2ZNPA

Human ppar delta ligand binding domain in complex with a synthetic agonist tipp204
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
266
structure length
259
Chain Sequence
LKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adaptability and selectivity of human peroxisome proliferator-activated receptor (PPAR) pan agonists revealed from crystal structures
pubmed doi rcsb
molecule keywords Peroxisome proliferator-activated receptor delta
molecule tags Transcription
source organism Homo sapiens
total genus 91
structure length 259
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2znpA00
3HC5A 3F7DA 1T65A 2FAIA 4QJRA 5DUEA 5IXKA 3W0IA 1G1UA 1OVLB 4JL4A 3V49A 3O1EA 4IVYA 3VSPA 2G44A 3LMPA 3A40X 3L03A 4J5WA 1HG4A 4OZTE 1RKHA 1XV9B 1P8DA 5FQRA 3W5QA 4RUOX 2VV4B 2PNUA 5DRJA 4OEYA 2O4RA 5I4VA 1X76A 1ZUCA 2P54A 2ZK6A 3HVLA 2AYRA 5HYKA 5DU5A 3FALB 5CJ6A 5FQSA 4IW6A 3HODA 2YJDA 3M7RA 4OZTU 1N4HA 4IW8A 4PP5A 2GPUA 4REFA 4WVDA 5DXEA 3TY0A 3ET0A 1YP0A 3OLLA 5DVCA 1XVPB 3VHWA 2J7XA 1XOWA 3CTBA 1NQ7A 1PQCA 5DXRA 5JJMA 3CS4A 1OSVA 3OMOA 3AUNA 1XQ3A 3ET3A 3K8SA 1QKMA 3L3ZA 2V7CA 3A2JA 4YT1A 4OJ4A 5DXGA 5JI0D 1PZLA 5EGVA 2Q5SA 3W0AA 4OJBA 1P93A 3G8OA 3RUUA 3R5MA 3R8AA 1XB7A 4ZNSA 2NV7A 1WM0X 2QABA 1FM9D 2ZMHA 3BC5A 1YMTA 3D90A 4MGBB 1YOWA 4BCRA 4FHHA 4KZIA 5DKGA 2ZY0A 5AYGA 1T7FA 3B0RA 3VT7A 2G5OA 1K74A 2GWXA 4RZEA 5DYDA 4ZNHA 2QZOA 3NSPA 5KRJA 4LTWA 4RFWA 2Q59A 4G1YA 4MDDA 4PWLA 1XNNA 5EC9A 1ZEOA 3E00A 2HFPA 3PEQA 3F5CB 4N5GA 3OS8C 1R20A 2I0GA 4NY9A 1UHLA 2XYJA 3FC6B 2AXAA 5G46A 3DZUD 4ZNWA 4POJA 4XUMA 2Q1HA 1ZH7A 4PF3A 5DZ1A 1NAVA 1R20D 1XP1A 1Q4XA 2ZXZA 3OMQA 5EJVA 3RVFA 1T7RA 4NUFA 3BQDA 4OFUA 3IXPA 3K6PA 1YA3A 4ZNTA 4S0TA 3B5RA 4K4JA 4QM0A 3G0WA 4TUZA 5APKA 2HWRA 3ADXA 4NB6A 4QE6A 2PINA 1NAXA 4UDDA 5DXBB 5E14A 2H77A 4MGAA 5DZ3A 3CQVA 3OLFA 3HZFA 4FN9A 5KRFA 2PIOA 2AA2A 3VT5A 1Y0XX 3IPQA 2VV1A 2IOKA 4ZI1A 2Q70A 3E94A 2AA5A 3AZ1A 5DXPA 5C4TA 5KRKA 3K22A 1SR7A 2PIVA 4ITFA 5C4OA 1IE8A 5DV8A 5KYJA 1OVLA 1XQCA 2HC4A 2ZNNA 5AAUA 1RKGA 1UOMA 5KR9A 5GT4A 4ITEA 5L7HA 1YYEA 1K4WA 1QKUA 1XV9A 3OS9A 3P89A 4MG5A 3AN4A 4OKXA 3R8DA 2OZ7A 1YOKA 2VV4A 2O4JA 3BEJA 1HJ1A 2G0GA 4OJ9A 4MG7B 2I4ZA 1ILGA 2Q6SA 3MNOA 1GWRA 1UHLB 3FALA 4JYGA 4OKWA 3VT9A 3GWSX 4PLDA 1E3KA 1XVPA 2ZMJA 5E15A 5DSHA 3GWXA 3R2AA 3R8IA 5KCCA 4XLDA 2J7YA 3OSAA 1K7LA 3U9QA 3AFRA 2YLOA 2J4AA 2XYXA 4RZGA 4ZNVA 1KV6A 4LNXA 1Y9RA 3V3QA 2QR9A 2XHSA 2F4BA 4RE8A 3VRTA 3X1HA 3HLVA 4E4KA 4XT9A 4X1GA 1SQNA 1RDTA 2VV0A 1YIMA 3B3KA 5L7GA 1FD0A 1ZDTA 4OIUA 3VJSA 1KKQA 2QGTA 3ZQTA 5DWJA 1RDTD 4MGBA 5G43A 5DWIA 3UP3A 4J24A 1X7JA 4DQMA 3P0UA 1M2ZA 4K7AA 4J5WC 3X36A 4OKBA 2GP7A 5K13A 1I37A 2YLPA 4ZOMA 3VT3A 2QMVA 2ZNOA 4E2JA 2PITA 3HQ5A 3PO9A 5DL4A 3OZJA 2HCDA 3F5CA 4J5XA 3D5FA 2YLQA 1N83A 1PDUA 5KRCA 3OMKA 1U3RA 3KMZA 3FC6A 1YINA 5DI7A 3PCUA 4PPPA 2OCFA 2YLYA 3FS1A 5DMFA 1XLSA 2Q60A 2PIWA 3V9VA 3GN8A 2OVMA 3ET1A 1I38A 4EM9A 3ADTA 3WMHA 1DKFB 1G50A 1I7GA 1XPCA 4PPSA 2QW4A 4A4WA 5DRMA 3JZCA 5GIDA 5DXMA 4ZN7A 4PVUA 4G21A 4IS8A 1TXIA 4K6IA 5DKEA 5DXBA 2P4YA 2Z4BA 1FM9A 2W8YA 3VRWA 1KNUA 3JZBA 2Q6JA 1XP6A 4WHGA 5KCFA 4JGVA 2QA8B 3FXVA 5IAWA 5DUGA 3W0CA 3A2IA 5E1CA 5DYBA 4R6SA 1TFCA 5KCDA 3OAPA 2ZXMA 4B7WA 1N46A 1S0ZA 3EYBA 3KBAA 4OH5A 4DMAA 4F9MA 1YJEA 5DLRA 5GIEA 2QE4A 2QNVA 3TX7B 3DT3A 4RAKA 1Z5XU 3FUGA 3UU7B 1FCZA 3VHVA 2QH6A 2YJAB 3VT6A 5KCEA 4OZRU 3AUQA 3RLLA 5ICKA 3FURA 3CDSA 5AK2A 3MNEA 3A3ZX 5B41A 3DZUA 2ZBSA 3CWDA 1X7RA 5DV3A 3W0YA 3WJ4A 4E4QA 5HZCA 4R06A 2ZLCA 4MG7A 4DK7A 1M13A 2AA6A 4REEA 4LNWA 5DKBA 4Q0AC 4XHDA 2O9IA 4PP6A 5HJSA 3ZR7A 2ZK0A 3GBKA 1UPVA 3KPZA 2Z4JA 3L0JA 3OSIA 4S15A 5DP0A 4ZN9A 2OVHA 4XUHA 1NQ0A 5DUHA 1LBDA 3D24A 2VV3A 5DIEA 2NPAA 4ZNUA 4XAOA 1IE9A 1ZKYA 2AA7A 2AX6A 4MG9B 3VRUA 2G0HA 1NQ2A 2Q6RA 4P6XA 1T79A 2QPYA 5EITA 1QKNA 2PKLA 3B66A 4MG8B 4OEDA 5FQTA 3UUDB 2POGA 1XDKB 3P88A 3OS8A 4N1YA 4CI4A 5E0XA 3OOFA 3W5TA 5G42A 3OSWA 5KYAA 3W0GA 1T74A 1T76A 4QE8A 3CS6A 4OLMA 4QK4A 5H1EA 3VTDA 4IVWA 3SP9A 4J26A 1EXXA 4R2UA 2ZK3A 1S9PA 4WQPA 2AMBA 3GZ9A 5AZTA 1GWQA 3ET2A 3H0AD 1SJ0A 5AAVB 2ZK4A 4A4VA 5DMCA 3WT7A 1XNXA 1R5KA 4UDBA 2YATA 4TV1B 4PRGA 5DWEA 2QXMA 1ZDUA 2A3IA 2HAMA 3QT0A 3ZRBA 1PQ6A 1QKTA 2ACLB 3B65A 3FLIA 2Q7IA 4UDCA 5KCWA 5DXQA 5KRIA 3VJTA 2HARA 2NXXE 1NRLA 1Y0SA 3AURA 4OZRE 1YUCA 1YY4A 1DB1A 1SKXA 1A28A 2VSTA 3UP0A 1FCXA 3IPSA 1R6GA 1DKFA 1NQ1A 3RY9A 1G5YA 2ZLAA 3AX8A 1XP9A 3IPUA 3V4AA 3GYUA 3H52A 3DR1A 1A52A 3W0JA 3Q95B 3AZ2A 5APHA 2YFEA 3K23A 3ZRAA 2Q7LA 3A9EB 1MV9A 1H9UA 4OGHA 4RWVA 5KCUA 1BSXA 4OILA 2ZNPA 3ERDA 3KDTA 4IU7A 4OEZA 5DTVA 4IV2A 5DWLA 2PJLA 3A78A 3R5NA 3V3EA 2R6WA 2FSZA 2QA8A 2QA6A 2HB7A 2HBHA 4FGYA 3B1MA 5AWJA 3WFGA 1NHZA 2GL8A 3CJWA 3B67A 5DY8A 5HCVA 5KRHA 3KMRA 3KDUA 2P15A 3PRGA 5DK9A 2ZNQA 1E3GA 3GD2A 4PXMA 4G20A 2IOGA 2REWA 2B23A 2P1TA 2JFAB 3UU7A 5DXKA 4OARA 3G9EA 4Q13A 2R6YA 5DIDA 5LGAA 4N73A 4PP3A 1S0XA 1X7BA 1XAPA 1T7TA 5B5BA 4MGCA 1FM6D 1L2IA 1T5ZA 1MZNA 3ADSA 3X1IA 2P1VA 3ERTA 5GICA 2BJ4B 4ZJWA 4YNKA 1Z95A 3CLDA 1GS4A 2B1VA 3D57A 5DX3A 2I4JA 1ZGYA 2GPVA 1PQ9A 4RUJA 2NW4A 2I4PA 3ILZA 3VTCA 4JYIA 2XKWA 1OSHA 3S9SA 1XJ7A 5E7VA 4KZMA 2YHDA 3KWYA 1PK5A 1R1KA 4WPFA 3VHUA 5SYZA 3IA6A 4MG9A 3DY6A 3FEJA 1RK3A 3GYTA 2Q8SA 5ACCA 1T7MA 1R1KD 1U9EA 2J14A 3L1BA 4MG6A 2E2RA 2HVCA 4MG8A 3OKIA 4NQAB 3UUDA 3D6DA 1XDKA 4IA7A 2AM9A 4G2IA 1ERRA 3CS8A 2ZK2A 3VT4A 2Q5PA 4YPQA 3UUAB 4KZJA 3AZ3A 3OGTA 1GWXA 4DK8A 3A2HA 4ZJRA 3OMMA 2AX8A 1VJBA 5AZVA 1XLSE 3SP6A 2P7AA 1U3QA 2AO6A 3LBDA 5KD9A 2GPOA 1S19A 2QSEA 2VV2A 3W5RA 5KRMA 3WFFA 4IWCA 2ZK1A 3VRVA 2R40A 3TKCA 5AAVA 5DV6A 2PIUA 2EWPA 3T03A 3P8XA 4MGDB 3OZ0A 4TV1A 1FBYA 3IMYA 4OEAA 3UVVB 2QXSA 2ZFXA 3MNPA 2I0JA 2OUZA 2R40D 4DM8A 3HM1A 2ACLA 2H79A 4OKTA 5HJPB 2P7GA 5ETHA 4OK1A 5HYRA 5JY3A 3RUTA 3VT8A 4Y29A 4IV4A 5DX3B 2JF9A 1OT7A 1PRGA 3CDPA 2IHQA 3G8IA 4X1FA 2B50A 3WJ5A 3ADVA 1UPWA 2LBDA 4RUPA 3WT6A 2P1UA 2GTKA 3Q95A 3UUCA 4M8EA 5KRAA 5DWGA 3VTBA 2PRGA 3A9EA 3B0TA 3B0WA 4IA3A 4WLBA 5A86A 1T63A 2OM9A 2ZASA 4S0SA 3L0EA 1K74D 3PLZA 3L0LA 4CSJA 3FEIA 4ONIA 5FQVA 5KROA 2AMAA 1RJKA 2Q7KA 4N8RA 3E00D 4RMDA 1FCYA 3X31A 3W5PA 3H0AA 2GPPA 4G1DA 4IUIA 4NIEA 4QL8A 4XTAA 5L7EA 4IA1A 2HB8A 4OHAA 3ADUA 4FHIA 4G2HA 5JJMB 3KYTA 3W0HA 3WWRA 5LWPA 3OOKA 5DKSA 4EMAA 3ADWA 4RMEA 2JFAA 2Q3YA 2AWHA 4ZO1B 1NYXA 3V9TA 4UDAA 5DZIA 4DM6A 2ZXNA 3VN2A 4IQRA 1X78A 2HASA 2B1ZA 3L3XA 4RZFA 1I7IA 1M7WA 3IXPD 4RMCA 4APUA 1X7EA 3DCUA 4POHA 2ZL9A 5DVVA 4OFRA 2AX7A 2NXXA 4OC7A 2BJ4A 1Z5XE 4PLEA 5DVSA 4DOSA 5FQPA 1MVCA 4LBDA 2PIQA 3WTQA 4YMQA 1T73A 3VJHA 5L11A 1PCGA 1LV2A 2ZKCA 3NSQA 2BAWA 3N00A 4OH6A 2VSRA 3SZ1A 4M8HA 3B68A 3KFCA 3VJIA 2AAXA 2P7ZA 5M96A 2XYWA 1XZXX 4FNEA 4DORA 2PIXA 5C4UA 5G5WA 2QZOB 4HEEX 4L96A 2Q59B 2Q1VA 2OAXA 3AN3A 2ATHA 4JYHA 5AVLA 2QTUA 4WHFA 5EHJA 1L2JA 4XI3A 1NUOA 2Q5GA 5G3JA 1S9QA 2ABIA 2FVJA 3B0QA 3O1DA 2ZVTA 3VI8A 3WT5A 3UUAA 5DZHA 2ZMIA 3OKHA 3HC6A 3V9YA 5APJA 3HO0A 4HLWA 3DZYA 1XIUA 2POBA 4LSJA 5C4SA 1U3SA 2GIUA 2PIPL 4ZO1X 2HWQA 1FM6A 4L98A 4A2JA 5E19A 3OLSA 5F9BA 4G1ZA 4Q50A 1EREA 2Q61A 5AVIA 5G44A 4TUZB 2JJ3A 2Q7JA 4OIVA 3DZYD 4P6WA 5DIGA 4JAZA 3PBAA 3R29A 4O8FA 4S14A 1ILHA 3OMPA 5E0WA 4MGDA 5EI1A 4CI5A 4J5XC 3UVVA 3DCTA 4MGAB 2PIRA 4IWFA 1ZAFA 5HJPA 1G2NA 2VV1B 1NDEA 3KMGA 5IZ0A 3TKMA 4IA2A 5G45A 3WGPA 5KRLA 2ZK5A 2V0VA 5KCTA 2AB2A 5AWKA 2AX9A 3E7CA 3NOAA 5DZ0A 1EXAA 3VSOA 2QGWA 3RLJA
