5DTVA 3VN2A 1YY4A 3B68A 5DKGA 2B1ZA 1XIUA 3A2JA 3P88A 3ET3A 4MGDB 3ZRBA 3FUGA 4PP5A 4S0SA 3R2AA 3IMYA 2JFAB 3UUDB 5KROA 2V0VA 1U3RA 4OKBA 4OKWA 2PIWA 4PXMA 1G2NA 3QT0A 1T7RA 2AMBA 4Q0AC 4UDBA 5KRFA 2P7ZA 2QXSA 1PCGA 2QA8B 2O4JA 2B1VA 5DYDA 4Q13A 3SP6A 4XUHA 4OFUA 1R5KA 4K4JA 3HO0A 3RUUA 1PQCA 5H1EA 1A28A 4OH6A 2OCFA 1T7MA 5HYKA 4N73A 3IXPA 4OHAA 3CS6A 3UU7A 3PRGA 1DKFA 3VHVA 1Z95A 4DK8A 5IAWA 3OOFA 1GWXA 1NQ7A 2Q7LA 2FAIA 1Z5XE 1FBYA 2AXAA 3D57A 3WMHA 2Q5GA 4YPQA 1KKQA 2O4RA 2HCDA 2YHDA 4OH5A 4OZRE 1ZUCA 4QE8A 4PP3A 3ADSA 3IPQA 2Q5SA 4IWFA 3AZ1A 2Z4JA 3W5RA 3B67A 4TUZA 1RKHA 3PCUA 4XAOA 3JZBA 3OMMA 1XP9A 4RWVA 4J24A 1I7GA 1T63A 5APJA 3KDTA 4OILA 3ADUA 3AZ2A 2GPUA 2AAXA 1XOWA 2QGWA 3WT6A 3OOKA 2AX8A 2HWRA 3LMPA 2HB7A 1L2JA 5DVCA 4ZNHA 1R1KD 4IS8A 2ZK6A 3B1MA 2P1VA 5AVLA 2FVJA 1RDTD 4POHA 4ZNTA 3X36A 4CI4A 4MGDA 5G46A 4MG9B 3WT5A 3UUDA 4DK7A 3ERDA 1K4WA 3K8SA 1RJKA 3LBDA 5DXKA 5KYAA 3FALB 2BAWA 1XLSE 3B0RA 2QABA 3NSPA 4G20A 1KNUA 2QA8A 3DZYD 1P8DA 5AZVA 4A4VA 3VI8A 1Y0XX 5AAVA 1PQ9A 1YUCA 5IZ0A 2ZMJA 2V7CA 1HG4A 3KMGA 4Q50A 5E7VA 2OVMA 2Q7JA 1VJBA 4RUOX 4PVUA 4E4KA 2H79A 1NDEA 4QM0A 4E4QA 2VSTA 5M96A 3HC5A 2GWXA 2OZ7A 4NUFA 3V3QA 3W0CA 5EC9A 5DKEA 1T76A 5KRLA 3R8IA 4UDDA 4G1ZA 2QW4A 3CQVA 4N1YA 5AVIA 1LV2A 4PPSA 4S0TA 2NXXA 5DI7A 1I38A 1PK5A 2ZMHA 4OKTA 2A3IA 5DV6A 5HCVA 1UOMA 2GPPA 4OLMA 5GICA 5L7EA 4PF3A 2AA7A 4RUJA 2ZFXA 2YATA 2G5OA 2VV1B 4RE8A 1OT7A 1NQ1A 3OMOA 4MG9A 3WGPA 3VSOA 3PBAA 3V9VA 2BJ4B 3OSWA 1XZXX 1QKUA 1NUOA 3FALA 1SKXA 4P6WA 2Q61A 1OSVA 4OIVA 4CSJA 2XYJA 5E19A 3VRTA 2ZNQA 1M2ZA 2QR9A 3RY9A 4IW6A 5AZTA 4ZO1X 3X1HA 5SYZA 1PDUA 1DKFB 3X31A 3NSQA 3AN4A 3B0QA 3E7CA 1G50A 1QKNA 4NIEA 1T74A 3B3KA 4RMEA 4A4WA 2AX6A 3ET0A 4F9MA 3W0IA 4ITEA 3UVVB 2O9IA 2HFPA 5FQTA 4YT1A 3K22A 2Q6JA 4MDDA 4OARA 2PNUA 5DRMA 3WJ4A 5JY3A 1XLSA 2PRGA 4IQRA 4PWLA 4FHHA 4XUMA 3W0YA 1U9EA 5C4TA 1NAVA 1RKGA 2QTUA 3B5RA 1P93A 3OZJA 4NY9A 1FM6D 4O8FA 2OM9A 2AM9A 3VT7A 2GTKA 2YLYA 2P4YA 1ZAFA 1RK3A 1IE8A 5DIEA 3W0HA 1YP0A 3KYTA 1X7RA 2R40D 2JJ3A 3B0WA 4G2HA 3VTDA 3VRUA 4QJRA 4ZN9A 5EGVA 3MNPA 4MGCA 1UPWA 3V3EA 5DXPA 4E2JA 3VT9A 4OKXA 4RFWA 1R1KA 2VV1A 4MGBB 1ZGYA 3A2HA 3V4AA 3VJHA 3GWSX 5KRMA 1RDTA 1S0XA 1X76A 4G1DA 3FS1A 1N83A 1T79A 2B50A 2BJ4A 3E94A 3GWXA 2QPYA 3OMQA 3OS8A 2GPOA 1HJ1A 4A2JA 3KMZA 2Q59B 3ET1A 3KPZA 4OJ4A 4R2UA 3R8DA 3VJIA 1XV9B 1XQCA 4OZTU 3RLJA 5AAVB 2W8YA 1SQNA 2R6YA 4UDAA 4DOSA 5G42A 4OEAA 1ZDTA 3M7RA 3DZYA 3FURA 5KRAA 1S9PA 5DWJA 3FXVA 3H0AA 4M8EA 2POBA 1SR7A 2H77A 2HBHA 4WHFA 4ONIA 3UVVA 3DZUA 4MG8B 5EHJA 3FC6B 2P1TA 1XDKB 5DSHA 2F4BA 2YLOA 2YJDA 3OMKA 4ZN7A 5KCTA 4IVWA 3R8AA 2Q60A 2VV4B 2Q6RA 3WFFA 1U3SA 5DVSA 1OSHA 5AYGA 4MG7B 5I4VA 3VT3A 5C4OA 4EM9A 2AYRA 4OC7A 5E14A 5B41A 4WPFA 2HB8A 2I4JA 4HEEX 4IUIA 1QKTA 1TXIA 4WVDA 1X78A 3A3ZX 3K23A 1PRGA 4UDCA 3DR1A 4XI3A 5DV3A 5DMCA 5KRIA 3A40X 5GIEA 5IXKA 1YIMA 1T65A 1YMTA 4ZNWA 5KD9A 3H52A 5GT4A 2EWPA 4MGBA 2ZY0A 3KFCA 5E1CA 1ZDUA 2ZNNA 3RLLA 3WTQA 5HYRA 3RVFA 5DZHA 5KR9A 4LSJA 4J5WA 3GYTA 5G45A 3BEJA 4R6SA 2ZLCA 5DUHA 5KYJA 1FM9A 2Q59A 4FHIA 4RAKA 3A78A 3RUTA 1XV9A 1YOKA 2Q7KA 2ZNPA 5F9BA 2NPAA 5DKSA 4PLEA 2IOGA 3CDPA 5DXBB 3T03A 3VRVA 2ZK4A 3ERTA 4OK1A 2ATHA 2ZK2A 1MVCA 2Q6SA 3HC6A 2XKWA 1ILGA 5KCWA 3VT5A 2ZL9A 2PIQA 4G21A 2I4PA 2QH6A 1R20D 2QNVA 3K6PA 4OGHA 2NW4A 3VTBA 2Z4BA 3TX7B 5DRJA 2GPVA 3X1IA 2PJLA 5DUGA 3KWYA 1GWQA 4MG8A 4JL4A 2HWQA 5A86A 3UP3A 3FC6A 2G0GA 1I37A 5KRCA 3OMPA 1XDKA 2AA5A 5DKBA 5DXRA 5AWKA 4DM8A 4NQAB 1PQ6A 2ZMIA 2GP7A 2LBDA 4OJ9A 2ZVTA 3ADTA 5E0XA 2VV4A 4B7WA 4XLDA 3ILZA 2QGTA 1ZEOA 4J26A 1K7LA 1Y0SA 2FSZA 2PIUA 2YJAB 3OLSA 3OS8C 1E3KA 4JYGA 4MG7A 4OFRA 2ABIA 4DM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T5Z A;  3VHU A;  4POJ A;  2OAX A;  3HQ5 A;  4X1F A;  2Q70 A;  3MNO A;  1FM6 A;  4XTA A;  5DV8 A;  3ADV A;  1FD0 A;  1WM0 X;  5LGA A;  4ZJR A;  1XPC A;  2QSE A;  2QMV A;  3PO9 A;  3GN8 A;  2I0G A;  1FCY A;  2R40 A;  2G44 A;  3G9E A;  3SP9 A;  1S0Z A;  3VJT A;  5DVV A;  5G3J A;  1XB7 A;  1E3G A;  2ZBS A;  4OEZ A;  5ACC A;  3AUN A;  4RMD A;  5AAU A;  5ICK A;  2PIP L;  1Y9R A;  3DY6 A;  5DIG A;  3IA6 A;  5FQS A;  1ERE A;  3FEI A;  2AX7 A;  2PIX A;  4ZJW A;  1Z5X U;  4KZJ A;  5EJV A;  1X7B A;  3BC5 A;  3L03 A;  1YIN A;  2JF9 