3D6DA

Crystal structure of the complex between ppargamma lbd and the lt175(r-enantiomer)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
270
structure length
270
Chain Sequence
ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Peroxisome Proliferator-Activated Receptor gamma (PPARgamma) Ligand Binding Domain Complexed with a Novel Partial Agonist: A New Region of the Hydrophobic Pocket Could Be Exploited for Drug Design
pubmed doi rcsb
molecule keywords Peroxisome proliferator-activated receptor gamma
molecule tags Transcription
source organism Homo sapiens
total genus 100
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3d6dA00
5G43A 5DXGA 4TV1B 5EC9A 1XQ3A 4MGAA 2R40A 4DK8A 2P1UA 2ZK3A 3CLDA 4LNWA 1YY4A 5JJMB 4R06A 3FS1A 4OGHA 2AA5A 3HVLA 2Q61A 3D57A 4FHHA 3W5TA 5KCTA 5I4VA 5AZTA 3OSWA 1XPCA 2P4YA 2Q5SA 5AAVA 4TUZB 5KCWA 3AZ3A 2ZK2A 3IXPD 1IE9A 2AMAA 1YJEA 5APKA 1EXXA 4Q50A 5DXEA 4OKXA 3W0IA 3V9YA 2P54A 1U3QA 1M13A 1K7LA 4HLWA 3TKMA 2HARA 3HC6A 5E0WA 3IMYA 1MV9A 2YJDA 3P88A 2QSEA 4OJBA 3V4AA 1T63A 1RKGA 4ITEA 5LGAA 3OOFA 5KRCA 3B1MA 1ZAFA 5DLRA 1XP1A 3R2AA 2AX9A 3UU7B 3A2IA 1HJ1A 4J5XC 3AN4A 2OVMA 5G45A 3OMPA 1I38A 3B65A 2Z4JA 3A9EB 4MG7B 4FGYA 4Q0AC 3AX8A 3KFCA 4LSJA 2GTKA 3FC6B 4WHGA 3WTQA 3DT3A 2YLOA 3WJ5A 4JYHA 3ERTA 4S0SA 3G9EA 4K6IA 4RMDA 2ZNOA 3KDTA 2Q6SA 3X31A 3S9SA 2J4AA 3A40X 4ZNSA 3V9VA 5HZCA 1G2NA 2AB2A 3B0QA 3GD2A 3R29A 4L96A 1NDEA 2GP7A 3RUTA 3B0WA 1UPWA 1XB7A 3VHWA 3WT6A 5KROA 4PF3A 3IXPA 1ZKYA 3JZBA 2VSRA 1XOWA 4XT9A 5C4UA 5AYGA 4OC7A 5DKEA 3VJTA 1R5KA 1Z95A 1XLSE 1OVLB 1YA3A 1U3SA 3L3ZA 4REFA 4ZOMA 4MG8B 1FM9A 4IA7A 3FUGA 5DZ0A 2ACLA 4ZO1B 1FCZA 4RZFA 3Q95A 5DUGA 2ZVTA 5DVVA 5KYJA 4RZEA 2AX7A 2Z4BA 4MGBA 2Q1VA 4OEDA 3L0LA 1XJ7A 4J24A 3DCUA 5E14A 1NQ7A 3H0AD 4NUFA 4XUMA 1FCXA 5IXKA 4ZNWA 4ZNUA 1XVPA 3TX7B 4POJA 3D90A 3QT0A 5DX3A 3OS9A 3F5CB 2FAIA 1QKMA 3L0EA 5KYAA 1XP6A 3HO0A 2ZXNA 2JFAA 2OUZA 2OAXA 5DXMA 1ILHA 3KMGA 4QK4A 2Q7JA 2HFPA 1PCGA 3B0RA 3AUQA 4ZI1A 5HYRA 3A2JA 5EGVA 2ATHA 1XP9A 5L11A 2QA8A 5AVIA 3L1BA 4OZRU 3G8IA 4G1DA 2AM9A 2ZASA 1GWXA 1XV9A 2HB8A 1I7GA 1E3GA 3GBKA 5GIDA 1XDKA 3HZFA 3OLLA 5AAUA 5DUEA 5FQTA 3T03A 4J5XA 4RUPA 3V3QA 1XZXX 2NXXE 2O9IA 3ADSA 3D6DA 3VT6A 4OH6A 2QGTA 2QMVA 2YFEA 3VTCA 2POGA 4REEA 1PQ9A 3B66A 5DU5A 1NYXA 5KRFA 2ZKCA 1EXAA 4N8RA 5G5WA 3UVVA 3VJIA 4DOSA 2HB7A 3IA6A 5ETHA 3DZUD 2XHSA 3V3EA 2Q8SA 4MGCA 1R20A 2NV7A 3ET3A 4OKWA 2XKWA 1T7MA 5DIGA 5E19A 3TY0A 2G0GA 5KR9A 3DZYA 3UUAA 4MG9B 3KPZA 3WMHA 1NRLA 4ZJRA 2ZXZA 1R1KD 4ITFA 2Q60A 1R6GA 3PCUA 5HJPB 2XYXA 3OMKA 2GIUA 4IS8A 3KDUA 5KCUA 2G44A 2ZK0A 2AAXA 3KMRA 5DP0A 3WGPA 4M8EA 3LMPA 3ZR7A 4E4KA 4G2IA 1S9PA 1SQNA 4PP3A 2Q59A 5DWIA 2OVHA 3UUDA 1DKFB 1G50A 3ILZA 3W0JA 5KRKA 2QE4A 2POBA 4OJ9A 3W0CA 3NOAA 4G1ZA 2HASA 3AURA 1X78A 2HC4A 1ZUCA 3UP3A 4EMAA 1PQCA 2VV1A 2OCFA 2GPOA 5A86A 2ZBSA 3B0TA 2GWXA 4A4WA 1NQ1A 2Q5PA 2A3IA 4XUHA 2PIVA 3OMQA 2P7ZA 3OMMA 3A2HA 1G5YA 1NQ2A 5DXRA 1T7TA 1S19A 4S0TA 3R8DA 2AA6A 1X7BA 1UHLA 2VV2A 3ET1A 4OFUA 5DVSA 5JI0D 4G2HA 3DZUA 3FXVA 4LBDA 1DB1A 2B50A 2Q7LA 2B1ZA 4ZNTA 1T7FA 3HQ5A 3KMZA 3W5RA 5C4TA 1ERRA 1PZLA 2AMBA 3B5RA 4XI3A 1PDUA 2J14A 1QKTA 2ZK4A 1R1KA 2ABIA 1YP0A 3AZ2A 5DWEA 2ZLAA 2AWHA 5DXQA 1NHZA 1MZNA 5APJA 4DM8A 3K22A 1WM0X 2P1TA 5DZ3A 2QA6A 5CJ6A 5DXPA 3GN8A 3PO9A 4RUJA 3ZQTA 4B7WA 2JJ3A 4QE6A 3FALB 2P15A 5M96A 4UDCA 3P89A 1XNNA 1L2JA 1X76A 3VI8A 5DRMA 3CDPA 4JGVA 1X7EA 2QXSA 2I4ZA 1GS4A 1P8DA 5B5BA 3B67A 1XLSA 3OS8C 4PP5A 5E1CA 1T74A 5DVCA 5LWPA 4S15A 5ACCA 4TV1A 5KCEA 2PIOA 4G20A 4JAZA 4OARA 4PP6A 5DRJA 5AWJA 3K23A 5JJMA 5DKGA 5L7GA 4OHAA 5DWLA 3ADTA 2ZXMA 5K13A 2HWRA 3HM1A 3NSQA 3X1HA 2IHQA 4TUZA 4WLBA 4NQAB 5HJSA 4EM9A 1I37A 3AZ1A 4K4JA 1EREA 4JYIA 3WT5A 3OSAA 1PRGA 1ZDTA 1YYEA 2BJ4B 2NW4A 2ZMHA 4S14A 1NAVA 4ZO1X 4WVDA 2JFAB 5DMFA 5EI1A 1IE8A 3VRTA 3VRVA 2R6WA 3PBAA 5DWJA 1N46A 4IW6A 2I0JA 4ZN7A 4IWCA 2Q70A 3DY6A 5APHA 4QM0A 1N83A 3GZ9A 5AZVA 4R6SA 4ZN9A 5E7VA 3ADWA 4CSJA 1ZDUA 2VV4B 3OOKA 5DIDA 2QR9A 3WJ4A 3UU7A 3E94A 2HVCA 1Q4XA 4NIEA 4O8FA 3PEQA 4XTAA 3D24A 1OSVA 4OZTE 4E2JA 5E0XA 3RLLA 2JF9A 3VHUA 3A9EA 4MG7A 5DUHA 4MDDA 1SJ0A 1NQ0A 4JYGA 3ZRBA 3MNOA 2G0HA 4OH5A 2OZ7A 4CI5A 1FCYA 2NXXA 3PRGA 3KYTA 4N73A 2NPAA 2ZNNA 3CS8A 3FEJA 3HODA 3KBAA 4OFRA 4UDDA 5DK9A 3OKHA 2H79A 5B41A 3U9QA 4OEYA 2QZOB 3O1EA 3OLFA 2PJLA 4RAKA 4RUOX 3VJHA 1ILGA 5ICKA 2QW4A 5DMCA 1OSHA 4OIVA 3UUCA 2QH6A 4DK7A 4DM6A 3JZCA 3CJWA 5HCVA 3VTDA 1UOMA 1KNUA 2YLQA 4JL4A 5F9BA 4RE8A 4XAOA 2REWA 1OVLA 3VRWA 5KRLA 3DR1A 1K74D 4MG5A 5AVLA 4DMAA 4L98A 