chains in the Genus database with same CATH superfamily
3HC5A 3F7DA 1T65A 2FAIA 4QJRA 5DUEA 5IXKA 3W0IA 1G1UA 1OVLB 4JL4A 3V49A 3O1EA 4IVYA 3VSPA 2G44A 3LMPA 3A40X 3L03A 4J5WA 1HG4A 4OZTE 1RKHA 1XV9B 1P8DA 5FQRA 3W5QA 4RUOX 2VV4B 2PNUA 5DRJA 4OEYA 2O4RA 5I4VA 1X76A 1ZUCA 2P54A 2ZK6A 3HVLA 2AYRA 5HYKA 5DU5A 3FALB 5CJ6A 5FQSA 4IW6A 3HODA 2YJDA 3M7RA 4OZTU 1N4HA 4IW8A 4PP5A 2GPUA 4REFA 4WVDA 5DXEA 3TY0A 3ET0A 1YP0A 3OLLA 5DVCA 1XVPB 3VHWA 2J7XA 1XOWA 3CTBA 1NQ7A 1PQCA 5DXRA 5JJMA 3CS4A 1OSVA 3OMOA 3AUNA 1XQ3A 3ET3A 3K8SA 1QKMA 3L3ZA 2V7CA 3A2JA 4YT1A 4OJ4A 5DXGA 5JI0D 1PZLA 5EGVA 2Q5SA 3W0AA 4OJBA 1P93A 3G8OA 3RUUA 3R5MA 3R8AA 1XB7A 4ZNSA 2NV7A 1WM0X 2QABA 1FM9D 2ZMHA 3BC5A 1YMTA 3D90A 4MGBB 1YOWA 4BCRA 4FHHA 4KZIA 5DKGA 2ZY0A 5AYGA 1T7FA 3B0RA 3VT7A 2G5OA 1K74A 2GWXA 4RZEA 5DYDA 4ZNHA 2QZOA 3NSPA 5KRJA 4LTWA 4RFWA 2Q59A 4G1YA 4MDDA 4PWLA 1XNNA 5EC9A 1ZEOA 3E00A 2HFPA 3PEQA 3F5CB 4N5GA 3OS8C 1R20A 2I0GA 4NY9A 1UHLA 2XYJA 3FC6B 2AXAA 5G46A 3DZUD 4ZNWA 4POJA 4XUMA 2Q1HA 1ZH7A 4PF3A 5DZ1A 1NAVA 1R20D 1XP1A 1Q4XA 2ZXZA 3OMQA 5EJVA 3RVFA 1T7RA 4NUFA 3BQDA 4OFUA 3IXPA 3K6PA 1YA3A 4ZNTA 4S0TA 3B5RA 4K4JA 4QM0A 3G0WA 4TUZA 5APKA 2HWRA 3ADXA 4NB6A 4QE6A 2PINA 1NAXA 4UDDA 5DXBB 5E14A 2H77A 4MGAA 5DZ3A 3CQVA 3OLFA 3HZFA 4FN9A 5KRFA 2PIOA 2AA2A 3VT5A 1Y0XX 3IPQA 2VV1A 2IOKA 4ZI1A 2Q70A 3E94A 2AA5A 3AZ1A 5DXPA 5C4TA 5KRKA 3K22A 1SR7A 2PIVA 4ITFA 5C4OA 1IE8A 5DV8A 5KYJA 1OVLA 1XQCA 2HC4A 2ZNNA 5AAUA 1RKGA 1UOMA 5KR9A 5GT4A 4ITEA 5L7HA 1YYEA 1K4WA 1QKUA 1XV9A 3OS9A 3P89A 4MG5A 3AN4A 4OKXA 3R8DA 2OZ7A 1YOKA 2VV4A 2O4JA 3BEJA 1HJ1A 2G0GA 4OJ9A 4MG7B 2I4ZA 1ILGA 2Q6SA 3MNOA 1GWRA 1UHLB 3FALA 4JYGA 4OKWA 3VT9A 3GWSX 4PLDA 1E3KA 1XVPA 2ZMJA 5E15A 5DSHA 3GWXA 3R2AA 3R8IA 5KCCA 4XLDA 2J7YA 3OSAA 1K7LA 3U9QA 3AFRA 2YLOA 2J4AA 2XYXA 4RZGA 4ZNVA 1KV6A 4LNXA 1Y9RA 3V3QA 2QR9A 2XHSA 2F4BA 4RE8A 3VRTA 3X1HA 3HLVA 4E4KA 4XT9A 4X1GA 1SQNA 1RDTA 2VV0A 1YIMA 3B3KA 5L7GA 1FD0A 1ZDTA 4OIUA 3VJSA 1KKQA 2QGTA 3ZQTA 5DWJA 1RDTD 4MGBA 5G43A 5DWIA 3UP3A 4J24A 1X7JA 4DQMA 3P0UA 1M2ZA 4K7AA 4J5WC 3X36A 4OKBA 2GP7A 5K13A 1I37A 2YLPA 4ZOMA 3VT3A 2QMVA 2ZNOA 4E2JA 2PITA 3HQ5A 3PO9A 5DL4A 3OZJA 2HCDA 3F5CA 4J5XA 3D5FA 2YLQA 1N83A 1PDUA 5KRCA 3OMKA 1U3RA 3KMZA 3FC6A 1YINA 5DI7A 3PCUA 4PPPA 2OCFA 2YLYA 3FS1A 5DMFA 1XLSA 2Q60A 2PIWA 3V9VA 3GN8A 2OVMA 3ET1A 1I38A 4EM9A 3ADTA 3WMHA 1DKFB 1G50A 1I7GA 1XPCA 4PPSA 2QW4A 4A4WA 5DRMA 3JZCA 5GIDA 5DXMA 4ZN7A 4PVUA 4G21A 4IS8A 1TXIA 4K6IA 5DKEA 5DXBA 2P4YA 2Z4BA 1FM9A 2W8YA 3VRWA 1KNUA 3JZBA 2Q6JA 1XP6A 4WHGA 5KCFA 4JGVA 2QA8B 3FXVA 5IAWA 5DUGA 3W0CA 3A2IA 5E1CA 5DYBA 4R6SA 1TFCA 5KCDA 3OAPA 2ZXMA 4B7WA 1N46A 1S0ZA 3EYBA 3KBAA 4OH5A 4DMAA 4F9MA 1YJEA 5DLRA 5GIEA 2QE4A 2QNVA 3TX7B 3DT3A 4RAKA 1Z5XU 3FUGA 3UU7B 1FCZA 3VHVA 2QH6A 2YJAB 3VT6A 5KCEA 4OZRU 3AUQA 3RLLA 5ICKA 3FURA 3CDSA 5AK2A 3MNEA 3A3ZX 5B41A 3DZUA 2ZBSA 3CWDA 1X7RA 5DV3A 3W0YA 3WJ4A 4E4QA 5HZCA 4R06A 2ZLCA 4MG7A 4DK7A 1M13A 2AA6A 4REEA 4LNWA 5DKBA 4Q0AC 4XHDA 2O9IA 4PP6A 5HJSA 3ZR7A 2ZK0A 3GBKA 1UPVA 3KPZA 2Z4JA 3L0JA 3OSIA 4S15A 5DP0A 4ZN9A 2OVHA 4XUHA 1NQ0A 5DUHA 1LBDA 3D24A 2VV3A 5DIEA 2NPAA 4ZNUA 4XAOA 1IE9A 1ZKYA 2AA7A 2AX6A 4MG9B 3VRUA 2G0HA 1NQ2A 2Q6RA 4P6XA 1T79A 2QPYA 5EITA 1QKNA 2PKLA 3B66A 4MG8B 4OEDA 5FQTA 3UUDB 2POGA 1XDKB 3P88A 3OS8A 4N1YA 4CI4A 5E0XA 3OOFA 3W5TA 5G42A 3OSWA 5KYAA 3W0GA 1T74A 1T76A 4QE8A 3CS6A 4OLMA 4QK4A 5H1EA 3VTDA 4IVWA 3SP9A 4J26A 1EXXA 4R2UA 2ZK3A 1S9PA 4WQPA 2AMBA 3GZ9A 5AZTA 1GWQA 3ET2A 3H0AD 1SJ0A 5AAVB 2ZK4A 4A4VA 5DMCA 3WT7A 1XNXA 1R5KA 4UDBA 2YATA 4TV1B 4PRGA 5DWEA 2QXMA 1ZDUA 2A3IA 2HAMA 3QT0A 3ZRBA 1PQ6A 1QKTA 2ACLB 3B65A 3FLIA 2Q7IA 4UDCA 5KCWA 5DXQA 5KRIA 3VJTA 2HARA 2NXXE 1NRLA 1Y0SA 3AURA 4OZRE 1YUCA 1YY4A 1DB1A 1SKXA 1A28A 2VSTA 3UP0A 1FCXA 3IPSA 1R6GA 1DKFA 1NQ1A 3RY9A 1G5YA 2ZLAA 3AX8A 1XP9A 3IPUA 3V4AA 3GYUA 3H52A 3DR1A 1A52A 3W0JA 3Q95B 3AZ2A 5APHA 2YFEA 3K23A 3ZRAA 2Q7LA 3A9EB 1MV9A 1H9UA 4OGHA 4RWVA 5KCUA 1BSXA 4OILA 2ZNPA 3ERDA 3KDTA 4IU7A 4OEZA 5DTVA 4IV2A 5DWLA 2PJLA 3A78A 3R5NA 3V3EA 2R6WA 2FSZA 2QA8A 2QA6A 2HB7A 2HBHA 4FGYA 3B1MA 5AWJA 3WFGA 1NHZA 2GL8A 3CJWA 3B67A 5DY8A 5HCVA 5KRHA 3KMRA 3KDUA 2P15A 3PRGA 5DK9A 2ZNQA 1E3GA 3GD2A 4PXMA 4G20A 2IOGA 2REWA 2B23A 2P1TA 2JFAB 3UU7A 5DXKA 4OARA 3G9EA 4Q13A 2R6YA 5DIDA 5LGAA 4N73A 4PP3A 1S0XA 1X7BA 1XAPA 1T7TA 5B5BA 4MGCA 1FM6D 1L2IA 1T5ZA 1MZNA 3ADSA 3X1IA 2P1VA 3ERTA 5GICA 2BJ4B 4ZJWA 4YNKA 1Z95A 3CLDA 1GS4A 2B1VA 3D57A 5DX3A 2I4JA 1ZGYA 2GPVA 1PQ9A 4RUJA 2NW4A 2I4PA 3ILZA 3VTCA 4JYIA 2XKWA 1OSHA 3S9SA 1XJ7A 5E7VA 4KZMA 2YHDA 3KWYA 1PK5A 1R1KA 4WPFA 3VHUA 5SYZA 3IA6A 4MG9A 3DY6A 3FEJA 1RK3A 3GYTA 2Q8SA 5ACCA 1T7MA 1R1KD 1U9EA 2J14A 3L1BA 4MG6A 2E2RA 2HVCA 4MG8A 3OKIA 4NQAB 3UUDA 3D6DA 1XDKA 4IA7A 2AM9A 4G2IA 1ERRA 3CS8A 2ZK2A 3VT4A 2Q5PA 4YPQA 3UUAB 4KZJA 3AZ3A 3OGTA 1GWXA 4DK8A 3A2HA 4ZJRA 3OMMA 2AX8A 1VJBA 5AZVA 1XLSE 3SP6A 2P7AA 1U3QA 2AO6A 3LBDA 5KD9A 2GPOA 1S19A 2QSEA 2VV2A 3W5RA 5KRMA 3WFFA 4IWCA 2ZK1A 3VRVA 2R40A 3TKCA 5AAVA 5DV6A 2PIUA 2EWPA 3T03A 3P8XA 4MGDB 3OZ0A 4TV1A 1FBYA 3IMYA 4OEAA 3UVVB 2QXSA 2ZFXA 3MNPA 2I0JA 2OUZA 2R40D 4DM8A 3HM1A 2ACLA 2H79A 4OKTA 5HJPB 2P7GA 5ETHA 4OK1A 5HYRA 5JY3A 3RUTA 3VT8A 4Y29A 4IV4A 5DX3B 2JF9A 1OT7A 1PRGA 3CDPA 2IHQA 3G8IA 4X1FA 2B50A 3WJ5A 3ADVA 1UPWA 2LBDA 4RUPA 3WT6A 2P1UA 2GTKA 3Q95A 3UUCA 4M8EA 5KRAA 5DWGA 3VTBA 2PRGA 3A9EA 3B0TA 3B0WA 4IA3A 4WLBA 5A86A 1T63A 2OM9A 2ZASA 4S0SA 3L0EA 1K74D 3PLZA 3L0LA 4CSJA 3FEIA 4ONIA 5FQVA 5KROA 2AMAA 