A;  4ITF A;  4OJB A;  4OZR U;  5DWI A;  4DQM A;  5DY8 A;  5GID A;  5DXB A;  3L3Z A;  4YMQ A;  1X7J A;  3AUR A;  1I7I A;  2PIO A;  1Q4X A;  5C4U A;  2HAS A;  2P15 A;  1GS4 A;  2Q7I A;  2P7A A;  3OSI A;  1NRL A;  4LTW A;  4JGV A;  5DZ0 A;  3WFG A;  1XJ7 A;  5ETH A;  5KRJ A;  2AMA A;  4L98 A;  2AO6 A;  4IWC A;  5AWJ A;  1XAP A;  5DZ1 A;  2ZXZ A;  2PIN A;  5E0W A;  2QZO B;  2ZK1 A;  1XVP B;  2ZLA A;  2NV7 A;  2ZNO A;  4K6I A;  5FQP A;  5DXM A;  4LBD A;  2QXM A;  3D90 A;  5EI1 A;  4J5W C;  3VT8 A;  3G0W A;  3O1D A;  2J14 A;  3P89 A;  1S9Q A;  3OZ0 A;  4XT9 A;  3L0J A;  2REW A;  2IHQ A;  2XYW A;  3N00 A;  4RZG A;  3VSP A;  3F7D A;  3KBA A;  1K74 D;  4WLB A;  3ZR7 A;  4DOR A;  1YJE A;  1MZN A;  3AUQ A;  1FCZ A;  3A9E B;  3CS4 A;  3R5M A;  4S15 A;  2ZXM A;  2ZKC A;  3F5C A;  1NHZ A;  2HAR A;  1LBD A;  2P54 A;  2Q8S A;  2AA2 A;  5DL4 A;  4Y29 A;  2GL8 A;  2YLQ A;  4IA2 A;  3CLD A;  1X7E A;  4P6X A;  3OKH A;  2QA6 A;  5E15 A;  5LWP A;  3UUA B;  1T7T A;  5DZ3 A;  5DX3 B;  4QK4 A;  2P7G A;  5B5B A;  4IV4 A;  3HLV A;  4WQP A;  5DID A;  3OSA A;  2ACL B;  3CTB A;  3OS9 A;  4IV2 A;  5DLR A;  5HJS A;  5L7H A;  4ZOM A;  4IU7 A;  4PP6 A;  3OKI A;  4KZM A;  2ZK3 A;  4FN9 A;  2XYX A;  3E00 D;  1YA3 A;  2I4Z A;  4RMC A;  3L0L A;  1FCX A;  2PIT A;  4REF A;  1NQ2 A;  1R20 A;  2G0H A;  1SJ0 A;  5DWE A;  5L7G A;  2QZO A;  3U9Q A;  3E00 A;  1XVP A;  1T7F A;  5APK A;  5DWL A;  5DMF A;  1G1U A;  1T73 A;  4IA7 A;  1GWR A;  2NXX E;  3TKM A;  1H9U A;  2VV0 A;  4OIU A;  3VT6 A;  3ADW A;  4K7A A;  1XNX A;  4RZF A;  1PZL A;  4REE A;  4PRG A;  1YOW A;  3B0T A;  3D6D A;  4OEY A;  5DXQ A;  5DXE A;  5KCD A;  3L0E A;  2HAM A;  4S14 A;  4PPP A;  2ZXN A;  2YLP A;  5FQV A;  5DZI A;  5JJM B;  2J7Y A;  5CJ6 A;  5G43 A;  3A9E A;  3OLL A;  5DP0 A;  4HLW A;  1M7W A;  2QE4 A;  2VV2 A;  3CS8 A;  4N8R A;  4XHD A;  1M13 A;  5DXG A;  2Q5P A;  5K13 A;  5L11 A;  1QKM A;  3VTC A;  1N4H A;  2HC4 A;  2PIV A;  3GBK A;  4ZO1 B;  1YYE A;  3V9T A;  3ADX A;  4CI5 A;  5KCC A;  4MG6 A;  1OVL B;  5DYB A;  3ZQT A;  4FGY A;  1U3Q A;  3UUA A;  2B23 A;  5DX3 A;  3W5T A;  3O1E A;  1ILH A;  5G44 A;  2ZK5 A;  3W0G A;  2JFA A;  3DT3 A;  3A2I A;  3AZ3 A;  4YNK A;  3P0U A;  2ACL A;  3V49 A;  3AFR A;  3PEQ A;  3OAP A;  2PKL A;  4WHG A;  4N5G A;  2AA6 A;  4MGA B;  2VSR A;  1TFC A;  5EIT A;  4J5X A;  1ZKY A;  2AX9 A;  4L96 A;  3VJS A;  4X1G A;  3D24 A;  3IXP D;  3CDS A;  5APH A;  3GD2 A;  3AN3 A;  1XQ3 A;  3R29 A;  3B66 A;  4TV1 B;  3FLI A;  3H0A D;  3JZC A;  2Q1H A;  3KDU A;  3KMR A;  1UHL B;  3Q95 B;  3UUC A;  5KCU A;  2HVC A;  3BQD A;  4R06 A;  3DZU D;  3W0A A;  3ZRA A;  2E2R A;  2GIU A;  4OZT E;  2OVH A;  4ZNV A;  4DMA A;  3IPU A;  3SZ1 A;  5DUE A;  4KZI A;  2I0J A;  1A52 A;  5C4S A;  5HJP B;  3VRW A;  2Q3Y A;  4BCR A;  3F5C B;  3HOD A;  3MNE A;  5JJM A;  1EXX A;  1UPV A;  1K74 A;  1NAX A;  1BSX A;  1R6G A;  3CWD A;  3WT7 A;  3GYU A;  2J7X A;  4JYH A;  3B65 A;  3TY0 A;  3VHW A;  4IA1 A;  1NYX A;  2R6W A;  4IA3 A;  3VT4 A;  1KV6 A;  2AB2 A;  4IVY A;  5AK2 A;  1ZH7 A;  4JAZ A;  3W0J A;  1OVL A;  4NB6 A;  3L1B A;  3S9S A;  3G8I A;  4PLD A;  3OGT A;  2J4A A;  5G5W A;  5KCF A;  3OLF A;  1EXA A;  1FM9 D;  1NQ0 A;  3V9Y A;  5DU5 A;  4QE6 A;  2ZK0 A;  5DWG A;  3HVL A;  4MGA A;  4G1Y A;  4RUP A;  2POG A;  2ZAS A;  3PLZ A;  3W5P A;  3NOA A;  4ZI1 A;  1MV9 A;  1L2I A;  4EMA A;  4TV1 A;  4G2I A;  4JYI A;  2IOK A;  4IW8 A;  2Q1V A;  3L3X A;  3UU7 B;  3W5Q A;  3UP0 A;  1UHL A;  3Q95 A;  1ERR A;  1XP1 A;  4FNE A;  5JI0 D;  2OUZ A;  5KRH A;  4LNW A;  1N46 A;  3EYB A;  3ET2 A;  4MG5 A;  5KRK A;  4APU A;  5DK9 A;  3DCU A;  3G8O A;  3R5N A;  1G5Y A;  4TUZ B;  5HZC A;  2VV3 A;  3DCT A;  3WWR A;  5HJP A;  3TKC A;  2YFE A;  1S19 A;  3D5F A;  3IPS A;  1XNN A;  1DB1 A;  3CJW A;  3P8X A;  1IE9 A;  2AWH A;  4LNX A;  4QL8 A;  3WJ5 A;  5KCE A;  5FQR A;  2XHS A;  1XP6 A;  4J5X C;  4M8H A;  4RZE A;  4ZNS A;  3FEJ A;  3GZ9 A;  2P1U A;  4OED A;  2PIR A;  3AX8 A;  3HM1 A;  3HZF A;  4ZNU A;  5DTV A;  3VN2 A;  1YY4 A;  3B68 A;  5DKG A;  2B1Z A;  1XIU A;  3A2J A;  3P88 A;  3ET3 A;  4MGD B;  3ZRB A;  3FUG A;  4PP5 A;  4S0S A;  3R2A A;  3IMY A;  2JFA B;  3UUD B;  5KRO A;  2V0V A;  1U3R A;  4OKB A;  4OKW A;  2PIW