3ET2A 2BAWA 3UP0A 2ZFXA 3O1DA 1KKQA 1OT7A 1VJBA 1T73A 3FURA 2F4BA 4XLDA 2HCDA 4ZNVA 5DXBB 2YLYA 4MGDB 3V49A 5DV3A 3ADVA 2Q1HA 3OMOA 1YMTA 5EJVA 3VT3A 3WFFA 4R2UA 2AA2A 3BC5A 3L3XA 4RFWA 4X1GA 2AX8A 2VV1B 2YATA 3H0AA 2PIWA 5FQVA 3OZJA 2V7CA 2GL8A 1HG4A 5EHJA 1PQ6A 1Z5XU 2PIXA 4MGAB 5FQSA 1YUCA 1NAXA 3FEIA 2ZK1A 3F5CA 2PIRA 3W0GA 2PITA 4APUA 4J26A 4K7AA 5DKBA 3R8IA 5DYBA 4IA3A 5AAVB 4POHA 1YINA 5AWKA 4IW8A 5KCFA 5KRIA 3WWRA 5DL4A 2XYWA 1XAPA 1S9QA 4OZRE 4YMQA 4DQMA 4G1YA 3G8OA 4IV4A 4OEZA 3G0WA 3W0HA 3V9TA 4Q13A 2LBDA 3K8SA 3ADUA 2PRGA 1NUOA 5DKSA 1XIUA 2PKLA 2QGWA 3HC5A 3W0YA 1ZH7A 4PLDA 3BQDA 2HWQA 3L03A 1GWQA 2G5OA 3R5MA 3MNPA 3IPSA 5DY8A 1N4HA 3CWDA 3P8XA 5KCDA 5C4SA 1K74A 3ADXA 3X1IA 5DZ1A 1YOWA 2QNVA 2ZNQA 3W0AA 2ZK5A 3GYTA 1YOKA 2EWPA 5FQRA 3VRUA 5DZIA 3VTBA 5DI7A 3VHVA 3VT5A 2IOKA 4IVYA 5DIEA 5G3JA 3K6PA 5GIEA 4MG9A 2W8YA 5KRAA 1P93A 2FVJA 3HLVA 3E00D 2I0GA 1TFCA 3KWYA 5HJPA 5KCCA 2Q6RA 2J7YA 1PK5A 2I4PA 2O4JA 1FBYA 2Q7KA 2V0VA 2ZL9A 4IVWA 4DORA 4PVUA 1ZEOA 5KRHA 1DKFA 5DYDA 4QL8A 3TKCA 3RLJA 5IZ0A 3OGTA 2QABA 3OKIA 3RUUA 3VSOA 5KRMA 1UPVA 3SP9A 2ACLB 3IPUA 1FM9D 3NSPA 4OEAA 4QE8A 1U9EA 4P6XA 5DZHA 3Q95B 2PIPL 5DSHA 2AA7A 5G46A 5DWGA 4MGBB 5KD9A 2VSTA 4UDAA 5GICA 1X7JA 5G42A 2AXAA 4WQPA 2PIQA 4ZJWA 3OZ0A 3R5NA 4ONIA 1XVPB 2AX6A 4PRGA 3VN2A 3BEJA 3CTBA 5DX3B 1RDTD 2QXMA 4YPQA 2ZNPA 4OZTU 2XYJA 3CS6A 5AK2A 2OM9A 3E00A 3MNEA 1FM6D 3X36A 4YNKA 5DV6A 4M8HA 3CDSA 5EITA 2ZMJA 2PNUA 2QA8B 4KZJA 2B23A 2ZMIA 1S0XA 3L0JA 5DTVA 4A4VA 5HYKA 2O4RA 1M7WA 1XV9B 2GPPA 2Q6JA 2VV3A 3EYBA 2QPYA 3F7DA 1XDKB 1XQCA 3AUNA 3FALA 3VJSA 3VT8A 2J7XA 4N1YA 5DXKA 1M2ZA 3FC6A 5JY3A 3R8AA 3UVVB 4PXMA 4UDBA 4J5WC 1I7IA 1S0ZA 3B68A 4IU7A 3RVFA 4XHDA 2ZY0A 1R20D 3VT9A 3D5FA 3M7RA 2P7GA 4G21A 1RJKA 3A78A 4OIUA 3UUAB 4F9MA 3DZYD 1KV6A 5C4OA 3OAPA 5KRJA 3AFRA 3E7CA 3OLSA 1L2IA 2IOGA 2GPVA 2Q5GA 4OILA 1RDTA 3FLIA 4A2JA 1U3RA 2Q3YA 4PPSA 2BJ4A 4LNXA 4KZIA 1H9UA 4WHFA 2P1VA 4YT1A 1Y9RA 4LTWA 4MG8A 3SZ1A 4RMEA 2AO6A 3SP6A 2Q59B 1FM6A 3UUDB 1LV2A 3B3KA 3W5QA 3OS8A 1T76A 4BCRA 1Y0SA 1A28A 4NY9A 3LBDA 3GWSX 2VV4A 1T5ZA 3ERDA 4KZMA 1MVCA 4OK1A 1Y0XX 2GPUA 2P7AA 2PINA 4OKTA 4RWVA 2FSZA 2ZK6A 1RKHA 1XNXA 4OJ4A 4WPFA 1X7RA 1SKXA 1RK3A 2R40D 2H77A 3W5PA 4PPPA 3VT4A 1K4WA 4E4QA 5GT4A 2I4JA 1UHLB 2YJAB 2PIUA 3PLZA 2R6YA 4OKBA 4PLEA 4CI4A 3H52A 5E15A 4Y29A 2B1VA 2QTUA 3P0UA 4X1FA 5FQPA 2HBHA 3DCTA 2QZOA 4IA1A 4IA2A 3OSIA 4IUIA 2HAMA 2YHDA 4IV2A 4N5GA 4RZGA 5DV8A 5H1EA 3WFGA 1GWRA 3A3ZX 1T79A 5L7EA 1A52A 4PWLA 3WT7A 2Q7IA 4RMCA 4HEEX 4QJRA 1YIMA 3ZRAA 3CQVA 1T65A 3GYUA 1G1UA 2AYRA 3N00A 4IWFA 1SR7A 5SYZA 2VV0A 1QKUA 2ZLCA 4OLMA 5IAWA 5G44A 1FD0A 3IPQA 5DXBA 1E3KA 1TXIA 1ZGYA 4MGDA 5L7HA 3VT7A 4P6WA 2YLPA 4FN9A 4ZNHA 3RY9A 3CS4A 4J5WA 4IQRA 2E2RA 4FNEA 1Z5XE 1QKNA 4NB6A 1BSXA 1LBDA 3GWXA 4FHIA 1T7RA 4MG6A 3VSPA 3ET0A 3AN3A
chains in the Genus database with same CATH superfamily
5G43A 5DXGA 4TV1B 5EC9A 1XQ3A 4MGAA 2R40A 4DK8A 2P1UA 2ZK3A 3CLDA 4LNWA 1YY4A 5JJMB 4R06A 3FS1A 4OGHA 2AA5A 3HVLA 2Q61A 3D57A 4FHHA 3W5TA 5KCTA 5I4VA 5AZTA 3OSWA 1XPCA 2P4YA 2Q5SA 5AAVA 4TUZB 5KCWA 3AZ3A 2ZK2A 3IXPD 1IE9A 2AMAA 1YJEA 5APKA 1EXXA 4Q50A 5DXEA 4OKXA 3W0IA 3V9YA 2P54A 1U3QA 1M13A 1K7LA 4HLWA 3TKMA 2HARA 3HC6A 5E0WA 3IMYA 1MV9A 2YJDA 3P88A 2QSEA 4OJBA 3V4AA 1T63A 1RKGA 4ITEA 5LGAA 3OOFA 5KRCA 3B1MA 1ZAFA 5DLRA 1XP1A 3R2AA 2AX9A 3UU7B 3A2IA 1HJ1A 4J5XC 3AN4A 2OVMA 5G45A 3OMPA 1I38A 3B65A 2Z4JA 3A9EB 4MG7B 4FGYA 4Q0AC 3AX8A 3KFCA 4LSJA 2GTKA 3FC6B 4WHGA 3WTQA 3DT3A 2YLOA 3WJ5A 4JYHA 3ERTA 4S0SA 3G9EA 4K6IA 4RMDA 2ZNOA 3KDTA 2Q6SA 3X31A 3S9SA 2J4AA 3A40X 4ZNSA 3V9VA 5HZCA 1G2NA 2AB2A 3B0QA 3GD2A 3R29A 4L96A 1NDEA 2GP7A 3RUTA 3B0WA 1UPWA 1XB7A 3VHWA 3WT6A 5KROA 4PF3A 3IXPA 1ZKYA 3JZBA 2VSRA 1XOWA 4XT9A 5C4UA 5AYGA 4OC7A 5DKEA 3VJTA 1R5KA 1Z95A 1XLSE 1OVLB 1YA3A 1U3SA 3L3ZA 4REFA 4ZOMA 4MG8B 1FM9A 4IA7A 3FUGA 5DZ0A 2ACLA 4ZO1B 1FCZA 4RZFA 3Q95A 5DUGA 2ZVTA 5DVVA 5KYJA 4RZEA 2AX7A 2Z4BA 4MGBA 2Q1VA 4OEDA 3L0LA 1XJ7A 4J24A 3DCUA 5E14A 1NQ7A 3H0AD 4NUFA 4XUMA 1FCXA 5IXKA 4ZNWA 4ZNUA 1XVPA 3TX7B 4POJA 3D90A 3QT0A 5DX3A 3OS9A 3F5CB 2FAIA 1QKMA 3L0EA 5KYAA 1XP6A 3HO0A 2ZXNA 2JFAA 2OUZA 2OAXA 5DXMA 1ILHA 3KMGA 4QK4A 2Q7JA 2HFPA 1PCGA 3B0RA 3AUQA 4ZI1A 5HYRA 3A2JA 5EGVA 2ATHA 1XP9A 5L11A 2QA8A 5AVIA 3L1BA 4OZRU 3G8IA 4G1DA 2AM9A 2ZASA 1GWXA 1XV9A 2HB8A 1I7GA 1E3GA 3GBKA 5GIDA 1XDKA 3HZFA 3OLLA 5AAUA 5DUEA 5FQTA 3T03A 4J5XA 4RUPA 3V3QA 1XZXX 2NXXE 2O9IA 3ADSA 3D6DA 3VT6A 4OH6A 2QGTA 2QMVA 2YFEA 3VTCA 2POGA 4REEA 1PQ9A 3B66A 5DU5A 1NYXA 