1RJKA 2Q7KA 4N8RA 3E00D 4RMDA 1FCYA 3X31A 3W5PA 3H0AA 2GPPA 4G1DA 4IUIA 4NIEA 4QL8A 4XTAA 5L7EA 4IA1A 2HB8A 4OHAA 3ADUA 4FHIA 4G2HA 5JJMB 3KYTA 3W0HA 3WWRA 5LWPA 3OOKA 5DKSA 4EMAA 3ADWA 4RMEA 2JFAA 2Q3YA 2AWHA 4ZO1B 1NYXA 3V9TA 4UDAA 5DZIA 4DM6A 2ZXNA 3VN2A 4IQRA 1X78A 2HASA 2B1ZA 3L3XA 4RZFA 1I7IA 1M7WA 3IXPD 4RMCA 4APUA 1X7EA 3DCUA 4POHA 2ZL9A 5DVVA 4OFRA 2AX7A 2NXXA 4OC7A 2BJ4A 1Z5XE 4PLEA 5DVSA 4DOSA 5FQPA 1MVCA 4LBDA 2PIQA 3WTQA 4YMQA 1T73A 3VJHA 5L11A 1PCGA 1LV2A 2ZKCA 3NSQA 2BAWA 3N00A 4OH6A 2VSRA 3SZ1A 4M8HA 3B68A 3KFCA 3VJIA 2AAXA 2P7ZA 5M96A 2XYWA 1XZXX 4FNEA 4DORA 2PIXA 5C4UA 5G5WA 2QZOB 4HEEX 4L96A 2Q59B 2Q1VA 2OAXA 3AN3A 2ATHA 4JYHA 5AVLA 2QTUA 4WHFA 5EHJA 1L2JA 4XI3A 1NUOA 2Q5GA 5G3JA 1S9QA 2ABIA 2FVJA 3B0QA 3O1DA 2ZVTA 3VI8A 3WT5A 3UUAA 5DZHA 2ZMIA 3OKHA 3HC6A 3V9YA 5APJA 3HO0A 4HLWA 3DZYA 1XIUA 2POBA 4LSJA 5C4SA 1U3SA 2GIUA 2PIPL 4ZO1X 2HWQA 1FM6A 4L98A 4A2JA 5E19A 3OLSA 5F9BA 4G1ZA 4Q50A 1EREA 2Q61A 5AVIA 5G44A 4TUZB 2JJ3A 2Q7JA 4OIVA 3DZYD 4P6WA 5DIGA 4JAZA 3PBAA 3R29A 4O8FA 4S14A 1ILHA 3OMPA 5E0WA 4MGDA 5EI1A 4CI5A 4J5XC 3UVVA 3DCTA 4MGAB 2PIRA 4IWFA 1ZAFA 5HJPA 1G2NA 2VV1B 1NDEA 3KMGA 5IZ0A 3TKMA 4IA2A 5G45A 3WGPA 5KRLA 2ZK5A 2V0VA 5KCTA 2AB2A 5AWKA 2AX9A 3E7CA 3NOAA 5DZ0A 1EXAA 3VSOA 2QGWA 3RLJA
chains in the Genus database with same CATH topology
3HC5A 3F7DA 1T65A 2FAIA 4QJRA 5DUEA 5IXKA 3W0IA 1G1UA 1OVLB 4JL4A 3V49A 3O1EA 4IVYA 3VSPA 2G44A 3LMPA 3A40X 3L03A 4J5WA 1HG4A 4OZTE 1RKHA 1XV9B 1P8DA 5FQRA 3W5QA 4RUOX 2VV4B 2PNUA 5DRJA 4OEYA 2O4RA 5I4VA 1X76A 1ZUCA 2P54A 2ZK6A 3HVLA 2AYRA 5HYKA 5DU5A 3FALB 5CJ6A 5FQSA 4IW6A 3HODA 2YJDA 3M7RA 4OZTU 1N4HA 4IW8A 4PP5A 2GPUA 4REFA 4WVDA 5DXEA 3TY0A 3ET0A 1YP0A 3OLLA 5DVCA 1XVPB 3VHWA 2J7XA 1XOWA 3CTBA 1NQ7A 1PQCA 5DXRA 5JJMA 3CS4A 1OSVA 3OMOA 3AUNA 1XQ3A 3ET3A 3K8SA 1QKMA 3L3ZA 2V7CA 3A2JA 4YT1A 4OJ4A 5DXGA 5JI0D 1PZLA 5EGVA 2Q5SA 3W0AA 4OJBA 1P93A 3G8OA 3RUUA 3R5MA 3R8AA 1XB7A 4ZNSA 2NV7A 1WM0X 2QABA 1FM9D 2ZMHA 3BC5A 1YMTA 3D90A 4MGBB 1YOWA 4BCRA 4FHHA 4KZIA 5DKGA 2ZY0A 5AYGA 1T7FA 3B0RA 3VT7A 2G5OA 1K74A 2GWXA 4RZEA 5DYDA 4ZNHA 2QZOA 3NSPA 5KRJA 4LTWA 4RFWA 2Q59A 4G1YA 4MDDA 4PWLA 1XNNA 5EC9A 1ZEOA 3E00A 2HFPA 3PEQA 3F5CB 4N5GA 3OS8C 1R20A 2I0GA 4NY9A 1UHLA 2XYJA 3FC6B 2AXAA 5G46A 3DZUD 4ZNWA 4POJA 4XUMA 2Q1HA 1ZH7A 4PF3A 5DZ1A 1NAVA 1R20D 1XP1A 1Q4XA 2ZXZA 3OMQA 5EJVA 3RVFA 1T7RA 4NUFA 3BQDA 4OFUA 3IXPA 3K6PA 1YA3A 4ZNTA 4S0TA 3B5RA 4K4JA 4QM0A 3G0WA 4TUZA 5APKA 2HWRA 3ADXA 4NB6A 4QE6A 2PINA 1NAXA 4UDDA 5DXBB 5E14A 2H77A 4MGAA 5DZ3A 3CQVA 3OLFA 3HZFA 4FN9A 5KRFA 2PIOA 2AA2A 3VT5A 1Y0XX 3IPQA 2VV1A 2IOKA 4ZI1A 2Q70A 3E94A 2AA5A 3AZ1A 5DXPA 5C4TA 5KRKA 3K22A 1SR7A 2PIVA 4ITFA 5C4OA 1IE8A 5DV8A 5KYJA 1OVLA 1XQCA 2HC4A 2ZNNA 5AAUA 1RKGA 1UOMA 5KR9A 5GT4A 4ITEA 5L7HA 1YYEA 1K4WA 1QKUA 1XV9A 3OS9A 3P89A 4MG5A 3AN4A 4OKXA 3R8DA 2OZ7A 1YOKA 2VV4A 2O4JA 3BEJA 1HJ1A 2G0GA 4OJ9A 4MG7B 2I4ZA 1ILGA 2Q6SA 3MNOA 1GWRA 1UHLB 3FALA 4JYGA 4OKWA 3VT9A 3GWSX 4PLDA 1E3KA 1XVPA 2ZMJA 5E15A 5DSHA 3GWXA 3R2AA 3R8IA 5KCCA 4XLDA 2J7YA 3OSAA 1K7LA 3U9QA 3AFRA 2YLOA 2J4AA 2XYXA 4RZGA 4ZNVA 1KV6A 4LNXA 1Y9RA 3V3QA 2QR9A 2XHSA 2F4BA 4RE8A 3VRTA 3X1HA 3HLVA 4E4KA 4XT9A 4X1GA 1SQNA 1RDTA 2VV0A 1YIMA 3B3KA 5L7GA 1FD0A 1ZDTA 4OIUA 3VJSA 1KKQA 2QGTA 3ZQTA 5DWJA 1RDTD 4MGBA 5G43A 5DWIA 3UP3A 4J24A 1X7JA 4DQMA 3P0UA 1M2ZA 4K7AA 4J5WC 3X36A 4OKBA 2GP7A 5K13A 1I37A 2YLPA 4ZOMA 3VT3A 2QMVA 2ZNOA 4E2JA 2PITA 3HQ5A 3PO9A 5DL4A 3OZJA 2HCDA 3F5CA 4J5XA 3D5FA 2YLQA 1N83A 1PDUA 5KRCA 3OMKA 1U3RA 3KMZA 3FC6A 1YINA 5DI7A 3PCUA 4PPPA 2OCFA 2YLYA 3FS1A 5DMFA 1XLSA 2Q60A 2PIWA 3V9VA 3GN8A 2OVMA 3ET1A 1I38A 4EM9A 3ADTA 3WMHA 1DKFB 1G50A 1I7GA 1XPCA 4PPSA 2QW4A 4A4WA 5DRMA 3JZCA 5GIDA 5DXMA 4ZN7A 4PVUA 4G21A 4IS8A 1TXIA 4K6IA 5DKEA 5DXBA 2P4YA 2Z4BA 1FM9A 2W8YA 3VRWA 1KNUA 3JZBA 2Q6JA 1XP6A 4WHGA 5KCFA 4JGVA 2QA8B 3FXVA 5IAWA 5DUGA 3W0CA 3A2IA 5E1CA 5DYBA 4R6SA 1TFCA 5KCDA 3OAPA 2ZXMA 4B7WA 1N46A 1S0ZA 3EYBA 3KBAA 4OH5A 4DMAA 4F9MA 1YJEA 5DLRA 5GIEA 2QE4A 2QNVA 3TX7B 3DT3A 4RAKA 1Z5XU 3FUGA 3UU7B 1FCZA 3VHVA 2QH6A 2YJAB 3VT6A 5KCEA 4OZRU 3AUQA 3RLLA 5ICKA 3FURA 3CDSA 5AK2A 3MNEA 3A3ZX 5B41A 3DZUA 2ZBSA 3CWDA 1X7RA 5DV3A 3W0YA 3WJ4A 4E4QA 5HZCA 4R06A 2ZLCA 4MG7A 4DK7A 1M13A 2AA6A 4REEA 4LNWA 5DKBA 4Q0AC 4XHDA 2O9IA 4PP6A 5HJSA 3ZR7A 2ZK0A 3GBKA 1UPVA 3KPZA 2Z4JA 3L0JA 3OSIA 4S15A 5DP0A 4ZN9A 2OVHA 4XUHA 1NQ0A 5DUHA 1LBDA 3D24A 2VV3A 5DIEA 2NPAA 4ZNUA 4XAOA 1IE9A 1ZKYA 2AA7A 2AX6A 4MG9B 3VRUA 2G0HA 1NQ2A 2Q6RA 4P6XA 1T79A 2QPYA 5EITA 1QKNA 2PKLA 3B66A 4MG8B 4OEDA 5FQTA 3UUDB 2POGA 1XDKB 3P88A 3OS8A 4N1YA 4CI4A 5E0XA 3OOFA 3W5TA 5G42A 3OSWA 5KYAA 3W0GA 1T74A 1T76A 4QE8A 3CS6A 4OLMA 4QK4A 5H1EA 3VTDA 4IVWA 3SP9A 4J26A 1EXXA 4R2UA 2ZK3A 1S9PA 4WQPA 2AMBA 3GZ9A 5AZTA 1GWQA 3ET2A 3H0AD 1SJ0A 5AAVB 2ZK4A 4A4VA 5DMCA 3WT7A 1XNXA 1R5KA 4UDBA 2YATA 4TV1B 4PRGA 5DWEA 2QXMA 1ZDUA 2A3IA 2HAMA 3QT0A 3ZRBA 1PQ6A 1QKTA 2ACLB 3B65A 3FLIA 2Q7IA 4UDCA 5KCWA 5DXQA 5KRIA 3VJTA 2HARA 2NXXE 1NRLA 1Y0SA 3AURA 4OZRE 1YUCA 1YY4A 1DB1A 1SKXA 1A28A 2VSTA 3UP0A 1FCXA 3IPSA 1R6GA 1DKFA 1NQ1A 3RY9A 1G5YA 2ZLAA 3AX8A 1XP9A 3IPUA 3V4AA 3GYUA 3H52A 3DR1A 1A52A 3W0JA 3Q95B 3AZ2A 5APHA 2YFEA 3K23A 3ZRAA 2Q7LA 3A9EB 1MV9A 1H9UA 4OGHA 4RWVA 5KCUA 1BSXA 4OILA 2ZNPA 3ERDA 3KDTA 4IU7A 4OEZA 5DTVA 4IV2A 5DWLA 2PJLA 3A78A 3R5NA 3V3EA 2R6WA 2FSZA 2QA8A 2QA6A 2HB7A 2HBHA 4FGYA 3B1MA 5AWJA 3WFGA 1NHZA 2GL8A 3CJWA 3B67A 5DY8A 5HCVA 5KRHA 3KMRA 3KDUA 2P15A 3PRGA 5DK9A 2ZNQA 1E3GA 3GD2A 4PXMA 4G20A 2IOGA 2REWA 2B23A 2P1TA 2JFAB 3UU7A 5DXKA 4OARA 3G9EA 4Q13A 2R6YA 5DIDA 5LGAA 4N73A 4PP3A 1S0XA 1X7BA 1XAPA 1T7TA 5B5BA 4MGCA 1FM6D 1L2IA 1T5ZA 1MZNA 3ADSA 3X1IA 2P1VA 3ERTA 5GICA 2BJ4B 4ZJWA 4YNKA 1Z95A 3CLDA 1GS4A 2B1VA 3D57A 5DX3A 2I4JA 1ZGYA 2GPVA 1PQ9A 4RUJA 2NW4A 2I4PA 3ILZA 3VTCA 4JYIA 2XKWA 1OSHA 3S9SA 1XJ7A 5E7VA 4KZMA 2YHDA 3KWYA 1PK5A 1R1KA 4WPFA 3VHUA 5SYZA 3IA6A 4MG9A 3DY6A 3FEJA 1RK3A 3GYTA 2Q8SA 5ACCA 1T7MA 1R1KD 1U9EA 2J14A 3L1BA 4MG6A 2E2RA 2HVCA 4MG8A 3OKIA 4NQAB 3UUDA 3D6DA 1XDKA 4IA7A 2AM9A 4G2IA 1ERRA 3CS8A 2ZK2A 3VT4A 2Q5PA 4YPQA 3UUAB 4KZJA 3AZ3A 3OGTA 1GWXA 4DK8A 3A2HA 4ZJRA 3OMMA 2AX8A 1VJBA 5AZVA 1XLSE 3SP6A 2P7AA 1U3QA 2AO6A 3LBDA 5KD9A 2GPOA 1S19A 2QSEA 2VV2A 3W5RA 5KRMA 3WFFA 4IWCA 2ZK1A 3VRVA 2R40A 3TKCA 5AAVA 5DV6A 2PIUA 2EWPA 3T03A 3P8XA 4MGDB 3OZ0A 4TV1A 1FBYA 3IMYA 4OEAA 3UVVB 2QXSA 2ZFXA 3MNPA 2I0JA 2OUZA 2R40D 4DM8A 3HM1A 2ACLA 