A;  4PXM A;  1G2N A;  3QT0 A;  1T7R A;  2AMB A;  4Q0A C;  4UDB A;  5KRF A;  2P7Z A;  2QXS A;  1PCG A;  2QA8 B;  2O4J A;  2B1V A;  5DYD A;  4Q13 A;  3SP6 A;  4XUH A;  4OFU A;  1R5K A;  4K4J A;  3HO0 A;  3RUU A;  1PQC A;  5H1E A;  1A28 A;  4OH6 A;  2OCF A;  1T7M A;  5HYK A;  4N73 A;  3IXP A;  4OHA A;  3CS6 A;  3UU7 A;  3PRG A;  1DKF A;  3VHV A;  1Z95 A;  4DK8 A;  5IAW A;  3OOF A;  1GWX A;  1NQ7 A;  2Q7L A;  2FAI A;  1Z5X E;  1FBY A;  2AXA A;  3D57 A;  3WMH A;  2Q5G A;  4YPQ A;  1KKQ A;  2O4R A;  2HCD A;  2YHD A;  4OH5 A;  4OZR E;  1ZUC A;  4QE8 A;  4PP3 A;  3ADS A;  3IPQ A;  2Q5S A;  4IWF A;  3AZ1 A;  2Z4J A;  3W5R A;  3B67 A;  4TUZ A;  1RKH A;  3PCU A;  4XAO A;  3JZB A;  3OMM A;  1XP9 A;  4RWV A;  4J24 A;  1I7G A;  1T63 A;  5APJ A;  3KDT A;  4OIL A;  3ADU A;  3AZ2 A;  2GPU A;  2AAX A;  1XOW A;  2QGW A;  3WT6 A;  3OOK A;  2AX8 A;  2HWR A;  3LMP A;  2HB7 A;  1L2J A;  5DVC A;  4ZNH A;  1R1K D;  4IS8 A;  2ZK6 A;  3B1M A;  2P1V A;  5AVL A;  2FVJ A;  1RDT D;  4POH A;  4ZNT A;  3X36 A;  4CI4 A;  4MGD A;  5G46 A;  4MG9 B;  3WT5 A;  3UUD A;  4DK7 A;  3ERD A;  1K4W A;  3K8S A;  1RJK A;  3LBD A;  5DXK A;  5KYA A;  3FAL B;  2BAW A;  1XLS E;  3B0R A;  2QAB A;  3NSP A;  4G20 A;  1KNU A;  2QA8 A;  3DZY D;  1P8D A;  5AZV A;  4A4V A;  3VI8 A;  1Y0X X;  5AAV A;  1PQ9 A;  1YUC A;  5IZ0 A;  2ZMJ A;  2V7C A;  1HG4 A;  3KMG A;  4Q50 A;  5E7V A;  2OVM A;  2Q7J A;  1VJB A;  4RUO X;  4PVU A;  4E4K A;  2H79 A;  1NDE A;  4QM0 A;  4E4Q A;  2VST A;  5M96 A;  3HC5 A;  2GWX A;  2OZ7 A;  4NUF A;  3V3Q A;  3W0C A;  5EC9 A;  5DKE A;  1T76 A;  5KRL A;  3R8I A;  4UDD A;  4G1Z A;  2QW4 A;  3CQV A;  4N1Y A;  5AVI A;  1LV2 A;  4PPS A;  4S0T A;  2NXX A;  5DI7 A;  1I38 A;  1PK5 A;  2ZMH A;  4OKT A;  2A3I A;  5DV6 A;  5HCV A;  1UOM A;  2GPP A;  4OLM A;  5GIC A;  5L7E A;  4PF3 A;  2AA7 A;  4RUJ A;  2ZFX A;  2YAT A;  2G5O A;  2VV1 B;  4RE8 A;  1OT7 A;  1NQ1 A;  3OMO A;  4MG9 A;  3WGP A;  3VSO A;  3PBA A;  3V9V A;  2BJ4 B;  3OSW A;  1XZX X;  1QKU A;  1NUO A;  3FAL A;  1SKX A;  4P6W A;  2Q61 A;  1OSV A;  4OIV A;  4CSJ A;  2XYJ A;  5E19 A;  3VRT A;  2ZNQ A;  1M2Z A;  2QR9 A;  3RY9 A;  4IW6 A;  5AZT A;  4ZO1 X;  3X1H A;  5SYZ A;  1PDU A;  1DKF B;  3X31 A;  3NSQ A;  3AN4 A;  3B0Q A;  3E7C A;  1G50 A;  1QKN A;  4NIE A;  1T74 A;  3B3K A;  4RME A;  4A4W A;  2AX6 A;  3ET0 A;  4F9M A;  3W0I A;  4ITE A;  3UVV B;  2O9I A;  2HFP A;  5FQT A;  4YT1 A;  3K22 A;  2Q6J A;  4MDD A;  4OAR A;  2PNU A;  5DRM A;  3WJ4 A;  5JY3 A;  1XLS A;  2PRG A;  4IQR A;  4PWL A;  4FHH A;  4XUM A;  3W0Y A;  1U9E A;  5C4T A;  1NAV A;  1RKG A;  2QTU A;  3B5R A;  1P93 A;  3OZJ A;  4NY9 A;  1FM6 D;  4O8F A;  2OM9 A;  2AM9 A;  3VT7 A;  2GTK A;  2YLY A;  2P4Y A;  1ZAF A;  1RK3 A;  1IE8 A;  5DIE A;  3W0H A;  1YP0 A;  3KYT A;  1X7R A;  2R40 D;  2JJ3 A;  3B0W A;  4G2H A;  3VTD A;  3VRU A;  4QJR A;  4ZN9 A;  5EGV A;  3MNP A;  4MGC A;  1UPW A;  3V3E A;  5DXP A;  4E2J A;  3VT9 A;  4OKX A;  4RFW A;  1R1K A;  2VV1 A;  4MGB B;  1ZGY A;  3A2H A;  3V4A A;  3VJH A;  3GWS X;  5KRM A;  1RDT A;  1S0X A;  1X76 A;  4G1D A;  3FS1 A;  1N83 A;  1T79 A;  2B50 A;  2BJ4 A;  3E94 A;  3GWX A;  2QPY A;  3OMQ A;  3OS8 A;  2GPO A;  1HJ1 A;  4A2J A;  3KMZ A;  2Q59 B;  3ET1 A;  3KPZ A;  4OJ4 A;  4R2U A;  3R8D A;  3VJI A;  1XV9 B;  1XQC A;  4OZT U;  3RLJ A;  5AAV B;  2W8Y A;  1SQN A;  2R6Y A;  4UDA A;  4DOS A;  5G42 A;  4OEA A;  1ZDT A;  3M7R A;  3DZY A;  3FUR A;  5KRA A;  1S9P A;  5DWJ A;  3FXV A;  3H0A A;  4M8E A;  2POB A;  1SR7 A;  2H77 A;  2HBH A;  4WHF A;  4ONI A;  3UVV A;  3DZU A;  4MG8 B;  5EHJ A;  3FC6 B;  2P1T A;  1XDK B;  5DSH A;  2F4B A;  2YLO A;  2YJD A;  3OMK A;  4ZN7 A;  5KCT A;  4IVW A;  3R8A A;  2Q60 A;  2VV4 B;  2Q6R A;  3WFF A;  1U3S A;  5DVS A;  1OSH A;  5AYG A;  4MG7 B;  5I4V A;  3VT3 A;  5C4O A;  4EM9 A;  2AYR A;  4OC7 A;  5E14 A;  5B41 A;  4WPF A;  2HB8 A;  2I4J A;  4HEE X;  4IUI A;  1QKT A;  1TXI A;  4WVD A;  1X78 A;  3A3Z X;  3K23 A;  1PRG A;  4UDC A;  3DR1 A;  4XI3 A;  5DV3 A;  5DMC A;  5KRI A;  3A40 X;  5GIE A;  5IXK A;  1YIM A;  1T65 A;  1YMT A;  4ZNW A;  5KD9 A;  3H52 A;  5GT4 A;  2EWP A;  4MGB A;  2ZY0 A;  3KFC A;  5E1C A;  1ZDU A;  2ZNN A;  3RLL A;  3WTQ A;  5HYR A;  3RVF A;  5DZH A;  