5KRFA 2ZKCA 1EXAA 4N8RA 5G5WA 3UVVA 3VJIA 4DOSA 2HB7A 3IA6A 5ETHA 3DZUD 2XHSA 3V3EA 2Q8SA 4MGCA 1R20A 2NV7A 3ET3A 4OKWA 2XKWA 1T7MA 5DIGA 5E19A 3TY0A 2G0GA 5KR9A 3DZYA 3UUAA 4MG9B 3KPZA 3WMHA 1NRLA 4ZJRA 2ZXZA 1R1KD 4ITFA 2Q60A 1R6GA 3PCUA 5HJPB 2XYXA 3OMKA 2GIUA 4IS8A 3KDUA 5KCUA 2G44A 2ZK0A 2AAXA 3KMRA 5DP0A 3WGPA 4M8EA 3LMPA 3ZR7A 4E4KA 4G2IA 1S9PA 1SQNA 4PP3A 2Q59A 5DWIA 2OVHA 3UUDA 1DKFB 1G50A 3ILZA 3W0JA 5KRKA 2QE4A 2POBA 4OJ9A 3W0CA 3NOAA 4G1ZA 2HASA 3AURA 1X78A 2HC4A 1ZUCA 3UP3A 4EMAA 1PQCA 2VV1A 2OCFA 2GPOA 5A86A 2ZBSA 3B0TA 2GWXA 4A4WA 1NQ1A 2Q5PA 2A3IA 4XUHA 2PIVA 3OMQA 2P7ZA 3OMMA 3A2HA 1G5YA 1NQ2A 5DXRA 1T7TA 1S19A 4S0TA 3R8DA 2AA6A 1X7BA 1UHLA 2VV2A 3ET1A 4OFUA 5DVSA 5JI0D 4G2HA 3DZUA 3FXVA 4LBDA 1DB1A 2B50A 2Q7LA 2B1ZA 4ZNTA 1T7FA 3HQ5A 3KMZA 3W5RA 5C4TA 1ERRA 1PZLA 2AMBA 3B5RA 4XI3A 1PDUA 2J14A 1QKTA 2ZK4A 1R1KA 2ABIA 1YP0A 3AZ2A 5DWEA 2ZLAA 2AWHA 5DXQA 1NHZA 1MZNA 5APJA 4DM8A 3K22A 1WM0X 2P1TA 5DZ3A 2QA6A 5CJ6A 5DXPA 3GN8A 3PO9A 4RUJA 3ZQTA 4B7WA 2JJ3A 4QE6A 3FALB 2P15A 5M96A 4UDCA 3P89A 1XNNA 1L2JA 1X76A 3VI8A 5DRMA 3CDPA 4JGVA 1X7EA 2QXSA 2I4ZA 1GS4A 1P8DA 5B5BA 3B67A 1XLSA 3OS8C 4PP5A 5E1CA 1T74A 5DVCA 5LWPA 4S15A 5ACCA 4TV1A 5KCEA 2PIOA 4G20A 4JAZA 4OARA 4PP6A 5DRJA 5AWJA 3K23A 5JJMA 5DKGA 5L7GA 4OHAA 5DWLA 3ADTA 2ZXMA 5K13A 2HWRA 3HM1A 3NSQA 3X1HA 2IHQA 4TUZA 4WLBA 4NQAB 5HJSA 4EM9A 1I37A 3AZ1A 4K4JA 1EREA 4JYIA 3WT5A 3OSAA 1PRGA 1ZDTA 1YYEA 2BJ4B 2NW4A 2ZMHA 4S14A 1NAVA 4ZO1X 4WVDA 2JFAB 5DMFA 5EI1A 1IE8A 3VRTA 3VRVA 2R6WA 3PBAA 5DWJA 1N46A 4IW6A 2I0JA 4ZN7A 4IWCA 2Q70A 3DY6A 5APHA 4QM0A 1N83A 3GZ9A 5AZVA 4R6SA 4ZN9A 5E7VA 3ADWA 4CSJA 1ZDUA 2VV4B 3OOKA 5DIDA 2QR9A 3WJ4A 3UU7A 3E94A 2HVCA 1Q4XA 4NIEA 4O8FA 3PEQA 4XTAA 3D24A 1OSVA 4OZTE 4E2JA 5E0XA 3RLLA 2JF9A 3VHUA 3A9EA 4MG7A 5DUHA 4MDDA 1SJ0A 1NQ0A 4JYGA 3ZRBA 3MNOA 2G0HA 4OH5A 2OZ7A 4CI5A 1FCYA 2NXXA 3PRGA 3KYTA 4N73A 2NPAA 2ZNNA 3CS8A 3FEJA 3HODA 3KBAA 4OFRA 4UDDA 5DK9A 3OKHA 2H79A 5B41A 3U9QA 4OEYA 2QZOB 3O1EA 3OLFA 2PJLA 4RAKA 4RUOX 3VJHA 1ILGA 5ICKA 2QW4A 5DMCA 1OSHA 4OIVA 3UUCA 2QH6A 4DK7A 4DM6A 3JZCA 3CJWA 5HCVA 3VTDA 1UOMA 1KNUA 2YLQA 4JL4A 5F9BA 4RE8A 4XAOA 2REWA 1OVLA 3VRWA 5KRLA 3DR1A 1K74D 4MG5A 5AVLA 4DMAA 4L98A 3ET2A 2BAWA 3UP0A 2ZFXA 3O1DA 1KKQA 1OT7A 1VJBA 1T73A 3FURA 2F4BA 4XLDA 2HCDA 4ZNVA 5DXBB 2YLYA 4MGDB 3V49A 5DV3A 3ADVA 2Q1HA 3OMOA 1YMTA 5EJVA 3VT3A 3WFFA 4R2UA 2AA2A 3BC5A 3L3XA 4RFWA 4X1GA 2AX8A 2VV1B 2YATA 3H0AA 2PIWA 5FQVA 3OZJA 2V7CA 2GL8A 1HG4A 5EHJA 1PQ6A 1Z5XU 2PIXA 4MGAB 5FQSA 1YUCA 1NAXA 3FEIA 2ZK1A 3F5CA 2PIRA 3W0GA 2PITA 4APUA 4J26A 4K7AA 5DKBA 3R8IA 5DYBA 4IA3A 5AAVB 4POHA 1YINA 5AWKA 4IW8A 5KCFA 5KRIA 3WWRA 5DL4A 2XYWA 1XAPA 1S9QA 4OZRE 4YMQA 4DQMA 4G1YA 3G8OA 4IV4A 4OEZA 3G0WA 3W0HA 3V9TA 4Q13A 2LBDA 3K8SA 3ADUA 2PRGA 1NUOA 5DKSA 1XIUA 2PKLA 2QGWA 3HC5A 3W0YA 1ZH7A 4PLDA 3BQDA 2HWQA 3L03A 1GWQA 2G5OA 3R5MA 3MNPA 3IPSA 5DY8A 1N4HA 3CWDA 3P8XA 5KCDA 5C4SA 1K74A 3ADXA 3X1IA 5DZ1A 1YOWA 2QNVA 2ZNQA 3W0AA 2ZK5A 3GYTA 1YOKA 2EWPA 5FQRA 3VRUA 5DZIA 3VTBA 5DI7A 3VHVA 3VT5A 2IOKA 4IVYA 5DIEA 5G3JA 3K6PA 5GIEA 4MG9A 2W8YA 5KRAA 1P93A 2FVJA 3HLVA 3E00D 2I0GA 1TFCA 3KWYA 5HJPA 5KCCA 2Q6RA 2J7YA 1PK5A 2I4PA 2O4JA 1FBYA 2Q7KA 2V0VA 2ZL9A 4IVWA 4DORA 4PVUA 1ZEOA 5KRHA 1DKFA 5DYDA 4QL8A 3TKCA 3RLJA 5IZ0A 3OGTA 2QABA 3OKIA 3RUUA 3VSOA 5KRMA 1UPVA 3SP9A 2ACLB 3IPUA 1FM9D 3NSPA 4OEAA 4QE8A 1U9EA 4P6XA 5DZHA 3Q95B 2PIPL 5DSHA 2AA7A 5G46A 5DWGA 4MGBB 5KD9A 2VSTA 4UDAA 5GICA 1X7JA 5G42A 2AXAA 4WQPA 2PIQA 4ZJWA 3OZ0A 3R5NA 4ONIA 1XVPB 2AX6A 4PRGA 3VN2A 3BEJA 3CTBA 5DX3B 1RDTD 2QXMA 4YPQA 2ZNPA 4OZTU 2XYJA 3CS6A 5AK2A 2OM9A 3E00A 3MNEA 1FM6D 3X36A 4YNKA 5DV6A 4M8HA 3CDSA 5EITA 2ZMJA 2PNUA 2QA8B 4KZJA 2B23A 2ZMIA 1S0XA 3L0JA 5DTVA 4A4VA 5HYKA 2O4RA 1M7WA 1XV9B 2GPPA 2Q6JA 2VV3A 3EYBA 2QPYA 3F7DA 1XDKB 1XQCA 3AUNA 3FALA 3VJSA 3VT8A 2J7XA 4N1YA 5DXKA 1M2ZA 3FC6A 5JY3A 3R8AA 3UVVB 4PXMA 4UDBA 4J5WC 1I7IA 1S0ZA 3B68A 4IU7A 3RVFA 4XHDA 2ZY0A 1R20D 3VT9A 3D5FA 3M7RA 2P7GA 4G21A 1RJKA 3A78A 4OIUA 3UUAB 4F9MA 3DZYD 1KV6A 5C4OA 3OAPA 5KRJA 3AFRA 3E7CA 3OLSA 1L2IA 2IOGA 2GPVA 2Q5GA 4OILA 1RDTA 3FLIA 4A2JA 1U3RA 2Q3YA 4PPSA 2BJ4A 4LNXA 4KZIA 1H9UA 4WHFA 2P1VA 4YT1A 1Y9RA 4LTWA 4MG8A 3SZ1A 4RMEA 2AO6A 3SP6A 2Q59B 1FM6A 3UUDB 1LV2A 3B3KA 3W5QA 3OS8A 1T76A 4BCRA 1Y0SA 1A28A 4NY9A 3LBDA 3GWSX 2VV4A 1T5ZA 3ERDA 4KZMA 1MVCA 4OK1A 1Y0XX 2GPUA 2P7AA 2PINA 4OKTA 4RWVA 2FSZA 2ZK6A 1RKHA 1XNXA 4OJ4A 4WPFA 1X7RA 1SKXA 1RK3A 2R40D 2H77A 3W5PA 4PPPA 3VT4A 1K4WA 4E4QA 5GT4A 2I4JA 1UHLB 2YJAB 2PIUA 3PLZA 2R6YA 4OKBA 4PLEA 4CI4A 3H52A 5E15A 4Y29A 2B1VA 2QTUA 3P0UA 4X1FA 5FQPA 2HBHA 3DCTA 2QZOA 4IA1A 4IA2A 3OSIA 4IUIA 2HAMA 2YHDA 4IV2A 4N5GA 4RZGA 5DV8A 5H1EA 3WFGA 1GWRA 3A3ZX 1T79A 5L7EA 1A52A 4PWLA 3WT7A 2Q7IA 4RMCA 4HEEX 4QJRA 1YIMA 3ZRAA 3CQVA 1T65A 3GYUA 1G1UA 2AYRA 3N00A 4IWFA 1SR7A 5SYZA 2VV0A 1QKUA 2ZLCA 4OLMA 5IAWA 5G44A 1FD0A 3IPQA 5DXBA 1E3KA 1TXIA 1ZGYA 4MGDA 5L7HA 3VT7A 4P6WA 2YLPA 4FN9A 4ZNHA 3RY9A 3CS4A 4J5WA 4IQRA 2E2RA 4FNEA 1Z5XE 1QKNA 4NB6A 1BSXA 1LBDA 3GWXA 4FHIA 1T7RA 4MG6A 3VSPA 3ET0A 3AN3A