2H79A 4OKTA 5HJPB 2P7GA 5ETHA 4OK1A 5HYRA 5JY3A 3RUTA 3VT8A 4Y29A 4IV4A 5DX3B 2JF9A 1OT7A 1PRGA 3CDPA 2IHQA 3G8IA 4X1FA 2B50A 3WJ5A 3ADVA 1UPWA 2LBDA 4RUPA 3WT6A 2P1UA 2GTKA 3Q95A 3UUCA 4M8EA 5KRAA 5DWGA 3VTBA 2PRGA 3A9EA 3B0TA 3B0WA 4IA3A 4WLBA 5A86A 1T63A 2OM9A 2ZASA 4S0SA 3L0EA 1K74D 3PLZA 3L0LA 4CSJA 3FEIA 4ONIA 5FQVA 5KROA 2AMAA 1RJKA 2Q7KA 4N8RA 3E00D 4RMDA 1FCYA 3X31A 3W5PA 3H0AA 2GPPA 4G1DA 4IUIA 4NIEA 4QL8A 4XTAA 5L7EA 4IA1A 2HB8A 4OHAA 3ADUA 4FHIA 4G2HA 5JJMB 3KYTA 3W0HA 3WWRA 5LWPA 3OOKA 5DKSA 4EMAA 3ADWA 4RMEA 2JFAA 2Q3YA 2AWHA 4ZO1B 1NYXA 3V9TA 4UDAA 5DZIA 4DM6A 2ZXNA 3VN2A 4IQRA 1X78A 2HASA 2B1ZA 3L3XA 4RZFA 1I7IA 1M7WA 3IXPD 4RMCA 4APUA 1X7EA 3DCUA 4POHA 2ZL9A 5DVVA 4OFRA 2AX7A 2NXXA 4OC7A 2BJ4A 1Z5XE 4PLEA 5DVSA 4DOSA 5FQPA 1MVCA 4LBDA 2PIQA 3WTQA 4YMQA 1T73A 3VJHA 5L11A 1PCGA 1LV2A 2ZKCA 3NSQA 2BAWA 3N00A 4OH6A 2VSRA 3SZ1A 4M8HA 3B68A 3KFCA 3VJIA 2AAXA 2P7ZA 5M96A 2XYWA 1XZXX 4FNEA 4DORA 2PIXA 5C4UA 5G5WA 2QZOB 4HEEX 4L96A 2Q59B 2Q1VA 2OAXA 3AN3A 2ATHA 4JYHA 5AVLA 2QTUA 4WHFA 5EHJA 1L2JA 4XI3A 1NUOA 2Q5GA 5G3JA 1S9QA 2ABIA 2FVJA 3B0QA 3O1DA 2ZVTA 3VI8A 3WT5A 3UUAA 5DZHA 2ZMIA 3OKHA 3HC6A 3V9YA 5APJA 3HO0A 4HLWA 3DZYA 1XIUA 2POBA 4LSJA 5C4SA 1U3SA 2GIUA 2PIPL 4ZO1X 2HWQA 1FM6A 4L98A 4A2JA 5E19A 3OLSA 5F9BA 4G1ZA 4Q50A 1EREA 2Q61A 5AVIA 5G44A 4TUZB 2JJ3A 2Q7JA 4OIVA 3DZYD 4P6WA 5DIGA 4JAZA 3PBAA 3R29A 4O8FA 4S14A 1ILHA 3OMPA 5E0WA 4MGDA 5EI1A 4CI5A 4J5XC 3UVVA 3DCTA 4MGAB 2PIRA 4IWFA 1ZAFA 5HJPA 1G2NA 2VV1B 1NDEA 3KMGA 5IZ0A 3TKMA 4IA2A 5G45A 3WGPA 5KRLA 2ZK5A 2V0VA 5KCTA 2AB2A 5AWKA 2AX9A 3E7CA 3NOAA 5DZ0A 1EXAA 3VSOA 2QGWA 3RLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HC5 A;  3F7D A;  1T65 A;  2FAI A;  4QJR A;  5DUE A;  5IXK A;  3W0I A;  1G1U A;  1OVL B;  4JL4 A;  3V49 A;  3O1E A;  4IVY A;  3VSP A;  2G44 A;  3LMP A;  3A40 X;  3L03 A;  4J5W A;  1HG4 A;  4OZT E;  1RKH A;  1XV9 B;  1P8D A;  5FQR A;  3W5Q A;  4RUO X;  2VV4 B;  2PNU A;  5DRJ A;  4OEY A;  2O4R A;  5I4V A;  1X76 A;  1ZUC A;  2P54 A;  2ZK6 A;  3HVL A;  2AYR A;  5HYK A;  5DU5 A;  3FAL B;  5CJ6 A;  5FQS A;  4IW6 A;  3HOD A;  2YJD A;  3M7R A;  4OZT U;  1N4H A;  4IW8 A;  4PP5 A;  2GPU A;  4REF A;  4WVD A;  5DXE A;  3TY0 A;  3ET0 A;  1YP0 A;  3OLL A;  5DVC A;  1XVP B;  3VHW A;  2J7X A;  1XOW A;  3CTB A;  1NQ7 A;  1PQC A;  5DXR A;  5JJM A;  3CS4 A;  1OSV A;  3OMO A;  3AUN A;  1XQ3 A;  3ET3 A;  3K8S A;  1QKM A;  3L3Z A;  2V7C A;  3A2J A;  4YT1 A;  4OJ4 A;  5DXG A;  5JI0 D;  1PZL A;  5EGV A;  2Q5S A;  3W0A A;  4OJB A;  1P93 A;  3G8O A;  3RUU A;  3R5M A;  3R8A A;  1XB7 A;  4ZNS A;  2NV7 A;  1WM0 X;  2QAB A;  1FM9 D;  2ZMH A;  3BC5 A;  1YMT A;  3D90 A;  4MGB B;  1YOW A;  4BCR A;  4FHH A;  4KZI A;  5DKG A;  2ZY0 A;  5AYG A;  1T7F A;  3B0R A;  3VT7 A;  2G5O A;  1K74 A;  2GWX A;  4RZE A;  5DYD A;  4ZNH A;  2QZO A;  3NSP A;  5KRJ A;  4LTW A;  4RFW A;  2Q59 A;  4G1Y A;  4MDD A;  4PWL A;  1XNN A;  5EC9 A;  1ZEO A;  3E00 A;  2HFP A;  3PEQ A;  3F5C B;  4N5G A;  3OS8 C;  1R20 A;  2I0G A;  4NY9 A;  1UHL A;  2XYJ A;  3FC6 B;  2AXA A;  5G46 A;  3DZU D;  4ZNW A;  4POJ A;  4XUM A;  2Q1H A;  1ZH7 A;  4PF3 A;  5DZ1 A;  1NAV A;  1R20 D;  1XP1 A;  1Q4X A;  2ZXZ A;  3OMQ A;  5EJV A;  3RVF A;  1T7R A;  4NUF A;  3BQD A;  4OFU A;  3IXP A;  3K6P A;  1YA3 A;  4ZNT A;  4S0T A;  3B5R A;  4K4J A;  4QM0 A;  3G0W A;  4TUZ A;  5APK A;  2HWR A;  3ADX A;  4NB6 A;  4QE6 A;  2PIN A;  1NAX A;  4UDD A;  5DXB B;  5E14 A;  2H77 A;  4MGA A;  5DZ3 A;  3CQV A;  3OLF A;  3HZF A;  4FN9 A;  5KRF A;  2PIO A;  2AA2 A;  3VT5 A;  1Y0X X;  3IPQ A;  2VV1 A;  2IOK A;  4ZI1 A;  2Q70 A;  3E94 A;  2AA5 A;  3AZ1 A;  5DXP A;  5C4T A;  5KRK A;  3K22 A;  1SR7 A;  2PIV A;  4ITF A;  5C4O A;  1IE8 A;  5DV8 A;  5KYJ A;  1OVL A;  1XQC A;  2HC4 A;  2ZNN A;  5AAU A;  1RKG A;  1UOM A;  5KR9 A;  5GT4 A;  4ITE A;  5L7H A;  1YYE A;  1K4W A;  1QKU A;  1XV9 A;  3OS9 A;  3P89 A;  4MG5 A;  3AN4 A;  4OKX A;  3R8D A;  2OZ7 A;  1YOK A;  2VV4 A;  2O4J A;  3BEJ A;  1HJ1 A;  2G0G A;  4OJ9 A;  4MG7 B;  2I4Z A;  1ILG A;  2Q6S A;  3MNO A;  1GWR A;  1UHL B;  3FAL A;  4JYG A;  4OKW A;  3VT9 A;  3GWS X;  4PLD A;  1E3K A;  1XVP A;  2ZMJ A;  5E15 A;  5DSH A;  3GWX A;  3R2A A;  3R8I A;  5KCC A;  4XLD A;  2J7Y A;  3OSA A;  1K7L A;  3U9Q A;  3AFR A;  2YLO A;  2J4A A;  2XYX A;  4RZG A;  4ZNV A;  1KV6 A;  4LNX A;  1Y9R A;  3V3Q A;  2QR9 A;  2XHS A;  2F4B A;  4RE8 A;  3VRT A;  3X1H A;  3HLV A;  4E4K A;  4XT9 A;  4X1G A;  1SQN A;  1RDT A;  2VV0 A;  1YIM A;  3B3K A;  5L7G A;  1FD0 A;  1ZDT A;  4OIU A;  3VJS A;  1KKQ A;  2QGT A;  3ZQT A;  5DWJ A;  1RDT D;  4MGB A;  5G43 A;  5DWI A;  3UP3 A;  4J24 A;  1X7J A;  4DQM A;  3P0U A;  1M2Z A;  4K7A A;  4J5W C;  3X36 A;  4OKB A;  2GP7 A;  5K13 A;  1I37 A;  2YLP A;  4ZOM A;  3VT3 A;  2QMV A;  2ZNO A;  4E2J A;  2PIT A;  3HQ5 A;  3PO9 A;  5DL4 A;  3OZJ A;  2HCD A;  3F5C A;  4J5X A;  3D5F A;  2YLQ A;  1N83 A;  1PDU A;  5KRC A;  3OMK A;  1U3R A;  3KMZ A;  3FC6 A;  1YIN A;  5DI7 A;  3PCU A;  4PPP A;  2OCF A;  2YLY A;  3FS1 A;  5DMF A;  1XLS A;  2Q60 A;  2PIW A;  3V9V A;  3GN8 A;  2OVM A;  3ET1 A;  1I38 A;  4EM9 A;  3ADT A;  3WMH A;  1DKF B;  1G50 A;  1I7G A;  1XPC A;  4PPS A;  2QW4 A;  4A4W A;  5DRM A;  3JZC A;  5GID A;  5DXM A;  4ZN7 A;  4PVU A;  4G21 A;  4IS8 A;  1TXI A;  4K6I A;  5DKE A;  5DXB A;  2P4Y A;  2Z4B A;  1FM9 A;  2W8Y A;  3VRW A;  1KNU A;  3JZB A;  2Q6J A;  1XP6 A;  4WHG A;  5KCF A;  4JGV A;  2QA8 B;  3FXV A;  5IAW A;  5DUG A;  3W0C A;  3A2I A;  5E1C A;  5DYB A;  4R6S A;  1TFC A;  5KCD A;  3OAP A;  2ZXM A;  4B7W A;  1N46 A;  1S0Z A;  3EYB A;  3KBA A;  4OH5 A;  4DMA A;  4F9M A;  1YJE A;  5DLR A;  5GIE A;  2QE4 A;  2QNV A;  3TX7 B;  3DT3 A;  4RAK A;  1Z5X U;  3FUG A;  3UU7 B;  1FCZ A;  3VHV A;  2QH6 A;  2YJA B;  3VT6 A;  5KCE A;  4OZR U;  3AUQ A;  3RLL A;  5ICK A;  3FUR A;  3CDS A;  5AK2 A;  3MNE A;  3A3Z X;  5B41 A;  3DZU A;  2ZBS A;  3CWD A;  1X7R A;  5DV3 A;  3W0Y A;  3WJ4 A;  4E4Q A;  5HZC A;  4R06 A;  2ZLC A;  4MG7 A;  4DK7 A;  1M13 A;  2AA6 A;  4REE A;  4LNW A;  5DKB A;  4Q0A C;  4XHD A;  2O9I A;  4PP6 A;  5HJS A;  3ZR7 A;  2ZK0 A;  3GBK A;  1UPV A;  3KPZ A;  2Z4J A;  3L0J A;  3OSI A;  4S15 A;  5DP0 A;  4ZN9 A;  2OVH A;  4XUH A;  1NQ0 A;  5DUH A;  1LBD A;  3D24 A;  2VV3 A;  5DIE A;  2NPA A;  4ZNU A;  4XAO A;  1IE9 A;  1ZKY A;  2AA7 A;  2AX6 A;  4MG9 B;  3VRU A;  2G0H A;  1NQ2 A;  