5KR9 A;  4LSJ A;  4J5W A;  3GYT A;  5G45 A;  3BEJ A;  4R6S A;  2ZLC A;  5DUH A;  5KYJ A;  1FM9 A;  2Q59 A;  4FHI A;  4RAK A;  3A78 A;  3RUT A;  1XV9 A;  1YOK A;  2Q7K A;  2ZNP A;  5F9B A;  2NPA A;  5DKS A;  4PLE A;  2IOG A;  3CDP A;  5DXB B;  3T03 A;  3VRV A;  2ZK4 A;  3ERT A;  4OK1 A;  2ATH A;  2ZK2 A;  1MVC A;  2Q6S A;  3HC6 A;  2XKW A;  1ILG A;  5KCW A;  3VT5 A;  2ZL9 A;  2PIQ A;  4G21 A;  2I4P A;  2QH6 A;  1R20 D;  2QNV A;  3K6P A;  4OGH A;  2NW4 A;  3VTB A;  2Z4B A;  3TX7 B;  5DRJ A;  2GPV A;  3X1I A;  2PJL A;  5DUG A;  3KWY A;  1GWQ A;  4MG8 A;  4JL4 A;  2HWQ A;  5A86 A;  3UP3 A;  3FC6 A;  2G0G A;  1I37 A;  5KRC A;  3OMP A;  1XDK A;  2AA5 A;  5DKB A;  5DXR A;  5AWK A;  4DM8 A;  4NQA B;  1PQ6 A;  2ZMI A;  2GP7 A;  2LBD A;  4OJ9 A;  2ZVT A;  3ADT A;  5E0X A;  2VV4 A;  4B7W A;  4XLD A;  3ILZ A;  2QGT A;  1ZEO A;  4J26 A;  1K7L A;  1Y0S A;  2FSZ A;  2PIU A;  2YJA B;  3OLS A;  3OS8 C;  1E3K A;  4JYG A;  4MG7 A;  4OFR A;  2ABI A;  4DM6 A; 
#chains in the Genus database with same CATH topology
 1T5Z A;  3VHU A;  4POJ A;  2OAX A;  3HQ5 A;  4X1F A;  2Q70 A;  3MNO A;  1FM6 A;  4XTA A;  5DV8 A;  3ADV A;  1FD0 A;  1WM0 X;  5LGA A;  4ZJR A;  1XPC A;  2QSE A;  2QMV A;  3PO9 A;  3GN8 A;  2I0G A;  1FCY A;  2R40 A;  2G44 A;  3G9E A;  3SP9 A;  1S0Z A;  3VJT A;  5DVV A;  5G3J A;  1XB7 A;  1E3G A;  2ZBS A;  4OEZ A;  5ACC A;  3AUN A;  4RMD A;  5AAU A;  5ICK A;  2PIP L;  1Y9R A;  3DY6 A;  5DIG A;  3IA6 A;  5FQS A;  1ERE A;  3FEI A;  2AX7 A;  2PIX A;  4ZJW A;  1Z5X U;  4KZJ A;  5EJV A;  1X7B A;  3BC5 A;  3L03 A;  1YIN A;  2JF9 A;  4ITF A;  4OJB A;  4OZR U;  5DWI A;  4DQM A;  5DY8 A;  5GID A;  5DXB A;  3L3Z A;  4YMQ A;  1X7J A;  3AUR A;  1I7I A;  2PIO A;  1Q4X A;  5C4U A;  2HAS A;  2P15 A;  1GS4 A;  2Q7I A;  2P7A A;  3OSI A;  1NRL A;  4LTW A;  4JGV A;  5DZ0 A;  3WFG A;  1XJ7 A;  5ETH A;  5KRJ A;  2AMA A;  4L98 A;  2AO6 A;  4IWC A;  5AWJ A;  1XAP A;  5DZ1 A;  2ZXZ A;  2PIN A;  5E0W A;  2QZO B;  2ZK1 A;  1XVP B;  2ZLA A;  2NV7 A;  2ZNO A;  4K6I A;  5FQP A;  5DXM A;  4LBD A;  2QXM A;  3D90 A;  5EI1 A;  4J5W C;  3VT8 A;  3G0W A;  3O1D A;  2J14 A;  3P89 A;  1S9Q A;  3OZ0 A;  4XT9 A;  3L0J A;  2REW A;  2IHQ A;  2XYW A;  3N00 A;  4RZG A;  3VSP A;  3F7D A;  3KBA A;  1K74 D;  4WLB A;  3ZR7 A;  4DOR A;  1YJE A;  1MZN A;  3AUQ A;  1FCZ A;  3A9E B;  3CS4 A;  3R5M A;  4S15 A;  2ZXM A;  2ZKC A;  3F5C A;  1NHZ A;  2HAR A;  1LBD A;  2P54 A;  2Q8S A;  2AA2 A;  5DL4 A;  4Y29 A;  2GL8 A;  2YLQ A;  4IA2 A;  3CLD A;  1X7E A;  4P6X A;  3OKH A;  2QA6 A;  5E15 A;  5LWP A;  3UUA B;  1T7T A;  5DZ3 A;  5DX3 B;  4QK4 A;  2P7G A;  5B5B A;  4IV4 A;  3HLV A;  4WQP A;  5DID A;  3OSA A;  2ACL B;  3CTB A;  3OS9 A;  4IV2 A;  5DLR A;  5HJS A;  5L7H A;  4ZOM A;  4IU7 A;  4PP6 A;  3OKI A;  4KZM A;  2ZK3 A;  4FN9 A;  2XYX A;  3E00 D;  1YA3 A;  2I4Z A;  4RMC A;  3L0L A;  1FCX A;  2PIT A;  4REF A;  1NQ2 A;  1R20 A;  2G0H A;  1SJ0 A;  5DWE A;  5L7G A;  2QZO A;  3U9Q A;  3E00 A;  1XVP A;  1T7F A;  5APK A;  5DWL A;  5DMF A;  1G1U A;  1T73 A;  4IA7 A;  1GWR A;  2NXX E;  3TKM A;  1H9U A;  2VV0 A;  4OIU A;  3VT6 A;  3ADW A;  4K7A A;  1XNX A;  4RZF A;  1PZL A;  4REE A;  4PRG A;  1YOW A;  3B0T A;  3D6D A;  4OEY A;  5DXQ A;  5DXE A;  5KCD A;  3L0E A;  2HAM A;  4S14 A;  4PPP A;  2ZXN A;  2YLP A;  5FQV A;  5DZI A;  5JJM B;  2J7Y A;  5CJ6 A;  5G43 A;  3A9E A;  3OLL A;  5DP0 A;  4HLW A;  1M7W A;  2QE4 A;  2VV2 A;  3CS8 A;  4N8R A;  4XHD A;  1M13 A;  5DXG A;  2Q5P A;  5K13 A;  5L11 A;  1QKM A;  3VTC A;  1N4H A;  2HC4 A;  2PIV A;  3GBK A;  4ZO1 B;  1YYE A;  3V9T A;  3ADX A;  4CI5 A;  5KCC A;  4MG6 A;  1OVL B;  5DYB A;  3ZQT A;  4FGY A;  1U3Q A;  3UUA A;  2B23 A;  5DX3 A;  3W5T A;  3O1E A;  1ILH A;  5G44 A;  2ZK5 A;  3W0G A;  2JFA A;  3DT3 A;  3A2I A;  3AZ3 A;  4YNK A;  3P0U A;  2ACL A;  3V49 A;  3AFR A;  3PEQ A;  3OAP A;  2PKL A;  4WHG A;  4N5G A;  2AA6 A;  4MGA B;  2VSR A;  1TFC A;  5EIT A;  4J5X A;  1ZKY A;  2AX9 A;  4L96 A;  3VJS A;  4X1G A;  3D24 A;  3IXP D;  3CDS A;  5APH A;  3GD2 A;  3AN3 A;  1XQ3 A;  3R29 A;  3B66 A;  4TV1 B;  3FLI A;  3H0A D;  3JZC A;  2Q1H A;  3KDU A;  3KMR A;  1UHL B;  3Q95 B;  3UUC A;  5KCU A;  2HVC A;  3BQD A;  4R06 A;  3DZU D;  3W0A A;  3ZRA