chains in the Genus database with same CATH topology
5G43A 5DXGA 4TV1B 5EC9A 1XQ3A 4MGAA 2R40A 4DK8A 2P1UA 2ZK3A 3CLDA 4LNWA 1YY4A 5JJMB 4R06A 3FS1A 4OGHA 2AA5A 3HVLA 2Q61A 3D57A 4FHHA 3W5TA 5KCTA 5I4VA 5AZTA 3OSWA 1XPCA 2P4YA 2Q5SA 5AAVA 4TUZB 5KCWA 3AZ3A 2ZK2A 3IXPD 1IE9A 2AMAA 1YJEA 5APKA 1EXXA 4Q50A 5DXEA 4OKXA 3W0IA 3V9YA 2P54A 1U3QA 1M13A 1K7LA 4HLWA 3TKMA 2HARA 3HC6A 5E0WA 3IMYA 1MV9A 2YJDA 3P88A 2QSEA 4OJBA 3V4AA 1T63A 1RKGA 4ITEA 5LGAA 3OOFA 5KRCA 3B1MA 1ZAFA 5DLRA 1XP1A 3R2AA 2AX9A 3UU7B 3A2IA 1HJ1A 4J5XC 3AN4A 2OVMA 5G45A 3OMPA 1I38A 3B65A 2Z4JA 3A9EB 4MG7B 4FGYA 4Q0AC 3AX8A 3KFCA 4LSJA 2GTKA 3FC6B 4WHGA 3WTQA 3DT3A 2YLOA 3WJ5A 4JYHA 3ERTA 4S0SA 3G9EA 4K6IA 4RMDA 2ZNOA 3KDTA 2Q6SA 3X31A 3S9SA 2J4AA 3A40X 4ZNSA 3V9VA 5HZCA 1G2NA 2AB2A 3B0QA 3GD2A 3R29A 4L96A 1NDEA 2GP7A 3RUTA 3B0WA 1UPWA 1XB7A 3VHWA 3WT6A 5KROA 4PF3A 3IXPA 1ZKYA 3JZBA 2VSRA 1XOWA 4XT9A 5C4UA 5AYGA 4OC7A 5DKEA 3VJTA 1R5KA 1Z95A 1XLSE 1OVLB 1YA3A 1U3SA 3L3ZA 4REFA 4ZOMA 4MG8B 1FM9A 4IA7A 3FUGA 5DZ0A 2ACLA 4ZO1B 1FCZA 4RZFA 3Q95A 5DUGA 2ZVTA 5DVVA 5KYJA 4RZEA 2AX7A 2Z4BA 4MGBA 2Q1VA 4OEDA 3L0LA 1XJ7A 4J24A 3DCUA 5E14A 1NQ7A 3H0AD 4NUFA 4XUMA 1FCXA 5IXKA 4ZNWA 4ZNUA 1XVPA 3TX7B 4POJA 3D90A 3QT0A 5DX3A 3OS9A 3F5CB 2FAIA 1QKMA 3L0EA 5KYAA 1XP6A 3HO0A 2ZXNA 2JFAA 2OUZA 2OAXA 5DXMA 1ILHA 3KMGA 4QK4A 2Q7JA 2HFPA 1PCGA 3B0RA 3AUQA 4ZI1A 5HYRA 3A2JA 5EGVA 2ATHA 1XP9A 5L11A 2QA8A 5AVIA 3L1BA 4OZRU 3G8IA 4G1DA 2AM9A 2ZASA 1GWXA 1XV9A 2HB8A 1I7GA 1E3GA 3GBKA 5GIDA 1XDKA 3HZFA 3OLLA 5AAUA 5DUEA 5FQTA 3T03A 4J5XA 4RUPA 3V3QA 1XZXX 2NXXE 2O9IA 3ADSA 3D6DA 3VT6A 4OH6A 2QGTA 2QMVA 2YFEA 3VTCA 2POGA 4REEA 1PQ9A 3B66A 5DU5A 1NYXA 5KRFA 2ZKCA 1EXAA 4N8RA 5G5WA 3UVVA 3VJIA 4DOSA 2HB7A 3IA6A 5ETHA 3DZUD 2XHSA 3V3EA 2Q8SA 4MGCA 1R20A 2NV7A 3ET3A 4OKWA 2XKWA 1T7MA 5DIGA 5E19A 3TY0A 2G0GA 5KR9A 3DZYA 3UUAA 4MG9B 3KPZA 3WMHA 1NRLA 4ZJRA 2ZXZA 1R1KD 4ITFA 2Q60A 1R6GA 3PCUA 5HJPB 2XYXA 3OMKA 2GIUA 4IS8A 3KDUA 5KCUA 2G44A 2ZK0A 2AAXA 3KMRA 5DP0A 3WGPA 4M8EA 3LMPA 3ZR7A 4E4KA 4G2IA 1S9PA 1SQNA 4PP3A 2Q59A 5DWIA 2OVHA 3UUDA 1DKFB 1G50A 3ILZA 3W0JA 5KRKA 2QE4A 2POBA 4OJ9A 3W0CA 3NOAA 4G1ZA 2HASA 3AURA 1X78A 2HC4A 1ZUCA 3UP3A 4EMAA 1PQCA 2VV1A 2OCFA 2GPOA 5A86A 2ZBSA 3B0TA 2GWXA 4A4WA 1NQ1A 2Q5PA 2A3IA 4XUHA 2PIVA 3OMQA 2P7ZA 3OMMA 3A2HA 1G5YA 1NQ2A 5DXRA 1T7TA 1S19A 4S0TA 3R8DA 2AA6A 1X7BA 1UHLA 2VV2A 3ET1A 4OFUA 5DVSA 5JI0D 4G2HA 3DZUA 3FXVA 4LBDA 1DB1A 2B50A 2Q7LA 2B1ZA 4ZNTA 1T7FA 3HQ5A 3KMZA 3W5RA 5C4TA 1ERRA 1PZLA 2AMBA 3B5RA 4XI3A 1PDUA 2J14A 1QKTA 2ZK4A 1R1KA 2ABIA 1YP0A 3AZ2A 5DWEA 2ZLAA 2AWHA 5DXQA 1NHZA 1MZNA 5APJA 4DM8A 3K22A 1WM0X 2P1TA 5DZ3A 2QA6A 5CJ6A 5DXPA 3GN8A 3PO9A 4RUJA 3ZQTA 4B7WA 2JJ3A 4QE6A 3FALB 2P15A 5M96A 4UDCA 3P89A 1XNNA 1L2JA 1X76A 3VI8A 5DRMA 3CDPA 4JGVA 1X7EA 2QXSA 2I4ZA 1GS4A 1P8DA 5B5BA 3B67A 1XLSA 3OS8C 4PP5A 5E1CA 1T74A 5DVCA 5LWPA 4S15A 5ACCA 4TV1A 5KCEA 2PIOA 4G20A 4JAZA 4OARA 4PP6A 5DRJA 5AWJA 3K23A 5JJMA 5DKGA 5L7GA 4OHAA 5DWLA 3ADTA 2ZXMA 5K13A 2HWRA 3HM1A 3NSQA 3X1HA 2IHQA 4TUZA 4WLBA 4NQAB 5HJSA 4EM9A 1I37A 3AZ1A 4K4JA 1EREA 4JYIA 3WT5A 3OSAA 1PRGA 1ZDTA 1YYEA 2BJ4B 2NW4A 2ZMHA 4S14A 1NAVA 4ZO1X 4WVDA 2JFAB 5DMFA 5EI1A 1IE8A 3VRTA 3VRVA 2R6WA 3PBAA 5DWJA 1N46A 4IW6A 2I0JA 4ZN7A 4IWCA 2Q70A 3DY6A 5APHA 4QM0A 1N83A 3GZ9A 5AZVA 4R6SA 4ZN9A 5E7VA 3ADWA 4CSJA 1ZDUA 2VV4B 3OOKA 5DIDA 2QR9A 3WJ4A 3UU7A 3E94A 2HVCA 1Q4XA 4NIEA 4O8FA 3PEQA 4XTAA 3D24A 1OSVA 4OZTE 4E2JA 5E0XA 3RLLA 2JF9A 3VHUA 3A9EA 4MG7A 5DUHA 4MDDA 1SJ0A 1NQ0A 4JYGA 3ZRBA 3MNOA 2G0HA 4OH5A 2OZ7A 4CI5A 1FCYA 2NXXA 3PRGA 3KYTA 4N73A 2NPAA 2ZNNA 3CS8A 3FEJA 3HODA 3KBAA 4OFRA 4UDDA 5DK9A 3OKHA 2H79A 5B41A 3U9QA 4OEYA 2QZOB 3O1EA 3OLFA 2PJLA 4RAKA 4RUOX 3VJHA 1ILGA 5ICKA 2QW4A 5DMCA 1OSHA 4OIVA 3UUCA 2QH6A 4DK7A 4DM6A 3JZCA 3CJWA 5HCVA 3VTDA 1UOMA 1KNUA 2YLQA 4JL4A 5F9BA 4RE8A 4XAOA 2REWA 1OVLA 3VRWA 5KRLA 3DR1A 1K74D 4MG5A 5AVLA 4DMAA 4L98A 3ET2A 2BAWA 3UP0A 2ZFXA 3O1DA 1KKQA 1OT7A 1VJBA 1T73A 3FURA 2F4BA 4XLDA 2HCDA 4ZNVA 5DXBB 2YLYA 4MGDB 3V49A 5DV3A 3ADVA 2Q1HA 3OMOA 1YMTA 5EJVA 3VT3A 3WFFA 4R2UA 2AA2A 3BC5A 3L3XA 4RFWA 4X1GA 2AX8A 2VV1B 2YATA 3H0AA 2PIWA 5FQVA 3OZJA 2V7CA 2GL8A 1HG4A 5EHJA 1PQ6A 1Z5XU 2PIXA 4MGAB 5FQSA 1YUCA 1NAXA 3FEIA 2ZK1A 3F5CA 2PIRA 3W0GA 2PITA 4APUA 4J26A 4K7AA 5DKBA 3R8IA 5DYBA 4IA3A 5AAVB 4POHA 1YINA 5AWKA 4IW8A 5KCFA 5KRIA 3WWRA 5DL4A 2XYWA 1XAPA 1S9QA 4OZRE 4YMQA 4DQMA 4G1YA 3G8OA 4IV4A 4OEZA 3G0WA 3W0HA 3V9TA 4Q13A 2LBDA 3K8SA 3ADUA 2PRGA 1NUOA 5DKSA 1XIUA 2PKLA 2QGWA 3HC5A 3W0YA 1ZH7A 4PLDA 3BQDA 2HWQA 3L03A 1GWQA 2G5OA 3R5MA 3MNPA 3IPSA 5DY8A 1N4HA 3CWDA 3P8XA 5KCDA 5C4SA 1K74A 3ADXA 3X1IA 5DZ1A 1YOWA 2QNVA 2ZNQA 3W0AA 2ZK5A 3GYTA 1YOKA 2EWPA 5FQRA 3VRUA 5DZIA 3VTBA 5DI7A 3VHVA 3VT5A 2IOKA 4IVYA 5DIEA 5G3JA 3K6PA 5GIEA 4MG9A 2W8YA 5KRAA 1P93A 2FVJA 3HLVA 3E00D 2I0GA 1TFCA 3KWYA 5HJPA 5KCCA 2Q6RA 2J7YA 1PK5A 2I4PA 2O4JA 1FBYA 2Q7KA 2V0VA 2ZL9A 4IVWA 4DORA 4PVUA 1ZEOA 5KRHA 1DKFA 5DYDA 4QL8A 3TKCA 3RLJA 5IZ0A 3OGTA 2QABA 3OKIA 3RUUA 3VSOA 5KRMA 1UPVA 3SP9A 2ACLB 3IPUA 1FM9D 3NSPA 4OEAA 4QE8A 1U9EA 4P6XA 5DZHA 3Q95B 2PIPL 5DSHA 2AA7A 5G46A 5DWGA 4MGBB 5KD9A 2VSTA 4UDAA 5GICA 1X7JA 5G42A 2AXAA 4WQPA 2PIQA 4ZJWA 3OZ0A 3R5NA 4ONIA 1XVPB 2AX6A 4PRGA 3VN2A 3BEJA 3CTBA 5DX3B 1RDTD 2QXMA 4YPQA 2ZNPA 4OZTU 2XYJA 3CS6A 5AK2A 2OM9A 3E00A 3MNEA 1FM6D 3X36A 4YNKA 5DV6A 4M8HA 3CDSA 5EITA 2ZMJA 2PNUA 2QA8B 4KZJA 2B23A 2ZMIA 1S0XA 3L0JA 5DTVA 4A4VA 5HYKA 2O4RA 1M7WA 1XV9B 2GPPA 2Q6JA 2VV3A 3EYBA 2QPYA 3F7DA 1XDKB 1XQCA 3AUNA 3FALA 3VJSA 3VT8A 2J7XA 4N1YA 5DXKA 1M2ZA 3FC6A 5JY3A 3R8AA 3UVVB 4PXMA 4UDBA 4J5WC 1I7IA 1S0ZA 3B68A 4IU7A 3RVFA 4XHDA 2ZY0A 1R20D 3VT9A 3D5FA 3M7RA 2P7GA 4G21A 1RJKA 3A78A 4OIUA 3UUAB 4F9MA 3DZYD 1KV6A 5C4OA 3OAPA 5KRJA 3AFRA 3E7CA 3OLSA 1L2IA 2IOGA 2GPVA 2Q5GA 4OILA 1RDTA 3FLIA 4A2JA 1U3RA 2Q3YA 4PPSA 2BJ4A 4LNXA 4KZIA 1H9UA 4WHFA 2P1VA 4YT1A 1Y9RA 4LTWA 4MG8A 3SZ1A 4RMEA 2AO6A 3SP6A 2Q59B 1FM6A 3UUDB 1LV2A 3B3KA 3W5QA 3OS8A 1T76A 4BCRA 1Y0SA 1A28A 4NY9A 3LBDA 3GWSX 2VV4A 1T5ZA 3ERDA 4KZMA 1MVCA 4OK1A 1Y0XX 2GPUA 2P7AA 2PINA 4OKTA 4RWVA 2FSZA 2ZK6A 1RKHA 1XNXA 4OJ4A 4WPFA 1X7RA 1SKXA 1RK3A 2R40D 2H77A 3W5PA 4PPPA 3VT4A 1K4WA 4E4QA 5GT4A 2I4JA 1UHLB 2YJAB 2PIUA 3PLZA 2R6YA 4OKBA 4PLEA 4CI4A 3H52A 5E15A 4Y29A 2B1VA 2QTUA 3P0UA 4X1FA 5FQPA 2HBHA 3DCTA 2QZOA 4IA1A 4IA2A 3OSIA 4IUIA 2HAMA 2YHDA 4IV2A 4N5GA 4RZGA 5DV8A 5H1EA 3WFGA 1GWRA 3A3ZX 1T79A 5L7EA 1A52A 4PWLA 3WT7A 2Q7IA 4RMCA 4HEEX 4QJRA 1YIMA 3ZRAA 3CQVA 1T65A 3GYUA 1G1UA 2AYRA 3N00A 4IWFA 1SR7A 5SYZA 2VV0A 1QKUA 2ZLCA 4OLMA 5IAWA 5G44A 1FD0A 3IPQA 5DXBA 1E3KA 1TXIA 1ZGYA 4MGDA 5L7HA 3VT7A 4P6WA 2YLPA 4FN9A 4ZNHA 3RY9A 3CS4A 4J5WA 4IQRA 2E2RA 4FNEA 1Z5XE 1QKNA 4NB6A 1BSXA 1LBDA 3GWXA 4FHIA 1T7RA 4MG6A 3VSPA 3ET0A 3AN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G43 A;  5DXG A;  4TV1 B;  5EC9 A;  1XQ3 A;  4MGA A;  2R40 A;  4DK8 A;  2P1U A;  2ZK3 A;  3CLD A;  4LNW A;  1YY4 A;  5JJM B;  4R06 A;  3FS1 A;  4OGH A;  2AA5 A;  3HVL A;  2Q61 A;  3D57 A;  4FHH A;  3W5T A;  5KCT A;  5I4V A;  5AZT A;  3OSW A;  1XPC A;  2P4Y A;  2Q5S A;  5AAV A;  4TUZ B;  5KCW A;  3AZ3 A;  2ZK2 A;  3IXP D;  1IE9 A;  2AMA A;  1YJE A;  5APK A;  1EXX A;  4Q50 A;  5DXE A;  4OKX A;  3W0I A;  3V9Y A;  2P54 A;  1U3Q A;  1M13 A;  1K7L A;  4HLW A;  3TKM A;  2HAR A;  3HC6 A;  5E0W A;  3IMY A;  1MV9 A;  2YJD A;  3P88 A;  2QSE A;  4OJB A;  3V4A A;  1T63 A;  1RKG A;  4ITE A;  5LGA A;  3OOF A;  5KRC A;  3B1M A;  1ZAF A;  5DLR A;  1XP1 A;  3R2A A;  2AX9 A;  3UU7 B;  3A2I A;  1HJ1 A;  4J5X C;  3AN4 A;  2OVM A;  5G45 A;  3OMP A;  1I38 A;  3B65 A;  2Z4J A;  3A9E B;  4MG7 B;  4FGY A;  4Q0A C;  3AX8 A;  3KFC A;  4LSJ A;  2GTK A;  3FC6 B;  4WHG A;  3WTQ A;  3DT3 A;  2YLO A;  3WJ5 A;  4JYH A;  3ERT A;  4S0S A;  3G9E A;  4K6I A;  4RMD A;  2ZNO A;  3KDT A;  2Q6S A;  3X31 A;  3S9S A;  2J4A A;  3A40 X;  4ZNS A;  3V9V A;  5HZC A;  1G2N A;  2AB2 A;  3B0Q A;  3GD2 A;  3R29 A;  4L96 A;  1NDE A;  2GP7 A;  3RUT A;  3B0W A;  1UPW A;  1XB7 A;  3VHW A;  3WT6 A;  5KRO A;  4PF3 A;  3IXP A;  1ZKY A;  3JZB A;  2VSR A;  1XOW A;  4XT9 A;  5C4U A;  5AYG A;  4OC7 A;  5DKE A;  3VJT A;  1R5K A;  1Z95 A;  1XLS E;  1OVL B;  1YA3 A;  1U3S A;  3L3Z A;  4REF A;  4ZOM A;  4MG8 B;  1FM9 A;  4IA7 A;  3FUG A;  5DZ0 A;  2ACL A;  4ZO1 B;  1FCZ A;  4RZF A;  3Q95 A;  5DUG A;  2ZVT A;  5DVV A;  5KYJ A;  4RZE A;  2AX7 A;  2Z4B A;  4MGB A;  2Q1V A;  4OED A;  3L0L A;  1XJ7 A;  4J24 A;  3DCU A;  5E14 A;  1NQ7 A;  3H0A D;  4NUF A;  4XUM A;  1FCX A;  5IXK A;  4ZNW A;  