2Q6R A;  4P6X A;  1T79 A;  2QPY A;  5EIT A;  1QKN A;  2PKL A;  3B66 A;  4MG8 B;  4OED A;  5FQT A;  3UUD B;  2POG A;  1XDK B;  3P88 A;  3OS8 A;  4N1Y A;  4CI4 A;  5E0X A;  3OOF A;  3W5T A;  5G42 A;  3OSW A;  5KYA A;  3W0G A;  1T74 A;  1T76 A;  4QE8 A;  3CS6 A;  4OLM A;  4QK4 A;  5H1E A;  3VTD A;  4IVW A;  3SP9 A;  4J26 A;  1EXX A;  4R2U A;  2ZK3 A;  1S9P A;  4WQP A;  2AMB A;  3GZ9 A;  5AZT A;  1GWQ A;  3ET2 A;  3H0A D;  1SJ0 A;  5AAV B;  2ZK4 A;  4A4V A;  5DMC A;  3WT7 A;  1XNX A;  1R5K A;  4UDB A;  2YAT A;  4TV1 B;  4PRG A;  5DWE A;  2QXM A;  1ZDU A;  2A3I A;  2HAM A;  3QT0 A;  3ZRB A;  1PQ6 A;  1QKT A;  2ACL B;  3B65 A;  3FLI A;  2Q7I A;  4UDC A;  5KCW A;  5DXQ A;  5KRI A;  3VJT A;  2HAR A;  2NXX E;  1NRL A;  1Y0S A;  3AUR A;  4OZR E;  1YUC A;  1YY4 A;  1DB1 A;  1SKX A;  1A28 A;  2VST A;  3UP0 A;  1FCX A;  3IPS A;  1R6G A;  1DKF A;  1NQ1 A;  3RY9 A;  1G5Y A;  2ZLA A;  3AX8 A;  1XP9 A;  3IPU A;  3V4A A;  3GYU A;  3H52 A;  3DR1 A;  1A52 A;  3W0J A;  3Q95 B;  3AZ2 A;  5APH A;  2YFE A;  3K23 A;  3ZRA A;  2Q7L A;  3A9E B;  1MV9 A;  1H9U A;  4OGH A;  4RWV A;  5KCU A;  1BSX A;  4OIL A;  2ZNP A;  3ERD A;  3KDT A;  4IU7 A;  4OEZ A;  5DTV A;  4IV2 A;  5DWL A;  2PJL A;  3A78 A;  3R5N A;  3V3E A;  2R6W A;  2FSZ A;  2QA8 A;  2QA6 A;  2HB7 A;  2HBH A;  4FGY A;  3B1M A;  5AWJ A;  3WFG A;  1NHZ A;  2GL8 A;  3CJW A;  3B67 A;  5DY8 A;  5HCV A;  5KRH A;  3KMR A;  3KDU A;  2P15 A;  3PRG A;  5DK9 A;  2ZNQ A;  1E3G A;  3GD2 A;  4PXM A;  4G20 A;  2IOG A;  2REW A;  2B23 A;  2P1T A;  2JFA B;  3UU7 A;  5DXK A;  4OAR A;  3G9E A;  4Q13 A;  2R6Y A;  5DID A;  5LGA A;  4N73 A;  4PP3 A;  1S0X A;  1X7B A;  1XAP A;  1T7T A;  5B5B A;  4MGC A;  1FM6 D;  1L2I A;  1T5Z A;  1MZN A;  3ADS A;  3X1I A;  2P1V A;  3ERT A;  5GIC A;  2BJ4 B;  4ZJW A;  4YNK A;  1Z95 A;  3CLD A;  1GS4 A;  2B1V A;  3D57 A;  5DX3 A;  2I4J A;  1ZGY A;  2GPV A;  1PQ9 A;  4RUJ A;  2NW4 A;  2I4P A;  3ILZ A;  3VTC A;  4JYI A;  2XKW A;  1OSH A;  3S9S A;  1XJ7 A;  5E7V A;  4KZM A;  2YHD A;  3KWY A;  1PK5 A;  1R1K A;  4WPF A;  3VHU A;  5SYZ A;  3IA6 A;  4MG9 A;  3DY6 A;  3FEJ A;  1RK3 A;  3GYT A;  2Q8S A;  5ACC A;  1T7M A;  1R1K D;  1U9E A;  2J14 A;  3L1B A;  4MG6 A;  2E2R A;  2HVC A;  4MG8 A;  3OKI A;  4NQA B;  3UUD A;  3D6D A;  1XDK A;  4IA7 A;  2AM9 A;  4G2I A;  1ERR A;  3CS8 A;  2ZK2 A;  3VT4 A;  2Q5P A;  4YPQ A;  3UUA B;  4KZJ A;  3AZ3 A;  3OGT A;  1GWX A;  4DK8 A;  3A2H A;  4ZJR A;  3OMM A;  2AX8 A;  1VJB A;  5AZV A;  1XLS E;  3SP6 A;  2P7A A;  1U3Q A;  2AO6 A;  3LBD A;  5KD9 A;  2GPO A;  1S19 A;  2QSE A;  2VV2 A;  3W5R A;  5KRM A;  3WFF A;  4IWC A;  2ZK1 A;  3VRV A;  2R40 A;  3TKC A;  5AAV A;  5DV6 A;  2PIU A;  2EWP A;  3T03 A;  3P8X A;  4MGD B;  3OZ0 A;  4TV1 A;  1FBY A;  3IMY A;  4OEA A;  3UVV B;  2QXS A;  2ZFX A;  3MNP A;  2I0J A;  2OUZ A;  2R40 D;  4DM8 A;  3HM1 A;  2ACL A;  2H79 A;  4OKT A;  5HJP B;  2P7G A;  5ETH A;  4OK1 A;  5HYR A;  5JY3 A;  3RUT A;  3VT8 A;  4Y29 A;  4IV4 A;  5DX3 B;  2JF9 A;  1OT7 A;  1PRG A;  3CDP A;  2IHQ A;  3G8I A;  4X1F A;  2B50 A;  3WJ5 A;  3ADV A;  1UPW A;  2LBD A;  4RUP A;  3WT6 A;  2P1U A;  2GTK A;  3Q95 A;  3UUC A;  4M8E A;  5KRA A;  5DWG A;  3VTB A;  2PRG A;  3A9E A;  3B0T A;  3B0W A;  4IA3 A;  4WLB A;  5A86 A;  1T63 A;  2OM9 A;  2ZAS A;  4S0S A;  3L0E A;  1K74 D;  3PLZ A;  3L0L A;  4CSJ A;  3FEI A;  4ONI A;  5FQV A;  5KRO A;  2AMA A;  1RJK A;  2Q7K A;  4N8R A;  3E00 D;  4RMD A;  1FCY A;  3X31 A;  3W5P A;  3H0A A;  2GPP A;  4G1D A;  4IUI A;  4NIE A;  4QL8 A;  4XTA A;  5L7E A;  4IA1 A;  2HB8 A;  4OHA A;  3ADU A;  4FHI A;  4G2H A;  5JJM B;  3KYT A;  3W0H A;  3WWR A;  5LWP A;  3OOK A;  5DKS A;  4EMA A;  3ADW A;  4RME A;  2JFA A;  2Q3Y A;  2AWH A;  4ZO1 B;  1NYX A;  3V9T A;  4UDA A;  5DZI A;  4DM6 A;  2ZXN A;  3VN2 A;  4IQR A;  1X78 A;  2HAS A;  2B1Z A;  3L3X A;  4RZF A;  1I7I A;  1M7W A;  3IXP D;  4RMC A;  4APU A;  1X7E A;  3DCU A;  4POH A;  2ZL9 A;  5DVV A;  4OFR A;  2AX7 A;  2NXX A;  4OC7 A;  2BJ4 A;  1Z5X E;  4PLE A;  5DVS A;  4DOS A;  5FQP A;  1MVC A;  4LBD A;  2PIQ A;  3WTQ A;  4YMQ A;  1T73 A;  3VJH A;  5L11 A;  1PCG A;  1LV2 A;  2ZKC A;  3NSQ A;  2BAW A;  3N00 A;  4OH6 A;  2VSR A;  3SZ1 A;  4M8H A;  3B68 A;  3KFC A;  3VJI A;  2AAX A;  2P7Z A;  5M96 A;  2XYW A;  1XZX X;  4FNE A;  4DOR A;  2PIX A;  5C4U A;  5G5W A;  2QZO B;  4HEE X;  4L96 A;  2Q59 B;  2Q1V A;  2OAX A;  3AN3 A;  2ATH A;  4JYH A;  5AVL A;  2QTU A;  4WHF A;  5EHJ A;  1L2J A;  4XI3 A;  1NUO A;  2Q5G A;  5G3J A;  1S9Q A;  2ABI A;  2FVJ A;  3B0Q A;  3O1D A;  2ZVT A;  3VI8 A;  3WT5 A;  3UUA A;  5DZH A;  2ZMI A;  3OKH A;  3HC6 A;  3V9Y A;  5APJ A;  3HO0 A;  4HLW A;  3DZY A;  1XIU A;  2POB A;  4LSJ A;  5C4S A;  1U3S A;  2GIU A;  2PIP L;  4ZO1 X;  2HWQ A;  1FM6 A;  4L98 A;  4A2J A;  5E19 A;  3OLS A;  5F9B A;  4G1Z A;  4Q50 A;  1ERE A;  2Q61 A;  5AVI A;  5G44 A;  4TUZ B;  2JJ3 A;  2Q7J A;  4OIV A;  3DZY D;  4P6W A;  5DIG A;  4JAZ A;  3PBA A;  3R29 A;  4O8F A;  4S14 A;  1ILH A;  3OMP A;  5E0W A;  4MGD A;  5EI1 A;  4CI5 A;  4J5X C;  3UVV A;  3DCT A;  4MGA B;  2PIR A;  4IWF A;  1ZAF A;  5HJP A;  1G2N A;  2VV1 B;  1NDE A;  3KMG A;  5IZ0 A;  3TKM A;  4IA2 A;  5G45 A;  3WGP A;  5KRL A;  2ZK5 A;  2V0V A;  5KCT A;  2AB2 A;  5AWK A;  2AX9 A;  3E7C A;  3NOA A;  5DZ0 A;  1EXA A;  3VSO A;  2QGW A;  3RLJ A; 
#chains in the Genus database with same CATH topology
 3HC5 A;  3F7D A;  1T65 A;  2FAI A;  4QJR A;  5DUE A;  5IXK A;  3W0I A;  1G1U A;  1OVL B;  4JL4 A;  3V49 A;  3O1E A;  4IVY A;  3VSP A;  2G44 A;  3LMP A;  3A40 X;  3L03 A;  4J5W A;  1HG4 A;  4OZT E;  1RKH A;  1XV9 B;  1P8D A;  5FQR A;  3W5Q A;  4RUO X;  2VV4 B;  2PNU A;  5DRJ A;  4OEY A;  2O4R A;  5I4V A;  1X76 A;  1ZUC A;  2P54 A;  2ZK6 A;  3HVL A;  2AYR A;  5HYK A;  5DU5 A;  3FAL B;  5CJ6 A;  5FQS A;  4IW6 A;  3HOD A;  2YJD A;  3M7R A;  4OZT U;  1N4H A;  4IW8 A;  4PP5 A;  2GPU A;  4REF A;  4WVD A;  5DXE A;  3TY0 A;  3ET0 A;  1YP0 A;  3OLL A;  5DVC A;  1XVP B;  3VHW A;  2J7X A;  1XOW A;  3CTB A;  1NQ7 A;  1PQC A;  5DXR A;  5JJM A;  3CS4 A;  1OSV A;  3OMO A;  3AUN A;  1XQ3 A;  3ET3 A;  3K8S A;  1QKM A;  3L3Z A;  2V7C A;  3A2J A;  4YT1 A;  4OJ4 A;  5DXG A;  5JI0 D;  1PZL A;  5EGV A;  2Q5S A;  3W0A A;  4OJB A;  1P93 A;  3G8O A;  3RUU A;  3R5M A;  3R8A A;  1XB7 A;  4ZNS A;  2NV7 A;  1WM0 X;  2QAB A;  1FM9 D;  2ZMH A;  3BC5 A;  1YMT A;  3D90 A;  4MGB