A;  2E2R A;  2GIU A;  4OZT E;  2OVH A;  4ZNV A;  4DMA A;  3IPU A;  3SZ1 A;  5DUE A;  4KZI A;  2I0J A;  1A52 A;  5C4S A;  5HJP B;  3VRW A;  2Q3Y A;  4BCR A;  3F5C B;  3HOD A;  3MNE A;  5JJM A;  1EXX A;  1UPV A;  1K74 A;  1NAX A;  1BSX A;  1R6G A;  3CWD A;  3WT7 A;  3GYU A;  2J7X A;  4JYH A;  3B65 A;  3TY0 A;  3VHW A;  4IA1 A;  1NYX A;  2R6W A;  4IA3 A;  3VT4 A;  1KV6 A;  2AB2 A;  4IVY A;  5AK2 A;  1ZH7 A;  4JAZ A;  3W0J A;  1OVL A;  4NB6 A;  3L1B A;  3S9S A;  3G8I A;  4PLD A;  3OGT A;  2J4A A;  5G5W A;  5KCF A;  3OLF A;  1EXA A;  1FM9 D;  1NQ0 A;  3V9Y A;  5DU5 A;  4QE6 A;  2ZK0 A;  5DWG A;  3HVL A;  4MGA A;  4G1Y A;  4RUP A;  2POG A;  2ZAS A;  3PLZ A;  3W5P A;  3NOA A;  4ZI1 A;  1MV9 A;  1L2I A;  4EMA A;  4TV1 A;  4G2I A;  4JYI A;  2IOK A;  4IW8 A;  2Q1V A;  3L3X A;  3UU7 B;  3W5Q A;  3UP0 A;  1UHL A;  3Q95 A;  1ERR A;  1XP1 A;  4FNE A;  5JI0 D;  2OUZ A;  5KRH A;  4LNW A;  1N46 A;  3EYB A;  3ET2 A;  4MG5 A;  5KRK A;  4APU A;  5DK9 A;  3DCU A;  3G8O A;  3R5N A;  1G5Y A;  4TUZ B;  5HZC A;  2VV3 A;  3DCT A;  3WWR A;  5HJP A;  3TKC A;  2YFE A;  1S19 A;  3D5F A;  3IPS A;  1XNN A;  1DB1 A;  3CJW A;  3P8X A;  1IE9 A;  2AWH A;  4LNX A;  4QL8 A;  3WJ5 A;  5KCE A;  5FQR A;  2XHS A;  1XP6 A;  4J5X C;  4M8H A;  4RZE A;  4ZNS A;  3FEJ A;  3GZ9 A;  2P1U A;  4OED A;  2PIR A;  3AX8 A;  3HM1 A;  3HZF A;  4ZNU A;  5DTV A;  3VN2 A;  1YY4 A;  3B68 A;  5DKG A;  2B1Z A;  1XIU A;  3A2J A;  3P88 A;  3ET3 A;  4MGD B;  3ZRB A;  3FUG A;  4PP5 A;  4S0S A;  3R2A A;  3IMY A;  2JFA B;  3UUD B;  5KRO A;  2V0V A;  1U3R A;  4OKB A;  4OKW A;  2PIW A;  4PXM A;  1G2N A;  3QT0 A;  1T7R A;  2AMB A;  4Q0A C;  4UDB A;  5KRF A;  2P7Z A;  2QXS A;  1PCG A;  2QA8 B;  2O4J A;  2B1V A;  5DYD A;  4Q13 A;  3SP6 A;  4XUH A;  4OFU A;  1R5K A;  4K4J A;  3HO0 A;  3RUU A;  1PQC A;  5H1E A;  1A28 A;  4OH6 A;  2OCF A;  1T7M A;  5HYK A;  4N73 A;  3IXP A;  4OHA A;  3CS6 A;  3UU7 A;  3PRG A;  1DKF A;  3VHV A;  1Z95 A;  4DK8 A;  5IAW A;  3OOF A;  1GWX A;  1NQ7 A;  2Q7L A;  2FAI A;  1Z5X E;  1FBY A;  2AXA A;  3D57 A;  3WMH A;  2Q5G A;  4YPQ A;  1KKQ A;  2O4R A;  2HCD A;  2YHD A;  4OH5 A;  4OZR E;  1ZUC A;  4QE8 A;  4PP3 A;  3ADS A;  3IPQ A;  2Q5S A;  4IWF A;  3AZ1 A;  2Z4J A;  3W5R A;  3B67 A;  4TUZ A;  1RKH A;  3PCU A;  4XAO A;  3JZB A;  3OMM A;  1XP9 A;  4RWV A;  4J24 A;  1I7G A;  1T63 A;  5APJ A;  3KDT A;  4OIL A;  3ADU A;  3AZ2 A;  2GPU A;  2AAX A;  1XOW A;  2QGW A;  3WT6 A;  3OOK A;  2AX8 A;  2HWR A;  3LMP A;  2HB7 A;  1L2J A;  5DVC A;  4ZNH A;  1R1K D;  4IS8 A;  2ZK6 A;  3B1M A;  2P1V A;  5AVL A;  2FVJ A;  1RDT D;  4POH A;  4ZNT A;  3X36 A;  4CI4 A;  4MGD A;  5G46 A;  4MG9 B;  3WT5 A;  3UUD A;  4DK7 A;  3ERD A;  1K4W A;  3K8S A;  1RJK A;  3LBD A;  5DXK A;  5KYA A;  3FAL B;  2BAW A;  1XLS E;  3B0R A;  2QAB A;  3NSP A;  4G20 A;  1KNU A;  2QA8 A;  3DZY D;  1P8D A;  5AZV A;  4A4V A;  3VI8 A;  1Y0X X;  5AAV A;  1PQ9 A;  1YUC A;  5IZ0 A;  2ZMJ A;  2V7C A;  1HG4 A;  3KMG A;  4Q50 A;  5E7V A;  2OVM A;  2Q7J A;  1VJB A;  4RUO X;  4PVU A;  4E4K A;  2H79 A;  1NDE A;  4QM0 A;  4E4Q A;  2VST A;  5M96 A;  3HC5 A;  2GWX A;  2OZ7 A;  4NUF A;  3V3Q A;  3W0C A;  5EC9 A;  5DKE A;  1T76 A;  5KRL A;  3R8I A;  4UDD A;  4G1Z A;  2QW4 A;  3CQV A;  4N1Y A;  5AVI A;  1LV2 A;  4PPS A;  4S0T A;  2NXX A;  5DI7 A;  1I38 A;  1PK5 A;  2ZMH A;  4OKT A;  2A3I A;  5DV6 A;  5HCV A;  1UOM A;  2GPP A;  4OLM A;  5GIC A;  5L7E A;  4PF3 A;  2AA7 A;  4RUJ A;  2ZFX A;  2YAT A;  2G5O A;  2VV1 B;  4RE8 A;  1OT7 A;  1NQ1 A;  3OMO A;  4MG9 A;  3WGP A;  3VSO A;  3PBA A;  3V9V A;  2BJ4 B;  3OSW A;  1XZX X;  1QKU A;  1NUO A;  3FAL A;  1SKX A;  4P6W A;  2Q61 A;  1OSV A;  4OIV A;  4CSJ A;  2XYJ A;  5E19 A;  3VRT A;  2ZNQ A;  1M2Z A;  2QR9 A;  3RY9 A;  4IW6 A;  5AZT A;  4ZO1 X;  3X1H A;  5SYZ A;  1PDU A;  1DKF B;  3X31 A;  3NSQ A;  3AN4 A;  3B0Q A;  3E7C A;  1G50 A;  1QKN A;  4NIE A;  1T74 A;  3B3K A;  4RME A;  4A4W A;  2AX6 A;  3ET0 A;  4F9M A;  3W0I A;  4ITE A;  3UVV B;  2O9I A;  2HFP A;  5FQT A;  4YT1 A;  3K22 A;  2Q6J A;  4MDD A;  4OAR A;  2PNU A;  5DRM A;  3WJ4 A;  5JY3 A;  1XLS A;  2PRG A;  4IQR A;  4PWL A;  4FHH A;  4XUM A;  3W0Y A;  1U9E A;  5C4T A;  1NAV A;  1RKG A;  2QTU A;  3B5R A;  1P93 A;  3OZJ A;  4NY9 A;  1FM6 D;  4O8F A;  2OM9 A;  2AM9 A;  3VT7 A;  2GTK A;  2YLY A;  2P4Y A;  1ZAF A;  1RK3 A;  1IE8 A;  5DIE A;  3W0H A;  1YP0 A;  3KYT A;  1X7R A;  2R40 D;  2JJ3 A;  3B0W A;  4G2H A;  3VTD A;  3VRU A;  4QJR A;  4ZN9 A;  5EGV A;  3MNP A;  4MGC A;  1UPW A;  3V3E A;  5DXP A;  4E2J A;  3VT9 A;  4OKX A;  4RFW A;  1R1K A;  2VV1 A;  4MGB B;  1ZGY A;  3A2H A;  3V4A A;  3VJH A;  3GWS X;  5KRM A;  1RDT A;  1S0X A;  1X76 A;  4G1D A;  3FS1 A;  1N83 A;  1T79 A;  2B50 A;  2BJ4 A;  3E94 A;  3GWX A;  2QPY A;  3OMQ A;  3OS8 A;  2GPO A;  1HJ1 A;  4A2J A;  3KMZ A;  2Q59 B;  3ET1 A;  3KPZ A;  4OJ4 A;  4R2U A;  3R8D A;  3VJI A;  1XV9 B;  1XQC A;  4OZT U;  3RLJ A;  5AAV B;  2W8Y A;  1SQN A;  2R6Y A;  4UDA A;  4DOS A;  5G42 A;  4OEA A;  1ZDT A;  3M7R A;  3DZY A;  3FUR A;  5KRA A;  1S9P A;  5DWJ A;  3FXV A;  3H0A A;  4M8E A;  2POB A;  1SR7 A;  2H77 A;  2HBH A;  4WHF A;  4ONI A;  3UVV A;  3DZU A;  4MG8 B;  5EHJ A;  3FC6 B;  2P1T A;  1XDK B;  5DSH A;  2F4B A;  2YLO A;  2YJD A;  3OMK A;  4ZN7 A;  5KCT A;  4IVW A;  3R8A A;  2Q60 A;  2VV4 B;  2Q6R A;  3WFF A;  1U3S A;  5DVS A;  1OSH A;  5AYG A;  4MG7 B;  5I4V A;  3VT3 A;  5C4O A;  4EM9 A;  2AYR A;  4OC7 A;  5E14 A;  5B41 A;  4WPF A;  2HB8 A;  2I4J A;  4HEE X;  4IUI A;  1QKT A;  1TXI A;  4WVD A;  1X78 A;  3A3Z X;  3K23 A;  1PRG A;  4UDC A;  3DR1 A;  4XI3 A;  5DV3 A;  5DMC A;  5KRI A;  3A40 X;  5GIE A;  5IXK A;  1YIM A;  1T65 A;  1YMT A;  4ZNW A;  5KD9 A;  3H52 A;  5GT4 A;  2EWP A;  4MGB A;  2ZY0 A;  3KFC A;  5E1C A;  1ZDU A;  2ZNN A;  3RLL A;  3WTQ A;  5HYR A;  3RVF A;  5DZH A;  5KR9 A;  4LSJ A;  4J5W A;  3GYT A;  5G45 A;  3BEJ A;  4R6S A;  2ZLC A;  5DUH A;  5KYJ A;  1FM9 A;  2Q59 A;  4FHI A;  4RAK A;  3A78 A;  3RUT A;  1XV9 A;  1YOK A;  2Q7K A;  2ZNP A;  5F9B A;  2NPA A;  5DKS A;  4PLE A;  2IOG A;  3CDP A;  5DXB B;  3T03 A;  3VRV A;  2ZK4 A;  3ERT A;  4OK1 A;  2ATH A;  2ZK2 A;  1MVC A;  2Q6S A;  3HC6 A;  2XKW A;  1ILG A;  5KCW A;  3VT5 A;  2ZL9 A;  2PIQ A;  4G21 A;  2I4P A;  2QH6 A;  1R20 D;  2QNV A;  3K6P A;  4OGH A;  2NW4 A;  3VTB A;  2Z4B A;  3TX7 B;  5DRJ A;  2GPV A;  3X1I A;  2PJL A;  5DUG A;  3KWY A;  1GWQ A;  4MG8 A;  4JL4 A;  2HWQ A;  5A86 A;  3UP3 A;  3FC6 A;  2G0G A;  1I37 A;  5KRC A;  3OMP A;  1XDK A;  2AA5 A;  5DKB A;  5DXR A;  5AWK A;  4DM8 A;  4NQA B;  1PQ6 A;  2ZMI A;  2GP7 A;  2LBD A;  4OJ9 A;  2ZVT A;  3ADT A;  5E0X A;  2VV4 A;  4B7W A;  4XLD A;  3ILZ A;  2QGT A;  1ZEO A;  4J26 A;  1K7L A;  1Y0S A;  2FSZ A;  2PIU A;  2YJA B;  3OLS A;  3OS8 C;  1E3K A;  4JYG A;  4MG7 A;  4OFR A;  2ABI A;  4DM6 A; 
#chains in the Genus database with same CATH homology
 1T5Z A;  3VHU A;  4POJ A;  2OAX A;  3HQ5 A;  4X1F A;  2Q70 A;  3MNO A;  1FM6 A;  4XTA A;  5DV8 A;  3ADV A;  1FD0 A;  1WM0 X;  5LGA A;  4ZJR A;  1XPC A;  2QSE A;  2QMV A;  3PO9 A;  3GN8 A;  2I0G A;  1FCY A;  2R40 A;  2G44 A;  3G9E A;  3SP9 A;  1S0Z A;  3VJT A;  5DVV A;  5G3J A;  1XB7 A;  1E3G A;  2ZBS A;  4OEZ A;  5ACC A;  3AUN A;  4RMD A;  5AAU A;  5ICK A;  2PIP L;  1Y9R A;  3DY6 A;  5DIG A;  3IA6 A;  5FQS A;  1ERE A;  3FEI A;  2AX7 A;  2PIX A;  4ZJW A;  1Z5X U;  4KZJ A;  5EJV A;  1X7B A;  3BC5 A;  3L03 A;  1YIN A;  2JF9 A;  4ITF A;  4OJB A;  4OZR U;  5DWI A;  4DQM A;  5DY8 A;  5GID A;  5DXB A;  3L3Z A;  4YMQ A;  1X7J A;  3AUR A;  1I7I A;  2PIO A;  1Q4X A;  5C4U A;  2HAS A;  2P15 A;  1GS4 A;  2Q7I A;  2P7A A;  3OSI A;  1NRL A;  4LTW A;  4JGV A;  5DZ0 A;  3WFG A;  1XJ7 A;  5ETH A;  5KRJ A;  2AMA A;  4L98 A;  2AO6 A;  4IWC A;  5AWJ A;  1XAP A;  5DZ1 A;  2ZXZ A;  2PIN A;  5E0W A;  2QZO B;  2ZK1 A;  1XVP B;  2ZLA A;  2NV7 A;  2ZNO A;  4K6I A;  5FQP A;  5DXM A;  4LBD A;  2QXM A;  3D90 A;  5EI1 A;  4J5W C;  3VT8 A;  3G0W A;  3O1D A;  2J14 A;  3P89 A;  1S9Q A;  3OZ0 A;  4XT9 A;  3L0J A;  2REW A;  2IHQ A;  2XYW A;  3N00 A;  4RZG A;  3VSP A;  3F7D A;  3KBA A;  1K74 D;  4WLB A;  3ZR7 A;  4DOR A;  1YJE A;  1MZN A;  3AUQ A;  1FCZ A;  3A9E B;  3CS4 A;  3R5M A;  4S15 A;  2ZXM A;  2ZKC A;  3F5C A;  1NHZ A;  2HAR A;  1LBD A;  2P54 A;  2Q8S A;  2AA2 A;  5DL4 A;  4Y29 A;  2GL8 A;  2YLQ A;  4IA2 A;  3CLD A;  1X7E A;  4P6X A;  3OKH A;  2QA6 A;  5E15 A;  5LWP A;  3UUA B;  1T7T A;  5DZ3 A;  5DX3 B;  4QK4 A;  2P7G A;  5B5B A;  