4ZNU A;  1XVP A;  3TX7 B;  4POJ A;  3D90 A;  3QT0 A;  5DX3 A;  3OS9 A;  3F5C B;  2FAI A;  1QKM A;  3L0E A;  5KYA A;  1XP6 A;  3HO0 A;  2ZXN A;  2JFA A;  2OUZ A;  2OAX A;  5DXM A;  1ILH A;  3KMG A;  4QK4 A;  2Q7J A;  2HFP A;  1PCG A;  3B0R A;  3AUQ A;  4ZI1 A;  5HYR A;  3A2J A;  5EGV A;  2ATH A;  1XP9 A;  5L11 A;  2QA8 A;  5AVI A;  3L1B A;  4OZR U;  3G8I A;  4G1D A;  2AM9 A;  2ZAS A;  1GWX A;  1XV9 A;  2HB8 A;  1I7G A;  1E3G A;  3GBK A;  5GID A;  1XDK A;  3HZF A;  3OLL A;  5AAU A;  5DUE A;  5FQT A;  3T03 A;  4J5X A;  4RUP A;  3V3Q A;  1XZX X;  2NXX E;  2O9I A;  3ADS A;  3D6D A;  3VT6 A;  4OH6 A;  2QGT A;  2QMV A;  2YFE A;  3VTC A;  2POG A;  4REE A;  1PQ9 A;  3B66 A;  5DU5 A;  1NYX A;  5KRF A;  2ZKC A;  1EXA A;  4N8R A;  5G5W A;  3UVV A;  3VJI A;  4DOS A;  2HB7 A;  3IA6 A;  5ETH A;  3DZU D;  2XHS A;  3V3E A;  2Q8S A;  4MGC A;  1R20 A;  2NV7 A;  3ET3 A;  4OKW A;  2XKW A;  1T7M A;  5DIG A;  5E19 A;  3TY0 A;  2G0G A;  5KR9 A;  3DZY A;  3UUA A;  4MG9 B;  3KPZ A;  3WMH A;  1NRL A;  4ZJR A;  2ZXZ A;  1R1K D;  4ITF A;  2Q60 A;  1R6G A;  3PCU A;  5HJP B;  2XYX A;  3OMK A;  2GIU A;  4IS8 A;  3KDU A;  5KCU A;  2G44 A;  2ZK0 A;  2AAX A;  3KMR A;  5DP0 A;  3WGP A;  4M8E A;  3LMP A;  3ZR7 A;  4E4K A;  4G2I A;  1S9P A;  1SQN A;  4PP3 A;  2Q59 A;  5DWI A;  2OVH A;  3UUD A;  1DKF B;  1G50 A;  3ILZ A;  3W0J A;  5KRK A;  2QE4 A;  2POB A;  4OJ9 A;  3W0C A;  3NOA A;  4G1Z A;  2HAS A;  3AUR A;  1X78 A;  2HC4 A;  1ZUC A;  3UP3 A;  4EMA A;  1PQC A;  2VV1 A;  2OCF A;  2GPO A;  5A86 A;  2ZBS A;  3B0T A;  2GWX A;  4A4W A;  1NQ1 A;  2Q5P A;  2A3I A;  4XUH A;  2PIV A;  3OMQ A;  2P7Z A;  3OMM A;  3A2H A;  1G5Y A;  1NQ2 A;  5DXR A;  1T7T A;  1S19 A;  4S0T A;  3R8D A;  2AA6 A;  1X7B A;  1UHL A;  2VV2 A;  3ET1 A;  4OFU A;  5DVS A;  5JI0 D;  4G2H A;  3DZU A;  3FXV A;  4LBD A;  1DB1 A;  2B50 A;  2Q7L A;  2B1Z A;  4ZNT A;  1T7F A;  3HQ5 A;  3KMZ A;  3W5R A;  5C4T A;  1ERR A;  1PZL A;  2AMB A;  3B5R A;  4XI3 A;  1PDU A;  2J14 A;  1QKT A;  2ZK4 A;  1R1K A;  2ABI A;  1YP0 A;  3AZ2 A;  5DWE A;  2ZLA A;  2AWH A;  5DXQ A;  1NHZ A;  1MZN A;  5APJ A;  4DM8 A;  3K22 A;  1WM0 X;  2P1T A;  5DZ3 A;  2QA6 A;  5CJ6 A;  5DXP A;  3GN8 A;  3PO9 A;  4RUJ A;  3ZQT A;  4B7W A;  2JJ3 A;  4QE6 A;  3FAL B;  2P15 A;  5M96 A;  4UDC A;  3P89 A;  1XNN A;  1L2J A;  1X76 A;  3VI8 A;  5DRM A;  3CDP A;  4JGV A;  1X7E A;  2QXS A;  2I4Z A;  1GS4 A;  1P8D A;  5B5B A;  3B67 A;  1XLS A;  3OS8 C;  4PP5 A;  5E1C A;  1T74 A;  5DVC A;  5LWP A;  4S15 A;  5ACC A;  4TV1 A;  5KCE A;  2PIO A;  4G20 A;  4JAZ A;  4OAR A;  4PP6 A;  5DRJ A;  5AWJ A;  3K23 A;  5JJM A;  5DKG A;  5L7G A;  4OHA A;  5DWL A;  3ADT A;  2ZXM A;  5K13 A;  2HWR A;  3HM1 A;  3NSQ A;  3X1H A;  2IHQ A;  4TUZ A;  4WLB A;  4NQA B;  5HJS A;  4EM9 A;  1I37 A;  3AZ1 A;  4K4J A;  1ERE A;  4JYI A;  3WT5 A;  3OSA A;  1PRG A;  1ZDT A;  1YYE A;  2BJ4 B;  2NW4 A;  2ZMH A;  4S14 A;  1NAV A;  4ZO1 X;  4WVD A;  2JFA B;  5DMF A;  5EI1 A;  1IE8 A;  3VRT A;  3VRV A;  2R6W A;  3PBA A;  5DWJ A;  1N46 A;  4IW6 A;  2I0J A;  4ZN7 A;  4IWC A;  2Q70 A;  3DY6 A;  5APH A;  4QM0 A;  1N83 A;  3GZ9 A;  5AZV A;  4R6S A;  4ZN9 A;  5E7V A;  3ADW A;  4CSJ A;  1ZDU A;  2VV4 B;  3OOK A;  5DID A;  2QR9 A;  3WJ4 A;  3UU7 A;  3E94 A;  2HVC A;  1Q4X A;  4NIE A;  4O8F A;  3PEQ A;  4XTA A;  3D24 A;  1OSV A;  4OZT E;  4E2J A;  5E0X A;  3RLL A;  2JF9 A;  3VHU A;  3A9E A;  4MG7 A;  5DUH A;  4MDD A;  1SJ0 A;  1NQ0 A;  4JYG A;  3ZRB A;  3MNO A;  2G0H A;  4OH5 A;  2OZ7 A;  4CI5 A;  1FCY A;  2NXX A;  3PRG A;  3KYT A;  4N73 A;  2NPA A;  2ZNN A;  3CS8 A;  3FEJ A;  3HOD A;  3KBA A;  4OFR A;  4UDD A;  5DK9 A;  3OKH A;  2H79 A;  5B41 A;  3U9Q A;  4OEY A;  2QZO B;  3O1E A;  3OLF A;  2PJL A;  4RAK A;  4RUO X;  3VJH A;  1ILG A;  5ICK A;  2QW4 A;  5DMC A;  1OSH A;  4OIV A;  3UUC A;  2QH6 A;  4DK7 A;  4DM6 A;  3JZC A;  3CJW A;  5HCV A;  3VTD A;  1UOM A;  1KNU A;  2YLQ A;  4JL4 A;  5F9B A;  4RE8 A;  4XAO A;  2REW A;  1OVL A;  3VRW A;  5KRL A;  3DR1 A;  1K74 D;  4MG5 A;  5AVL A;  4DMA A;  4L98 A;  3ET2 A;  2BAW A;  3UP0 A;  2ZFX A;  3O1D A;  1KKQ A;  1OT7 A;  1VJB A;  1T73 A;  3FUR A;  2F4B A;  4XLD A;  2HCD A;  4ZNV A;  5DXB B;  2YLY A;  4MGD B;  3V49 A;  5DV3 A;  3ADV A;  2Q1H A;  3OMO A;  1YMT A;  5EJV A;  3VT3 A;  3WFF A;  4R2U A;  2AA2 A;  3BC5 A;  3L3X A;  4RFW A;  4X1G A;  2AX8 A;  2VV1 B;  2YAT A;  3H0A A;  2PIW A;  5FQV A;  3OZJ A;  2V7C A;  2GL8 A;  1HG4 A;  5EHJ A;  1PQ6 A;  1Z5X U;  2PIX A;  4MGA B;  5FQS A;  1YUC A;  1NAX A;  