B;  1YOW A;  4BCR A;  4FHH A;  4KZI A;  5DKG A;  2ZY0 A;  5AYG A;  1T7F A;  3B0R A;  3VT7 A;  2G5O A;  1K74 A;  2GWX A;  4RZE A;  5DYD A;  4ZNH A;  2QZO A;  3NSP A;  5KRJ A;  4LTW A;  4RFW A;  2Q59 A;  4G1Y A;  4MDD A;  4PWL A;  1XNN A;  5EC9 A;  1ZEO A;  3E00 A;  2HFP A;  3PEQ A;  3F5C B;  4N5G A;  3OS8 C;  1R20 A;  2I0G A;  4NY9 A;  1UHL A;  2XYJ A;  3FC6 B;  2AXA A;  5G46 A;  3DZU D;  4ZNW A;  4POJ A;  4XUM A;  2Q1H A;  1ZH7 A;  4PF3 A;  5DZ1 A;  1NAV A;  1R20 D;  1XP1 A;  1Q4X A;  2ZXZ A;  3OMQ A;  5EJV A;  3RVF A;  1T7R A;  4NUF A;  3BQD A;  4OFU A;  3IXP A;  3K6P A;  1YA3 A;  4ZNT A;  4S0T A;  3B5R A;  4K4J A;  4QM0 A;  3G0W A;  4TUZ A;  5APK A;  2HWR A;  3ADX A;  4NB6 A;  4QE6 A;  2PIN A;  1NAX A;  4UDD A;  5DXB B;  5E14 A;  2H77 A;  4MGA A;  5DZ3 A;  3CQV A;  3OLF A;  3HZF A;  4FN9 A;  5KRF A;  2PIO A;  2AA2 A;  3VT5 A;  1Y0X X;  3IPQ A;  2VV1 A;  2IOK A;  4ZI1 A;  2Q70 A;  3E94 A;  2AA5 A;  3AZ1 A;  5DXP A;  5C4T A;  5KRK A;  3K22 A;  1SR7 A;  2PIV A;  4ITF A;  5C4O A;  1IE8 A;  5DV8 A;  5KYJ A;  1OVL A;  1XQC A;  2HC4 A;  2ZNN A;  5AAU A;  1RKG A;  1UOM A;  5KR9 A;  5GT4 A;  4ITE A;  5L7H A;  1YYE A;  1K4W A;  1QKU A;  1XV9 A;  3OS9 A;  3P89 A;  4MG5 A;  3AN4 A;  4OKX A;  3R8D A;  2OZ7 A;  1YOK A;  2VV4 A;  2O4J A;  3BEJ A;  1HJ1 A;  2G0G A;  4OJ9 A;  4MG7 B;  2I4Z A;  1ILG A;  2Q6S A;  3MNO A;  1GWR A;  1UHL B;  3FAL A;  4JYG A;  4OKW A;  3VT9 A;  3GWS X;  4PLD A;  1E3K A;  1XVP A;  2ZMJ A;  5E15 A;  5DSH A;  3GWX A;  3R2A A;  3R8I A;  5KCC A;  4XLD A;  2J7Y A;  3OSA A;  1K7L A;  3U9Q A;  3AFR A;  2YLO A;  2J4A A;  2XYX A;  4RZG A;  4ZNV A;  1KV6 A;  4LNX A;  1Y9R A;  3V3Q A;  2QR9 A;  2XHS A;  2F4B A;  4RE8 A;  3VRT A;  3X1H A;  3HLV A;  4E4K A;  4XT9 A;  4X1G A;  1SQN A;  1RDT A;  2VV0 A;  1YIM A;  3B3K A;  5L7G A;  1FD0 A;  1ZDT A;  4OIU A;  3VJS A;  1KKQ A;  2QGT A;  3ZQT A;  5DWJ A;  1RDT D;  4MGB A;  5G43 A;  5DWI A;  3UP3 A;  4J24 A;  1X7J A;  4DQM A;  3P0U A;  1M2Z A;  4K7A A;  4J5W C;  3X36 A;  4OKB A;  2GP7 A;  5K13 A;  1I37 A;  2YLP A;  4ZOM A;  3VT3 A;  2QMV A;  2ZNO A;  4E2J A;  2PIT A;  3HQ5 A;  3PO9 A;  5DL4 A;  3OZJ A;  2HCD A;  3F5C A;  4J5X A;  3D5F A;  2YLQ A;  1N83 A;  1PDU A;  5KRC A;  3OMK A;  1U3R A;  3KMZ A;  3FC6 A;  1YIN A;  5DI7 A;  3PCU A;  4PPP A;  2OCF A;  2YLY A;  3FS1 A;  5DMF A;  1XLS A;  2Q60 A;  2PIW A;  3V9V A;  3GN8 A;  2OVM A;  3ET1 A;  1I38 A;  4EM9 A;  3ADT A;  3WMH A;  1DKF B;  1G50 A;  1I7G A;  1XPC A;  4PPS A;  2QW4 A;  4A4W A;  5DRM A;  3JZC A;  5GID A;  5DXM A;  4ZN7 A;  4PVU A;  4G21 A;  4IS8 A;  1TXI A;  4K6I A;  5DKE A;  5DXB A;  2P4Y A;  2Z4B A;  1FM9 A;  2W8Y A;  3VRW A;  1KNU A;  3JZB A;  2Q6J A;  1XP6 A;  4WHG A;  5KCF A;  4JGV A;  2QA8 B;  3FXV A;  5IAW A;  5DUG A;  3W0C A;  3A2I A;  5E1C A;  5DYB A;  4R6S A;  1TFC A;  5KCD A;  3OAP A;  2ZXM A;  4B7W A;  1N46 A;  1S0Z A;  3EYB A;  3KBA A;  4OH5 A;  4DMA A;  4F9M A;  1YJE A;  5DLR A;  5GIE A;  2QE4 A;  2QNV A;  3TX7 B;  3DT3 A;  4RAK A;  1Z5X U;  3FUG A;  3UU7 B;  1FCZ A;  3VHV A;  2QH6 A;  2YJA B;  3VT6 A;  5KCE A;  4OZR U;  3AUQ A;  3RLL A;  5ICK A;  3FUR A;  3CDS A;  5AK2 A;  3MNE A;  3A3Z X;  5B41 A;  3DZU A;  2ZBS A;  3CWD A;  1X7R A;  5DV3 A;  3W0Y A;  3WJ4 A;  4E4Q A;  5HZC A;  4R06 A;  2ZLC A;  4MG7 A;  4DK7 A;  1M13 A;  2AA6 A;  4REE A;  4LNW A;  5DKB A;  4Q0A C;  4XHD A;  2O9I A;  4PP6 A;  5HJS A;  3ZR7 A;  2ZK0 A;  3GBK A;  1UPV A;  3KPZ A;  2Z4J A;  3L0J A;  3OSI A;  4S15 A;  5DP0 A;  4ZN9 A;  2OVH A;  4XUH A;  1NQ0 A;  5DUH A;  1LBD A;  3D24 A;  2VV3 A;  5DIE A;  2NPA A;  4ZNU A;  4XAO A;  1IE9 A;  1ZKY A;  2AA7 A;  2AX6 A;  4MG9 B;  3VRU A;  2G0H A;  1NQ2 A;  2Q6R A;  4P6X A;  1T79 A;  2QPY A;  5EIT A;  1QKN A;  2PKL A;  3B66 A;  4MG8 B;  4OED A;  5FQT A;  3UUD B;  2POG A;  1XDK B;  3P88 A;  3OS8 A;  4N1Y A;  4CI4 A;  5E0X A;  3OOF A;  3W5T A;  5G42 A;  3OSW A;  5KYA A;  3W0G A;  1T74 A;  1T76 A;  4QE8 A;  3CS6 A;  4OLM A;  4QK4 A;  5H1E A;  3VTD A;  4IVW A;  3SP9 A;  4J26 A;  1EXX A;  4R2U A;  2ZK3 A;  1S9P A;  4WQP A;  2AMB A;  3GZ9 A;  5AZT A;  1GWQ A;  3ET2 A;  3H0A D;  1SJ0 A;  5AAV B;  2ZK4 A;  4A4V A;  5DMC A;  3WT7 A;  1XNX A;  1R5K A;  4UDB A;  2YAT A;  4TV1 B;  4PRG A;  5DWE A;  2QXM A;  1ZDU A;  2A3I A;  2HAM A;  3QT0 A;  3ZRB A;  1PQ6 A;  1QKT A;  2ACL B;  3B65 A;  3FLI A;  2Q7I A;  4UDC A;  5KCW A;  5DXQ A;  5KRI A;  3VJT A;  2HAR A;  2NXX E;  1NRL A;  1Y0S A;  3AUR A;  4OZR E;  1YUC A;  1YY4 A;  1DB1 A;  1SKX A;  1A28 A;  2VST A;  3UP0 A;  1FCX A;  3IPS A;  1R6G A;  1DKF A;  1NQ1 A;  3RY9 A;  1G5Y A;  2ZLA A;  3AX8 A;  1XP9 A;  3IPU A;  3V4A A;  3GYU A;  3H52 A;  3DR1 A;  1A52 A;  3W0J A;  3Q95 B;  3AZ2 A;  5APH A;  2YFE A;  3K23 A;  3ZRA A;  2Q7L A;  3A9E B;  1MV9 A;  1H9U A;  4OGH A;  4RWV A;  5KCU A;  1BSX A;  4OIL A;  2ZNP A;  3ERD A;  3KDT A;  4IU7 A;  4OEZ A;  5DTV A;  4IV2 A;  5DWL A;  2PJL A;  3A78 A;  3R5N A;  3V3E A;  2R6W A;  2FSZ A;  2QA8 A;  2QA6 A;  2HB7 A;  2HBH A;  4FGY A;  3B1M A;  5AWJ A;  3WFG A;  1NHZ A;  2GL8 A;  3CJW A;  3B67 A;  5DY8 A;  5HCV A;  5KRH A;  3KMR A;  3KDU A;  2P15 A;  3PRG A;  5DK9 A;  2ZNQ A;  1E3G A;  3GD2 A;  4PXM A;  4G20 A;  2IOG A;  2REW A;  2B23 A;  2P1T A;  2JFA B;  3UU7 A;  5DXK A;  4OAR A;  3G9E A;  4Q13 A;  2R6Y A;  5DID A;  5LGA A;  4N73 A;  4PP3 A;  1S0X A;  1X7B A;  1XAP A;  1T7T A;  5B5B A;  4MGC A;  1FM6 D;  1L2I A;  1T5Z A;  1MZN A;  3ADS A;  3X1I A;  2P1V A;  3ERT A;  5GIC A;  2BJ4 B;  4ZJW A;  4YNK A;  1Z95 A;  3CLD A;  1GS4 A;  2B1V A;  3D57 A;  5DX3 A;  2I4J A;  1ZGY A;  2GPV A;  1PQ9 A;  4RUJ A;  2NW4 A;  2I4P A;  3ILZ A;  3VTC A;  4JYI A;  2XKW A;  1OSH A;  3S9S A;  1XJ7 A;  5E7V A;  4KZM A;  2YHD A;  3KWY A;  1PK5 A;  1R1K A;  4WPF A;  3VHU A;  5SYZ A;  3IA6 A;  4MG9 A;  3DY6 A;  3FEJ A;  1RK3 A;  3GYT A;  2Q8S A;  5ACC A;  1T7M A;  1R1K D;  1U9E A;  2J14 A;  3L1B A;  4MG6 A;  2E2R A;  2HVC A;  4MG8 A;  3OKI A;  4NQA B;  3UUD A;  3D6D A;  1XDK A;  4IA7 A;  2AM9 A;  4G2I A;  1ERR A;  3CS8 A;  2ZK2 A;  3VT4 A;  2Q5P A;  4YPQ A;  3UUA B;  4KZJ A;  3AZ3 A;  3OGT A;  1GWX A;  4DK8 A;  3A2H A;  4ZJR A;  3OMM A;  2AX8 A;  1VJB A;  5AZV A;  1XLS E;  3SP6 A;  2P7A A;  1U3Q A;  2AO6 A;  3LBD A;  5KD9 A;  2GPO A;  1S19 A;  2QSE A;  2VV2 A;  3W5R A;  5KRM A;  3WFF A;  4IWC A;  2ZK1 A;  3VRV A;  2R40 A;  3TKC A;  5AAV A;  5DV6 A;  2PIU