4IV4 A;  3HLV A;  4WQP A;  5DID A;  3OSA A;  2ACL B;  3CTB A;  3OS9 A;  4IV2 A;  5DLR A;  5HJS A;  5L7H A;  4ZOM A;  4IU7 A;  4PP6 A;  3OKI A;  4KZM A;  2ZK3 A;  4FN9 A;  2XYX A;  3E00 D;  1YA3 A;  2I4Z A;  4RMC A;  3L0L A;  1FCX A;  2PIT A;  4REF A;  1NQ2 A;  1R20 A;  2G0H A;  1SJ0 A;  5DWE A;  5L7G A;  2QZO A;  3U9Q A;  3E00 A;  1XVP A;  1T7F A;  5APK A;  5DWL A;  5DMF A;  1G1U A;  1T73 A;  4IA7 A;  1GWR A;  2NXX E;  3TKM A;  1H9U A;  2VV0 A;  4OIU A;  3VT6 A;  3ADW A;  4K7A A;  1XNX A;  4RZF A;  1PZL A;  4REE A;  4PRG A;  1YOW A;  3B0T A;  3D6D A;  4OEY A;  5DXQ A;  5DXE A;  5KCD A;  3L0E A;  2HAM A;  4S14 A;  4PPP A;  2ZXN A;  2YLP A;  5FQV A;  5DZI A;  5JJM B;  2J7Y A;  5CJ6 A;  5G43 A;  3A9E A;  3OLL A;  5DP0 A;  4HLW A;  1M7W A;  2QE4 A;  2VV2 A;  3CS8 A;  4N8R A;  4XHD A;  1M13 A;  5DXG A;  2Q5P A;  5K13 A;  5L11 A;  1QKM A;  3VTC A;  1N4H A;  2HC4 A;  2PIV A;  3GBK A;  4ZO1 B;  1YYE A;  3V9T A;  3ADX A;  4CI5 A;  5KCC A;  4MG6 A;  1OVL B;  5DYB A;  3ZQT A;  4FGY A;  1U3Q A;  3UUA A;  2B23 A;  5DX3 A;  3W5T A;  3O1E A;  1ILH A;  5G44 A;  2ZK5 A;  3W0G A;  2JFA A;  3DT3 A;  3A2I A;  3AZ3 A;  4YNK A;  3P0U A;  2ACL A;  3V49 A;  3AFR A;  3PEQ A;  3OAP A;  2PKL A;  4WHG A;  4N5G A;  2AA6 A;  4MGA B;  2VSR A;  1TFC A;  5EIT A;  4J5X A;  1ZKY A;  2AX9 A;  4L96 A;  3VJS A;  4X1G A;  3D24 A;  3IXP D;  3CDS A;  5APH A;  3GD2 A;  3AN3 A;  1XQ3 A;  3R29 A;  3B66 A;  4TV1 B;  3FLI A;  3H0A D;  3JZC A;  2Q1H A;  3KDU A;  3KMR A;  1UHL B;  3Q95 B;  3UUC A;  5KCU A;  2HVC A;  3BQD A;  4R06 A;  3DZU D;  3W0A A;  3ZRA A;  2E2R A;  2GIU A;  4OZT E;  2OVH A;  4ZNV A;  4DMA A;  3IPU A;  3SZ1 A;  5DUE A;  4KZI A;  2I0J A;  1A52 A;  5C4S A;  5HJP B;  3VRW A;  2Q3Y A;  4BCR A;  3F5C B;  3HOD A;  3MNE A;  5JJM A;  1EXX A;  1UPV A;  1K74 A;  1NAX A;  1BSX A;  1R6G A;  3CWD A;  3WT7 A;  3GYU A;  2J7X A;  4JYH A;  3B65 A;  3TY0 A;  3VHW A;  4IA1 A;  1NYX A;  2R6W A;  4IA3 A;  3VT4 A;  1KV6 A;  2AB2 A;  4IVY A;  5AK2 A;  1ZH7 A;  4JAZ A;  3W0J A;  1OVL A;  4NB6 A;  3L1B A;  3S9S A;  3G8I A;  4PLD A;  3OGT A;  2J4A A;  5G5W A;  5KCF A;  3OLF A;  1EXA A;  1FM9 D;  1NQ0 A;  3V9Y A;  5DU5 A;  4QE6 A;  2ZK0 A;  5DWG A;  3HVL A;  4MGA A;  4G1Y A;  4RUP A;  2POG A;  2ZAS A;  3PLZ A;  3W5P A;  3NOA A;  4ZI1 A;  1MV9 A;  1L2I A;  4EMA A;  4TV1 A;  4G2I A;  4JYI A;  2IOK A;  4IW8 A;  2Q1V A;  3L3X A;  3UU7 B;  3W5Q A;  3UP0 A;  1UHL A;  3Q95 A;  1ERR A;  1XP1 A;  4FNE A;  5JI0 D;  2OUZ A;  5KRH A;  4LNW A;  1N46 A;  3EYB A;  3ET2 A;  4MG5 A;  5KRK A;  4APU A;  5DK9 A;  3DCU A;  3G8O A;  3R5N A;  1G5Y A;  4TUZ B;  5HZC A;  2VV3 A;  3DCT A;  3WWR A;  5HJP A;  3TKC A;  2YFE A;  1S19 A;  3D5F A;  3IPS A;  1XNN A;  1DB1 A;  3CJW A;  3P8X A;  1IE9 A;  2AWH A;  4LNX A;  4QL8 A;  3WJ5 A;  5KCE A;  5FQR A;  2XHS A;  1XP6 A;  4J5X C;  4M8H A;  4RZE A;  4ZNS A;  3FEJ A;  3GZ9 A;  2P1U A;  4OED A;  2PIR A;  3AX8 A;  3HM1 A;  3HZF A;  4ZNU A;  5DTV A;  3VN2 A;  1YY4 A;  3B68 A;  5DKG A;  2B1Z A;  1XIU A;  3A2J A;  3P88 A;  3ET3 A;  4MGD B;  3ZRB A;  3FUG A;  4PP5 A;  4S0S A;  3R2A A;  3IMY A;  2JFA B;  3UUD B;  5KRO A;  2V0V A;  1U3R A;  4OKB A;  4OKW A;  2PIW A;  4PXM A;  1G2N A;  3QT0 A;  1T7R A;  2AMB A;  4Q0A C;  4UDB A;  5KRF A;  2P7Z A;  2QXS A;  1PCG A;  2QA8 B;  2O4J A;  2B1V A;  5DYD A;  4Q13 A;  3SP6 A;  4XUH A;  4OFU A;  1R5K A;  4K4J A;  3HO0 A;  3RUU A;  1PQC A;  5H1E A;  1A28 A;  4OH6 A;  2OCF A;  1T7M A;  5HYK A;  4N73 A;  3IXP A;  4OHA A;  3CS6 A;  3UU7 A;  3PRG A;  1DKF A;  3VHV A;  1Z95 A;  4DK8 A;  5IAW A;  3OOF A;  1GWX A;  1NQ7 A;  2Q7L A;  2FAI A;  1Z5X E;  1FBY A;  2AXA A;  3D57 A;  3WMH A;  2Q5G A;  4YPQ A;  1KKQ A;  2O4R A;  2HCD A;  2YHD A;  4OH5 A;  4OZR E;  1ZUC A;  4QE8 A;  4PP3 A;  3ADS A;  3IPQ A;  2Q5S A;  4IWF A;  3AZ1 A;  2Z4J A;  3W5R A;  3B67 A;  4TUZ A;  1RKH A;  3PCU A;  4XAO A;  3JZB A;  3OMM A;  1XP9 A;  4RWV A;  4J24 A;  1I7G A;  1T63 A;  5APJ A;  3KDT A;  4OIL A;  3ADU A;  3AZ2 A;  2GPU A;  2AAX A;  1XOW A;  2QGW A;  3WT6 A;  3OOK A;  2AX8 A;  2HWR A;  3LMP A;  2HB7 A;  1L2J A;  5DVC A;  4ZNH A;  1R1K D;  4IS8 A;  2ZK6 A;  3B1M A;  2P1V A;  5AVL A;  2FVJ A;  1RDT D;  4POH A;  4ZNT A;  3X36 A;  4CI4 A;  