3FEI A;  2ZK1 A;  3F5C A;  2PIR A;  3W0G A;  2PIT A;  4APU A;  4J26 A;  4K7A A;  5DKB A;  3R8I A;  5DYB A;  4IA3 A;  5AAV B;  4POH A;  1YIN A;  5AWK A;  4IW8 A;  5KCF A;  5KRI A;  3WWR A;  5DL4 A;  2XYW A;  1XAP A;  1S9Q A;  4OZR E;  4YMQ A;  4DQM A;  4G1Y A;  3G8O A;  4IV4 A;  4OEZ A;  3G0W A;  3W0H A;  3V9T A;  4Q13 A;  2LBD A;  3K8S A;  3ADU A;  2PRG A;  1NUO A;  5DKS A;  1XIU A;  2PKL A;  2QGW A;  3HC5 A;  3W0Y A;  1ZH7 A;  4PLD A;  3BQD A;  2HWQ A;  3L03 A;  1GWQ A;  2G5O A;  3R5M A;  3MNP A;  3IPS A;  5DY8 A;  1N4H A;  3CWD A;  3P8X A;  5KCD A;  5C4S A;  1K74 A;  3ADX A;  3X1I A;  5DZ1 A;  1YOW A;  2QNV A;  2ZNQ A;  3W0A A;  2ZK5 A;  3GYT A;  1YOK A;  2EWP A;  5FQR A;  3VRU A;  5DZI A;  3VTB A;  5DI7 A;  3VHV A;  3VT5 A;  2IOK A;  4IVY A;  5DIE A;  5G3J A;  3K6P A;  5GIE A;  4MG9 A;  2W8Y A;  5KRA A;  1P93 A;  2FVJ A;  3HLV A;  3E00 D;  2I0G A;  1TFC A;  3KWY A;  5HJP A;  5KCC A;  2Q6R A;  2J7Y A;  1PK5 A;  2I4P A;  2O4J A;  1FBY A;  2Q7K A;  2V0V A;  2ZL9 A;  4IVW A;  4DOR A;  4PVU A;  1ZEO A;  5KRH A;  1DKF A;  5DYD A;  4QL8 A;  3TKC A;  3RLJ A;  5IZ0 A;  3OGT A;  2QAB A;  3OKI A;  3RUU A;  3VSO A;  5KRM A;  1UPV A;  3SP9 A;  2ACL B;  3IPU A;  1FM9 D;  3NSP A;  4OEA A;  4QE8 A;  1U9E A;  4P6X A;  5DZH A;  3Q95 B;  2PIP L;  5DSH A;  2AA7 A;  5G46 A;  5DWG A;  4MGB B;  5KD9 A;  2VST A;  4UDA A;  5GIC A;  1X7J A;  5G42 A;  2AXA A;  4WQP A;  2PIQ A;  4ZJW A;  3OZ0 A;  3R5N A;  4ONI A;  1XVP B;  2AX6 A;  4PRG A;  3VN2 A;  3BEJ A;  3CTB A;  5DX3 B;  1RDT D;  2QXM A;  4YPQ A;  2ZNP A;  4OZT U;  2XYJ A;  3CS6 A;  5AK2 A;  2OM9 A;  3E00 A;  3MNE A;  1FM6 D;  3X36 A;  4YNK A;  5DV6 A;  4M8H A;  3CDS A;  5EIT A;  2ZMJ A;  2PNU A;  2QA8 B;  4KZJ A;  2B23 A;  2ZMI A;  1S0X A;  3L0J A;  5DTV A;  4A4V A;  5HYK A;  2O4R A;  1M7W A;  1XV9 B;  2GPP A;  2Q6J A;  2VV3 A;  3EYB A;  2QPY A;  3F7D A;  1XDK B;  1XQC A;  3AUN A;  3FAL A;  3VJS A;  3VT8 A;  2J7X A;  4N1Y A;  5DXK A;  1M2Z A;  3FC6 A;  5JY3 A;  3R8A A;  3UVV B;  4PXM A;  4UDB A;  4J5W C;  1I7I A;  1S0Z A;  3B68 A;  4IU7 A;  3RVF A;  4XHD A;  2ZY0 A;  1R20 D;  3VT9 A;  3D5F A;  3M7R A;  2P7G A;  4G21 A;  1RJK A;  3A78 A;  4OIU A;  3UUA B;  4F9M A;  3DZY D;  1KV6 A;  5C4O A;  3OAP A;  5KRJ A;  3AFR A;  3E7C A;  3OLS A;  1L2I A;  2IOG A;  2GPV A;  2Q5G A;  4OIL A;  1RDT A;  3FLI A;  4A2J A;  1U3R A;  2Q3Y A;  4PPS A;  2BJ4 A;  4LNX A;  4KZI A;  1H9U A;  4WHF A;  2P1V A;  4YT1 A;  1Y9R A;  4LTW A;  4MG8 A;  3SZ1 A;  4RME A;  2AO6 A;  3SP6 A;  2Q59 B;  1FM6 A;  3UUD B;  1LV2 A;  3B3K A;  3W5Q A;  3OS8 A;  1T76 A;  4BCR A;  1Y0S A;  1A28 A;  4NY9 A;  3LBD A;  3GWS X;  2VV4 A;  1T5Z A;  3ERD A;  4KZM A;  1MVC A;  4OK1 A;  1Y0X X;  2GPU A;  2P7A A;  2PIN A;  4OKT A;  4RWV A;  2FSZ A;  2ZK6 A;  1RKH A;  1XNX A;  4OJ4 A;  4WPF A;  1X7R A;  1SKX A;  1RK3 A;  2R40 D;  2H77 A;  3W5P A;  4PPP A;  3VT4 A;  1K4W A;  4E4Q A;  5GT4 A;  2I4J A;  1UHL B;  2YJA B;  2PIU A;  3PLZ A;  2R6Y A;  4OKB A;  4PLE A;  4CI4 A;  3H52 A;  5E15 A;  4Y29 A;  2B1V A;  2QTU A;  3P0U A;  4X1F A;  5FQP A;  2HBH A;  3DCT A;  2QZO A;  4IA1 A;  4IA2 A;  3OSI A;  4IUI A;  2HAM A;  2YHD A;  4IV2 A;  4N5G A;  4RZG A;  5DV8 A;  5H1E A;  3WFG A;  1GWR A;  3A3Z X;  1T79 A;  5L7E A;  1A52 A;  4PWL A;  3WT7 A;  2Q7I A;  4RMC A;  4HEE X;  4QJR A;  1YIM A;  3ZRA A;  3CQV A;  1T65 A;  3GYU A;  1G1U A;  2AYR A;  3N00 A;  4IWF A;  1SR7 A;  5SYZ A;  2VV0 A;  1QKU A;  2ZLC A;  4OLM A;  5IAW A;  5G44 A;  1FD0 A;  3IPQ A;  5DXB A;  1E3K A;  1TXI A;  1ZGY A;  4MGD A;  5L7H A;  3VT7 A;  4P6W A;  2YLP A;  4FN9 A;  4ZNH A;  3RY9 A;  3CS4 A;  4J5W A;  4IQR A;  2E2R A;  4FNE A;  1Z5X E;  1QKN A;  4NB6 A;  1BSX A;  1LBD A;  3GWX A;  4FHI A;  1T7R A;  4MG6 A;  3VSP A;  3ET0 A;  3AN3 A; 
#chains in the Genus database with same CATH topology
 5G43 A;  5DXG A;  4TV1 B;  5EC9 A;  1XQ3 A;  4MGA A;  2R40 A;  4DK8 A;  2P1U A;  2ZK3 A;  3CLD A;  4LNW A;  1YY4 A;  5JJM B;  4R06 A;  3FS1 A;  4OGH A;  2AA5 A;  3HVL A;  2Q61 A;  3D57 A;  4FHH A;  3W5T A;  5KCT A;  5I4V A;  5AZT A;  3OSW A;  1XPC A;  2P4Y A;  2Q5S A;  5AAV A;  4TUZ B;  5KCW A;  3AZ3 A;  2ZK2 A;  3IXP D;  1IE9 A;  2AMA A;  1YJE A;  5APK A;  1EXX A;  4Q50 A;  5DXE A;  4OKX A;  3W0I A;  3V9Y A;  2P54 A;  1U3Q A;  1M13 A;  1K7L A;  4HLW A;  3TKM A;  2HAR A;  3HC6 A;  5E0W A;  3IMY A;  1MV9 A;  2YJD A;  3P88 A;  2QSE A;  4OJB A;  3V4A A;  1T63 A;  1RKG A;  4ITE A;  5LGA A;  3OOF A;  5KRC A;  3B1M A;  1ZAF A;  5DLR A;  1XP1 A;  3R2A