A;  2EWP A;  3T03 A;  3P8X A;  4MGD B;  3OZ0 A;  4TV1 A;  1FBY A;  3IMY A;  4OEA A;  3UVV B;  2QXS A;  2ZFX A;  3MNP A;  2I0J A;  2OUZ A;  2R40 D;  4DM8 A;  3HM1 A;  2ACL A;  2H79 A;  4OKT A;  5HJP B;  2P7G A;  5ETH A;  4OK1 A;  5HYR A;  5JY3 A;  3RUT A;  3VT8 A;  4Y29 A;  4IV4 A;  5DX3 B;  2JF9 A;  1OT7 A;  1PRG A;  3CDP A;  2IHQ A;  3G8I A;  4X1F A;  2B50 A;  3WJ5 A;  3ADV A;  1UPW A;  2LBD A;  4RUP A;  3WT6 A;  2P1U A;  2GTK A;  3Q95 A;  3UUC A;  4M8E A;  5KRA A;  5DWG A;  3VTB A;  2PRG A;  3A9E A;  3B0T A;  3B0W A;  4IA3 A;  4WLB A;  5A86 A;  1T63 A;  2OM9 A;  2ZAS A;  4S0S A;  3L0E A;  1K74 D;  3PLZ A;  3L0L A;  4CSJ A;  3FEI A;  4ONI A;  5FQV A;  5KRO A;  2AMA A;  1RJK A;  2Q7K A;  4N8R A;  3E00 D;  4RMD A;  1FCY A;  3X31 A;  3W5P A;  3H0A A;  2GPP A;  4G1D A;  4IUI A;  4NIE A;  4QL8 A;  4XTA A;  5L7E A;  4IA1 A;  2HB8 A;  4OHA A;  3ADU A;  4FHI A;  4G2H A;  5JJM B;  3KYT A;  3W0H A;  3WWR A;  5LWP A;  3OOK A;  5DKS A;  4EMA A;  3ADW A;  4RME A;  2JFA A;  2Q3Y A;  2AWH A;  4ZO1 B;  1NYX A;  3V9T A;  4UDA A;  5DZI A;  4DM6 A;  2ZXN A;  3VN2 A;  4IQR A;  1X78 A;  2HAS A;  2B1Z A;  3L3X A;  4RZF A;  1I7I A;  1M7W A;  3IXP D;  4RMC A;  4APU A;  1X7E A;  3DCU A;  4POH A;  2ZL9 A;  5DVV A;  4OFR A;  2AX7 A;  2NXX A;  4OC7 A;  2BJ4 A;  1Z5X E;  4PLE A;  5DVS A;  4DOS A;  5FQP A;  1MVC A;  4LBD A;  2PIQ A;  3WTQ A;  4YMQ A;  1T73 A;  3VJH A;  5L11 A;  1PCG A;  1LV2 A;  2ZKC A;  3NSQ A;  2BAW A;  3N00 A;  4OH6 A;  2VSR A;  3SZ1 A;  4M8H A;  3B68 A;  3KFC A;  3VJI A;  2AAX A;  2P7Z A;  5M96 A;  2XYW A;  1XZX X;  4FNE A;  4DOR A;  2PIX A;  5C4U A;  5G5W A;  2QZO B;  4HEE X;  4L96 A;  2Q59 B;  2Q1V A;  2OAX A;  3AN3 A;  2ATH A;  4JYH A;  5AVL A;  2QTU A;  4WHF A;  5EHJ A;  1L2J A;  4XI3 A;  1NUO A;  2Q5G A;  5G3J A;  1S9Q A;  2ABI A;  2FVJ A;  3B0Q A;  3O1D A;  2ZVT A;  3VI8 A;  3WT5 A;  3UUA A;  5DZH A;  2ZMI A;  3OKH A;  3HC6 A;  3V9Y A;  5APJ A;  3HO0 A;  4HLW A;  3DZY A;  1XIU A;  2POB A;  4LSJ A;  5C4S A;  1U3S A;  2GIU A;  2PIP L;  4ZO1 X;  2HWQ A;  1FM6 A;  4L98 A;  4A2J A;  5E19 A;  3OLS A;  5F9B A;  4G1Z A;  4Q50 A;  1ERE A;  2Q61 A;  5AVI A;  5G44 A;  4TUZ B;  2JJ3 A;  2Q7J A;  4OIV A;  3DZY D;  4P6W A;  5DIG A;  4JAZ A;  3PBA A;  3R29 A;  4O8F A;  4S14 A;  1ILH A;  3OMP A;  5E0W A;  4MGD A;  5EI1 A;  4CI5 A;  4J5X C;  3UVV A;  3DCT A;  4MGA B;  2PIR A;  4IWF A;  1ZAF A;  5HJP A;  1G2N A;  2VV1 B;  1NDE A;  3KMG A;  5IZ0 A;  3TKM A;  4IA2 A;  5G45 A;  3WGP A;  5KRL A;  2ZK5 A;  2V0V A;  5KCT A;  2AB2 A;  5AWK A;  2AX9 A;  3E7C A;  3NOA A;  5DZ0 A;  1EXA A;  3VSO A;  2QGW A;  3RLJ A; 
#chains in the Genus database with same CATH homology
 3HC5 A;  3F7D A;  1T65 A;  2FAI A;  4QJR A;  5DUE A;  5IXK A;  3W0I A;  1G1U A;  1OVL B;  4JL4 A;  3V49 A;  3O1E A;  4IVY A;  3VSP A;  2G44 A;  3LMP A;  3A40 X;  3L03 A;  4J5W A;  1HG4 A;  4OZT E;  1RKH A;  1XV9 B;  1P8D A;  5FQR A;  3W5Q A;  4RUO X;  2VV4 B;  2PNU A;  5DRJ A;  4OEY A;  2O4R A;  5I4V A;  1X76 A;  1ZUC A;  2P54 A;  2ZK6 A;  3HVL A;  2AYR A;  5HYK A;  5DU5 A;  3FAL B;  5CJ6 A;  5FQS A;  4IW6 A;  3HOD A;  2YJD A;  3M7R A;  4OZT U;  1N4H A;  4IW8 A;  4PP5 A;  2GPU A;  4REF A;  4WVD A;  5DXE A;  3TY0 A;  3ET0 A;  1YP0 A;  3OLL A;  5DVC A;  1XVP B;  3VHW A;  2J7X A;  1XOW A;  3CTB A;  1NQ7 A;  1PQC A;  5DXR A;  5JJM A;  3CS4 A;  1OSV A;  3OMO A;  3AUN A;  1XQ3 A;  3ET3 A;  3K8S A;  1QKM A;  3L3Z A;  2V7C A;  3A2J A;  4YT1 A;  4OJ4 A;  5DXG A;  5JI0 D;  1PZL A;  5EGV A;  2Q5S A;  3W0A A;  4OJB A;  1P93 A;  3G8O A;  3RUU A;  3R5M A;  3R8A A;  1XB7 A;  4ZNS A;  2NV7 A;  1WM0 X;  2QAB A;  1FM9 D;  2ZMH A;  3BC5 A;  1YMT A;  3D90 A;  4MGB B;  1YOW A;  4BCR A;  4FHH A;  4KZI A;  5DKG A;  2ZY0 A;  5AYG A;  1T7F A;  3B0R A;  3VT7 A;  2G5O A;  1K74 A;  2GWX A;  4RZE A;  5DYD A;  4ZNH A;  2QZO A;  3NSP A;  5KRJ A;  4LTW A;  4RFW A;  2Q59 A;  4G1Y A;  4MDD A;  4PWL A;  1XNN A;  5EC9 A;  1ZEO A;  3E00 A;  2HFP A;  3PEQ A;  3F5C B;  4N5G A;  3OS8 C;  1R20 A;  2I0G A;  4NY9 A;  1UHL A;  2XYJ A;  3FC6 B;  2AXA A;  5G46 A;  3DZU D;  4ZNW A;  4POJ A;  4XUM A;  2Q1H A;  1ZH7 A;  4PF3 A;  5DZ1 A;  1NAV A;  1R20 D;  1XP1 A;  1Q4X A;  2ZXZ A;  3OMQ A;  5EJV A;  3RVF A;  1T7R A;  4NUF A;  3BQD A;  4OFU A;  3IXP A;  3K6P A;  1YA3 A;  4ZNT A;  4S0T A;  3B5R A;  4K4J A;  4QM0 A;  3G0W A;  4TUZ A;  5APK A;  2HWR A;  3ADX A;  4NB6 A;  4QE6 A;  2PIN A;  1NAX A;  4UDD A;  5DXB B;  5E14 A;  2H77 A;  4MGA A;  5DZ3 A;  3CQV A;  3OLF A;  3HZF A;  4FN9 A;  5KRF A;  2PIO A;  2AA2 A;  3VT5 A;  1Y0X X;  3IPQ A;  2VV1 A;  2IOK A;  4ZI1 A;  2Q70 A;  3E94 A;  2AA5 A;  3AZ1 A;  5DXP A;  5C4T A;  5KRK A;  3K22 A;  1SR7 A;  2PIV A;  4ITF A;  5C4O A;  1IE8 A;  5DV8 A;  5KYJ A;  1OVL A;  1XQC A;  2HC4 A;  2ZNN A;  5AAU A;  1RKG A;  1UOM A;  5KR9 A;  5GT4 A;  4ITE A;  5L7H A;  1YYE A;  1K4W A;  1QKU A;  1XV9 A;  3OS9 A;  3P89 A;  4MG5 A;  3AN4 A;  4OKX A;  3R8D A;  2OZ7 A;  1YOK A;  2VV4 A;  2O4J A;  3BEJ A;  1HJ1 A;  2G0G A;  4OJ9 A;  4MG7 B;  2I4Z A;  1ILG A;  2Q6S A;  3MNO A;  1GWR A;  1UHL B;  3FAL A;  4JYG A;  4OKW A;  3VT9 A;  3GWS X;  4PLD A;  1E3K A;  1XVP A;  2ZMJ A;  5E15 A;  5DSH A;  3GWX A;  3R2A A;  3R8I A;  5KCC A;  4XLD A;  2J7Y A;  3OSA A;  1K7L A;  3U9Q A;  3AFR A;  2YLO A;  2J4A A;  2XYX A;  4RZG A;  4ZNV A;  1KV6 A;  4LNX A;  1Y9R A;  3V3Q A;  2QR9 A;  2XHS A;  2F4B A;  4RE8 A;  3VRT A;  3X1H A;  3HLV A;  4E4K A;  4XT9 A;  4X1G A;  1SQN A;  1RDT A;  2VV0 A;  1YIM A;  3B3K A;  5L7G A;  1FD0 A;  1ZDT A;  4OIU A;  3VJS A;  1KKQ A;  2QGT A;  3ZQT A;  5DWJ A;  1RDT D;  4MGB A;  5G43 A;  5DWI A;  3UP3 A;  4J24 A;  1X7J A;  4DQM A;  3P0U A;  1M2Z A;  4K7A A;  4J5W C;  3X36 A;  4OKB A;  2GP7 A;  5K13 A;  1I37 A;  2YLP A;  4ZOM A;  3VT3 A;  2QMV A;  2ZNO A;  4E2J A;  2PIT A;  3HQ5 A;  3PO9 A;  5DL4 A;  3OZJ A;  2HCD A;  3F5C A;  4J5X A;  3D5F A;  2YLQ A;  1N83 A;  1PDU A;  5KRC A;  3OMK A;  1U3R A;  3KMZ A;  3FC6 A;  1YIN A;  5DI7 A;  3PCU A;  4PPP A;  2OCF A;  2YLY A;  3FS1 A;  5DMF A;  1XLS A;  2Q60 A;  2PIW A;  3V9V A;  3GN8 A;  2OVM A;  3ET1 A;  1I38 A;  4EM9 A;  3ADT A;  3WMH A;  1DKF B;  1G50 A;  1I7G A;  1XPC A;  4PPS A;  2QW4 A;  4A4W A;  5DRM A;  3JZC A;  5GID A;  5DXM A;  4ZN7 A;  4PVU A;  4G21 A;  4IS8 A;  1TXI A;  4K6I A;  5DKE A;  5DXB A;  2P4Y A;  2Z4B A;  1FM9 A;  2W8Y A;  3VRW A;  1KNU A;  