4MGD A;  5G46 A;  4MG9 B;  3WT5 A;  3UUD A;  4DK7 A;  3ERD A;  1K4W A;  3K8S A;  1RJK A;  3LBD A;  5DXK A;  5KYA A;  3FAL B;  2BAW A;  1XLS E;  3B0R A;  2QAB A;  3NSP A;  4G20 A;  1KNU A;  2QA8 A;  3DZY D;  1P8D A;  5AZV A;  4A4V A;  3VI8 A;  1Y0X X;  5AAV A;  1PQ9 A;  1YUC A;  5IZ0 A;  2ZMJ A;  2V7C A;  1HG4 A;  3KMG A;  4Q50 A;  5E7V A;  2OVM A;  2Q7J A;  1VJB A;  4RUO X;  4PVU A;  4E4K A;  2H79 A;  1NDE A;  4QM0 A;  4E4Q A;  2VST A;  5M96 A;  3HC5 A;  2GWX A;  2OZ7 A;  4NUF A;  3V3Q A;  3W0C A;  5EC9 A;  5DKE A;  1T76 A;  5KRL A;  3R8I A;  4UDD A;  4G1Z A;  2QW4 A;  3CQV A;  4N1Y A;  5AVI A;  1LV2 A;  4PPS A;  4S0T A;  2NXX A;  5DI7 A;  1I38 A;  1PK5 A;  2ZMH A;  4OKT A;  2A3I A;  5DV6 A;  5HCV A;  1UOM A;  2GPP A;  4OLM A;  5GIC A;  5L7E A;  4PF3 A;  2AA7 A;  4RUJ A;  2ZFX A;  2YAT A;  2G5O A;  2VV1 B;  4RE8 A;  1OT7 A;  1NQ1 A;  3OMO A;  4MG9 A;  3WGP A;  3VSO A;  3PBA A;  3V9V A;  2BJ4 B;  3OSW A;  1XZX X;  1QKU A;  1NUO A;  3FAL A;  1SKX A;  4P6W A;  2Q61 A;  1OSV A;  4OIV A;  4CSJ A;  2XYJ A;  5E19 A;  3VRT A;  2ZNQ A;  1M2Z A;  2QR9 A;  3RY9 A;  4IW6 A;  5AZT A;  4ZO1 X;  3X1H A;  5SYZ A;  1PDU A;  1DKF B;  3X31 A;  3NSQ A;  3AN4 A;  3B0Q A;  3E7C A;  1G50 A;  1QKN A;  4NIE A;  1T74 A;  3B3K A;  4RME A;  4A4W A;  2AX6 A;  3ET0 A;  4F9M A;  3W0I A;  4ITE A;  3UVV B;  2O9I A;  2HFP A;  5FQT A;  4YT1 A;  3K22 A;  2Q6J A;  4MDD A;  4OAR A;  2PNU A;  5DRM A;  3WJ4 A;  5JY3 A;  1XLS A;  2PRG A;  4IQR A;  4PWL A;  4FHH A;  4XUM A;  3W0Y A;  1U9E A;  5C4T A;  1NAV A;  1RKG A;  2QTU A;  3B5R A;  1P93 A;  3OZJ A;  4NY9 A;  1FM6 D;  4O8F A;  2OM9 A;  2AM9 A;  3VT7 A;  2GTK A;  2YLY A;  2P4Y A;  1ZAF A;  1RK3 A;  1IE8 A;  5DIE A;  3W0H A;  1YP0 A;  3KYT A;  1X7R A;  2R40 D;  2JJ3 A;  3B0W A;  4G2H A;  3VTD A;  3VRU A;  4QJR A;  4ZN9 A;  5EGV A;  3MNP A;  4MGC A;  1UPW A;  3V3E A;  5DXP A;  4E2J A;  3VT9 A;  4OKX A;  4RFW A;  1R1K A;  2VV1 A;  4MGB B;  1ZGY A;  3A2H A;  3V4A A;  3VJH A;  3GWS X;  5KRM A;  1RDT A;  1S0X A;  1X76 A;  4G1D A;  3FS1 A;  1N83 A;  1T79 A;  2B50 A;  2BJ4 A;  3E94 A;  3GWX A;  2QPY A;  3OMQ A;  3OS8 A;  2GPO A;  1HJ1 A;  4A2J A;  3KMZ A;  2Q59 B;  3ET1 A;  3KPZ A;  4OJ4 A;  4R2U A;  3R8D A;  3VJI A;  1XV9 B;  1XQC A;  4OZT U;  3RLJ A;  5AAV B;  2W8Y A;  1SQN A;  2R6Y A;  4UDA A;  4DOS A;  5G42 A;  4OEA A;  1ZDT A;  3M7R A;  3DZY A;  3FUR A;  5KRA A;  1S9P A;  5DWJ A;  3FXV A;  3H0A A;  4M8E A;  2POB A;  1SR7 A;  2H77 A;  2HBH A;  4WHF A;  4ONI A;  3UVV A;  3DZU A;  4MG8 B;  5EHJ A;  3FC6 B;  2P1T A;  1XDK B;  5DSH A;  2F4B A;  2YLO A;  2YJD A;  3OMK A;  4ZN7 A;  5KCT A;  4IVW A;  3R8A A;  2Q60 A;  2VV4 B;  2Q6R A;  3WFF A;  1U3S A;  5DVS A;  1OSH A;  5AYG A;  4MG7 B;  5I4V A;  3VT3 A;  5C4O A;  4EM9 A;  2AYR A;  4OC7 A;  5E14 A;  5B41 A;  4WPF A;  2HB8 A;  2I4J A;  4HEE X;  4IUI A;  1QKT A;  1TXI A;  4WVD A;  1X78 A;  3A3Z X;  3K23 A;  1PRG A;  4UDC A;  3DR1 A;  4XI3 A;  5DV3 A;  5DMC A;  5KRI A;  3A40 X;  5GIE A;  5IXK A;  1YIM A;  1T65 A;  1YMT A;  4ZNW A;  5KD9 A;  3H52 A;  5GT4 A;  2EWP A;  4MGB A;  2ZY0 A;  3KFC A;  5E1C A;  1ZDU A;  2ZNN A;  3RLL A;  3WTQ A;  5HYR A;  3RVF A;  5DZH A;  5KR9 A;  4LSJ A;  4J5W A;  3GYT A;  5G45 A;  3BEJ A;  4R6S A;  2ZLC A;  5DUH A;  5KYJ A;  1FM9 A;  2Q59 A;  4FHI A;  4RAK A;  3A78 A;  3RUT A;  1XV9 A;  1YOK A;  2Q7K A;  2ZNP A;  5F9B A;  2NPA A;  5DKS A;  4PLE A;  2IOG A;  3CDP A;  5DXB B;  3T03 A;  3VRV A;  2ZK4 A;  3ERT A;  4OK1 A;  2ATH A;  2ZK2 A;  1MVC A;  2Q6S A;  3HC6 A;  2XKW A;  1ILG A;  5KCW A;  3VT5 A;  2ZL9 A;  2PIQ A;  4G21 A;  2I4P A;  2QH6 A;  1R20 D;  2QNV A;  3K6P A;  4OGH A;  2NW4 A;  3VTB A;  2Z4B A;  3TX7 B;  5DRJ A;  2GPV A;  3X1I A;  2PJL A;  5DUG A;  3KWY A;  1GWQ A;  4MG8 A;  4JL4 A;  2HWQ A;  5A86 A;  3UP3 A;  3FC6 A;  2G0G A;  1I37 A;  5KRC A;  3OMP A;  1XDK A;  2AA5 A;  5DKB A;  5DXR A;  5AWK A;  4DM8 A;  4NQA B;  1PQ6 A;  2ZMI A;  2GP7 A;  2LBD A;  4OJ9 A;  2ZVT A;  3ADT A;  5E0X A;  2VV4 A;  4B7W A;  4XLD A;  3ILZ A;  2QGT A;  1ZEO A;  4J26 A;  1K7L A;  1Y0S A;  2FSZ A;  2PIU A;  2YJA B;  3OLS A;  3OS8 C;  1E3K A;  4JYG A;  4MG7 A;  4OFR A;  2ABI A;  4DM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...