3JZB A;  2Q6J A;  1XP6 A;  4WHG A;  5KCF A;  4JGV A;  2QA8 B;  3FXV A;  5IAW A;  5DUG A;  3W0C A;  3A2I A;  5E1C A;  5DYB A;  4R6S A;  1TFC A;  5KCD A;  3OAP A;  2ZXM A;  4B7W A;  1N46 A;  1S0Z A;  3EYB A;  3KBA A;  4OH5 A;  4DMA A;  4F9M A;  1YJE A;  5DLR A;  5GIE A;  2QE4 A;  2QNV A;  3TX7 B;  3DT3 A;  4RAK A;  1Z5X U;  3FUG A;  3UU7 B;  1FCZ A;  3VHV A;  2QH6 A;  2YJA B;  3VT6 A;  5KCE A;  4OZR U;  3AUQ A;  3RLL A;  5ICK A;  3FUR A;  3CDS A;  5AK2 A;  3MNE A;  3A3Z X;  5B41 A;  3DZU A;  2ZBS A;  3CWD A;  1X7R A;  5DV3 A;  3W0Y A;  3WJ4 A;  4E4Q A;  5HZC A;  4R06 A;  2ZLC A;  4MG7 A;  4DK7 A;  1M13 A;  2AA6 A;  4REE A;  4LNW A;  5DKB A;  4Q0A C;  4XHD A;  2O9I A;  4PP6 A;  5HJS A;  3ZR7 A;  2ZK0 A;  3GBK A;  1UPV A;  3KPZ A;  2Z4J A;  3L0J A;  3OSI A;  4S15 A;  5DP0 A;  4ZN9 A;  2OVH A;  4XUH A;  1NQ0 A;  5DUH A;  1LBD A;  3D24 A;  2VV3 A;  5DIE A;  2NPA A;  4ZNU A;  4XAO A;  1IE9 A;  1ZKY A;  2AA7 A;  2AX6 A;  4MG9 B;  3VRU A;  2G0H A;  1NQ2 A;  2Q6R A;  4P6X A;  1T79 A;  2QPY A;  5EIT A;  1QKN A;  2PKL A;  3B66 A;  4MG8 B;  4OED A;  5FQT A;  3UUD B;  2POG A;  1XDK B;  3P88 A;  3OS8 A;  4N1Y A;  4CI4 A;  5E0X A;  3OOF A;  3W5T A;  5G42 A;  3OSW A;  5KYA A;  3W0G A;  1T74 A;  1T76 A;  4QE8 A;  3CS6 A;  4OLM A;  4QK4 A;  5H1E A;  3VTD A;  4IVW A;  3SP9 A;  4J26 A;  1EXX A;  4R2U A;  2ZK3 A;  1S9P A;  4WQP A;  2AMB A;  3GZ9 A;  5AZT A;  1GWQ A;  3ET2 A;  3H0A D;  1SJ0 A;  5AAV B;  2ZK4 A;  4A4V A;  5DMC A;  3WT7 A;  1XNX A;  1R5K A;  4UDB A;  2YAT A;  4TV1 B;  4PRG A;  5DWE A;  2QXM A;  1ZDU A;  2A3I A;  2HAM A;  3QT0 A;  3ZRB A;  1PQ6 A;  1QKT A;  2ACL B;  3B65 A;  3FLI A;  2Q7I A;  4UDC A;  5KCW A;  5DXQ A;  5KRI A;  3VJT A;  2HAR A;  2NXX E;  1NRL A;  1Y0S A;  3AUR A;  4OZR E;  1YUC A;  1YY4 A;  1DB1 A;  1SKX A;  1A28 A;  2VST A;  3UP0 A;  1FCX A;  3IPS A;  1R6G A;  1DKF A;  1NQ1 A;  3RY9 A;  1G5Y A;  2ZLA A;  3AX8 A;  1XP9 A;  3IPU A;  3V4A A;  3GYU A;  3H52 A;  3DR1 A;  1A52 A;  3W0J A;  3Q95 B;  3AZ2 A;  5APH A;  2YFE A;  3K23 A;  3ZRA A;  2Q7L A;  3A9E B;  1MV9 A;  1H9U A;  4OGH A;  4RWV A;  5KCU A;  1BSX A;  4OIL A;  2ZNP A;  3ERD A;  3KDT A;  4IU7 A;  4OEZ A;  5DTV A;  4IV2 A;  5DWL A;  2PJL A;  3A78 A;  3R5N A;  3V3E A;  2R6W A;  2FSZ A;  2QA8 A;  2QA6 A;  2HB7 A;  2HBH A;  4FGY A;  3B1M A;  5AWJ A;  3WFG A;  1NHZ A;  2GL8 A;  3CJW A;  3B67 A;  5DY8 A;  5HCV A;  5KRH A;  3KMR A;  3KDU A;  2P15 A;  3PRG A;  5DK9 A;  2ZNQ A;  1E3G A;  3GD2 A;  4PXM A;  4G20 A;  2IOG A;  2REW A;  2B23 A;  2P1T A;  2JFA B;  3UU7 A;  5DXK A;  4OAR A;  3G9E A;  4Q13 A;  2R6Y A;  5DID A;  5LGA A;  4N73 A;  4PP3 A;  1S0X A;  1X7B A;  1XAP A;  1T7T A;  5B5B A;  4MGC A;  1FM6 D;  1L2I A;  1T5Z A;  1MZN A;  3ADS A;  3X1I A;  2P1V A;  3ERT A;  5GIC A;  2BJ4 B;  4ZJW A;  4YNK A;  1Z95 A;  3CLD A;  1GS4 A;  2B1V A;  3D57 A;  5DX3 A;  2I4J A;  1ZGY A;  2GPV A;  1PQ9 A;  4RUJ A;  2NW4 A;  2I4P A;  3ILZ A;  3VTC A;  4JYI A;  2XKW A;  1OSH A;  3S9S A;  1XJ7 A;  5E7V A;  4KZM A;  2YHD A;  3KWY A;  1PK5 A;  1R1K A;  4WPF A;  3VHU A;  5SYZ A;  3IA6 A;  4MG9 A;  3DY6 A;  3FEJ A;  1RK3 A;  3GYT A;  2Q8S A;  5ACC A;  1T7M A;  1R1K D;  1U9E A;  2J14 A;  3L1B A;  4MG6 A;  2E2R A;  2HVC A;  4MG8 A;  3OKI A;  4NQA B;  3UUD A;  3D6D A;  1XDK A;  4IA7 A;  2AM9 A;  4G2I A;  1ERR A;  3CS8 A;  2ZK2 A;  3VT4 A;  2Q5P A;  4YPQ A;  3UUA B;  4KZJ A;  3AZ3 A;  3OGT A;  1GWX A;  4DK8 A;  3A2H A;  4ZJR A;  3OMM A;  2AX8 A;  1VJB A;  5AZV A;  1XLS E;  3SP6 A;  2P7A A;  1U3Q A;  2AO6 A;  3LBD A;  5KD9 A;  2GPO A;  1S19 A;  2QSE A;  2VV2 A;  3W5R A;  5KRM A;  3WFF A;  4IWC A;  2ZK1 A;  3VRV A;  2R40 A;  3TKC A;  5AAV A;  5DV6 A;  2PIU A;  2EWP A;  3T03 A;  3P8X A;  4MGD B;  3OZ0 A;  4TV1 A;  1FBY A;  3IMY A;  4OEA A;  3UVV B;  2QXS A;  2ZFX A;  3MNP A;  2I0J A;  2OUZ A;  2R40 D;  4DM8 A;  3HM1 A;  2ACL A;  2H79 A;  4OKT A;  5HJP B;  2P7G A;  5ETH A;  4OK1 A;  5HYR A;  5JY3 A;  3RUT A;  3VT8 A;  4Y29 A;  4IV4 A;  5DX3 B;  2JF9 A;  1OT7 A;  1PRG A;  3CDP A;  2IHQ A;  3G8I A;  4X1F A;  2B50 A;  3WJ5 A;  3ADV A;  1UPW A;  2LBD A;  4RUP A;  3WT6 A;  2P1U A;  2GTK A;  3Q95 A;  3UUC A;  4M8E A;  5KRA A;  5DWG A;  3VTB A;  2PRG A;  3A9E A;  3B0T A;  3B0W A;  4IA3 A;  4WLB A;  5A86 A;  1T63 A;  2OM9 A;  2ZAS A;  4S0S A;  3L0E A;  1K74 D;  3PLZ A;  3L0L A;  4CSJ A;  3FEI A;  4ONI A;  5FQV A;  5KRO A;  2AMA A;  1RJK A;  2Q7K A;  4N8R A;  3E00 D;  4RMD A;  1FCY A;  3X31 A;  3W5P A;  3H0A A;  2GPP A;  4G1D A;  4IUI A;  4NIE A;  4QL8 A;  4XTA A;  5L7E A;  4IA1 A;  2HB8 A;  4OHA A;  3ADU A;  4FHI A;  4G2H A;  5JJM B;  3KYT A;  3W0H A;  3WWR A;  5LWP A;  3OOK A;  5DKS A;  4EMA A;  3ADW A;  4RME A;  2JFA A;  2Q3Y A;  2AWH A;  4ZO1 B;  1NYX A;  3V9T A;  4UDA A;  5DZI A;  4DM6 A;  2ZXN A;  3VN2 A;  4IQR A;  1X78 A;  2HAS A;  2B1Z A;  3L3X A;  4RZF A;  1I7I A;  1M7W A;  3IXP D;  4RMC A;  4APU A;  1X7E A;  3DCU A;  4POH A;  2ZL9 A;  5DVV A;  4OFR A;  2AX7 A;  2NXX A;  4OC7 A;  2BJ4 A;  1Z5X E;  4PLE A;  5DVS A;  4DOS A;  5FQP A;  1MVC A;  4LBD A;  2PIQ A;  3WTQ A;  4YMQ A;  1T73 A;  3VJH A;  5L11 A;  1PCG A;  1LV2 A;  2ZKC A;  3NSQ A;  2BAW A;  3N00 A;  4OH6 A;  2VSR A;  3SZ1 A;  4M8H A;  3B68 A;  3KFC A;  3VJI A;  2AAX A;  2P7Z A;  5M96 A;  2XYW A;  1XZX X;  4FNE A;  4DOR A;  2PIX A;  5C4U A;  5G5W A;  2QZO B;  4HEE X;  4L96 A;  2Q59 B;  2Q1V A;  2OAX A;  3AN3 A;  2ATH A;  4JYH A;  5AVL A;  2QTU A;  4WHF A;  5EHJ A;  1L2J A;  4XI3 A;  1NUO A;  2Q5G A;  5G3J A;  1S9Q A;  2ABI A;  2FVJ A;  3B0Q A;  3O1D A;  2ZVT A;  3VI8 A;  3WT5 A;  3UUA A;  5DZH A;  2ZMI A;  3OKH A;  3HC6 A;  3V9Y A;  5APJ A;  3HO0 A;  4HLW A;  3DZY A;  1XIU A;  2POB A;  4LSJ A;  5C4S A;  1U3S A;  2GIU A;  2PIP L;  4ZO1 X;  2HWQ A;  1FM6 A;  4L98 A;  4A2J A;  5E19 A;  3OLS A;  5F9B A;  4G1Z A;  4Q50 A;  1ERE A;  2Q61 A;  5AVI A;  5G44 A;  4TUZ B;  2JJ3 A;  2Q7J A;  4OIV A;  3DZY D;  4P6W A;  5DIG A;  4JAZ A;  3PBA A;  3R29 A;  4O8F A;  4S14 A;  1ILH A;  3OMP A;  5E0W A;  4MGD A;  5EI1 A;  4CI5 A;  4J5X C;  3UVV A;  3DCT A;  4MGA B;  2PIR A;  4IWF A;  1ZAF A;  5HJP A;  1G2N A;  2VV1 B;  1NDE A;  3KMG A;  5IZ0 A;  3TKM A;  4IA2 A;  5G45 A;  3WGP A;  5KRL A;  2ZK5 A;  2V0V A;  5KCT A;  2AB2 A;  5AWK A;  2AX9 A;  3E7C A;  3NOA A;  5DZ0 A;  1EXA A;  3VSO A;  2QGW A;  3RLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...