A;  2AX9 A;  3UU7 B;  3A2I A;  1HJ1 A;  4J5X C;  3AN4 A;  2OVM A;  5G45 A;  3OMP A;  1I38 A;  3B65 A;  2Z4J A;  3A9E B;  4MG7 B;  4FGY A;  4Q0A C;  3AX8 A;  3KFC A;  4LSJ A;  2GTK A;  3FC6 B;  4WHG A;  3WTQ A;  3DT3 A;  2YLO A;  3WJ5 A;  4JYH A;  3ERT A;  4S0S A;  3G9E A;  4K6I A;  4RMD A;  2ZNO A;  3KDT A;  2Q6S A;  3X31 A;  3S9S A;  2J4A A;  3A40 X;  4ZNS A;  3V9V A;  5HZC A;  1G2N A;  2AB2 A;  3B0Q A;  3GD2 A;  3R29 A;  4L96 A;  1NDE A;  2GP7 A;  3RUT A;  3B0W A;  1UPW A;  1XB7 A;  3VHW A;  3WT6 A;  5KRO A;  4PF3 A;  3IXP A;  1ZKY A;  3JZB A;  2VSR A;  1XOW A;  4XT9 A;  5C4U A;  5AYG A;  4OC7 A;  5DKE A;  3VJT A;  1R5K A;  1Z95 A;  1XLS E;  1OVL B;  1YA3 A;  1U3S A;  3L3Z A;  4REF A;  4ZOM A;  4MG8 B;  1FM9 A;  4IA7 A;  3FUG A;  5DZ0 A;  2ACL A;  4ZO1 B;  1FCZ A;  4RZF A;  3Q95 A;  5DUG A;  2ZVT A;  5DVV A;  5KYJ A;  4RZE A;  2AX7 A;  2Z4B A;  4MGB A;  2Q1V A;  4OED A;  3L0L A;  1XJ7 A;  4J24 A;  3DCU A;  5E14 A;  1NQ7 A;  3H0A D;  4NUF A;  4XUM A;  1FCX A;  5IXK A;  4ZNW A;  4ZNU A;  1XVP A;  3TX7 B;  4POJ A;  3D90 A;  3QT0 A;  5DX3 A;  3OS9 A;  3F5C B;  2FAI A;  1QKM A;  3L0E A;  5KYA A;  1XP6 A;  3HO0 A;  2ZXN A;  2JFA A;  2OUZ A;  2OAX A;  5DXM A;  1ILH A;  3KMG A;  4QK4 A;  2Q7J A;  2HFP A;  1PCG A;  3B0R A;  3AUQ A;  4ZI1 A;  5HYR A;  3A2J A;  5EGV A;  2ATH A;  1XP9 A;  5L11 A;  2QA8 A;  5AVI A;  3L1B A;  4OZR U;  3G8I A;  4G1D A;  2AM9 A;  2ZAS A;  1GWX A;  1XV9 A;  2HB8 A;  1I7G A;  1E3G A;  3GBK A;  5GID A;  1XDK A;  3HZF A;  3OLL A;  5AAU A;  5DUE A;  5FQT A;  3T03 A;  4J5X A;  4RUP A;  3V3Q A;  1XZX X;  2NXX E;  2O9I A;  3ADS A;  3D6D A;  3VT6 A;  4OH6 A;  2QGT A;  2QMV A;  2YFE A;  3VTC A;  2POG A;  4REE A;  1PQ9 A;  3B66 A;  5DU5 A;  1NYX A;  5KRF A;  2ZKC A;  1EXA A;  4N8R A;  5G5W A;  3UVV A;  3VJI A;  4DOS A;  2HB7 A;  3IA6 A;  5ETH A;  3DZU D;  2XHS A;  3V3E A;  2Q8S A;  4MGC A;  1R20 A;  2NV7 A;  3ET3 A;  4OKW A;  2XKW A;  1T7M A;  5DIG A;  5E19 A;  3TY0 A;  2G0G A;  5KR9 A;  3DZY A;  3UUA A;  4MG9 B;  3KPZ A;  3WMH A;  1NRL A;  4ZJR A;  2ZXZ A;  1R1K D;  4ITF A;  2Q60 A;  1R6G A;  3PCU A;  5HJP B;  2XYX A;  3OMK A;  2GIU A;  4IS8 A;  3KDU A;  5KCU A;  2G44 A;  2ZK0 A;  2AAX A;  3KMR A;  5DP0 A;  3WGP A;  4M8E A;  3LMP A;  3ZR7 A;  4E4K A;  4G2I A;  1S9P A;  1SQN A;  4PP3 A;  2Q59 A;  5DWI A;  2OVH A;  3UUD A;  1DKF B;  1G50 A;  3ILZ A;  3W0J A;  5KRK A;  2QE4 A;  2POB A;  4OJ9 A;  3W0C A;  3NOA A;  4G1Z A;  2HAS A;  3AUR A;  1X78 A;  2HC4 A;  1ZUC A;  3UP3 A;  4EMA A;  1PQC A;  2VV1 A;  2OCF A;  2GPO A;  5A86 A;  2ZBS A;  3B0T A;  2GWX A;  4A4W A;  1NQ1 A;  2Q5P A;  2A3I A;  4XUH A;  2PIV A;  3OMQ A;  2P7Z A;  3OMM A;  3A2H A;  1G5Y A;  1NQ2 A;  5DXR A;  1T7T A;  1S19 A;  4S0T A;  3R8D A;  2AA6 A;  1X7B A;  1UHL A;  2VV2 A;  3ET1 A;  4OFU A;  5DVS A;  5JI0 D;  4G2H A;  3DZU A;  3FXV A;  4LBD A;  1DB1 A;  2B50 A;  2Q7L A;  2B1Z A;  4ZNT A;  1T7F A;  3HQ5 A;  3KMZ A;  3W5R A;  5C4T A;  1ERR A;  1PZL A;  2AMB A;  3B5R A;  4XI3 A;  1PDU A;  2J14 A;  1QKT A;  2ZK4 A;  1R1K A;  2ABI A;  1YP0 A;  3AZ2 A;  5DWE A;  2ZLA A;  2AWH A;  5DXQ A;  1NHZ A;  1MZN A;  5APJ A;  4DM8 A;  3K22 A;  1WM0 X;  2P1T A;  5DZ3 A;  2QA6 A;  5CJ6 A;  5DXP A;  3GN8 A;  3PO9 A;  4RUJ A;  3ZQT A;  4B7W A;  2JJ3 A;  4QE6 A;  3FAL B;  2P15 A;  5M96 A;  4UDC A;  3P89 A;  1XNN A;  1L2J A;  1X76 A;  3VI8 A;  5DRM A;  3CDP A;  4JGV A;  1X7E A;  2QXS A;  2I4Z A;  1GS4 A;  1P8D A;  5B5B A;  3B67 A;  1XLS A;  3OS8 C;  4PP5 A;  5E1C A;  1T74 A;  5DVC A;  5LWP A;  4S15 A;  5ACC A;  4TV1 A;  5KCE A;  2PIO A;  4G20 A;  4JAZ A;  4OAR A;  4PP6 A;  5DRJ A;  5AWJ A;  3K23 A;  5JJM A;  5DKG A;  5L7G A;  4OHA A;  5DWL A;  3ADT A;  2ZXM A;  5K13 A;  2HWR A;  3HM1 A;  3NSQ A;  3X1H A;  2IHQ A;  4TUZ A;  4WLB A;  4NQA B;  5HJS A;  4EM9 A;  1I37 A;  3AZ1 A;  4K4J A;  1ERE A;  4JYI A;  3WT5 A;  3OSA A;  1PRG A;  1ZDT A;  1YYE A;  2BJ4 B;  2NW4 A;  2ZMH A;  4S14 A;  1NAV A;  4ZO1 X;  4WVD A;  2JFA B;  5DMF A;  5EI1 A;  1IE8 A;  3VRT A;  3VRV A;  2R6W A;  3PBA A;  5DWJ A;  1N46 A;  4IW6 A;  2I0J A;  4ZN7 A;  4IWC A;  2Q70 A;  3DY6 A;  5APH A;  4QM0 A;  1N83 A;  3GZ9 A;  5AZV A;  4R6S A;  4ZN9 A;  5E7V A;  3ADW A;  4CSJ A;  1ZDU A;  2VV4 B;  3OOK A;  5DID A;  2QR9 A;  3WJ4 A;  3UU7 A;  3E94 A;  2HVC A;  1Q4X A;  4NIE A;  4O8F A;  3PEQ A;  4XTA A;  3D24 A;  1OSV A;  4OZT E;  4E2J A;  5E0X A;  3RLL A;  2JF9 A;  3VHU A;  3A9E A;  4MG7 A;  5DUH A;  4MDD A;  1SJ0 A;  1NQ0 A;  4JYG A;  3ZRB A;  3MNO A;  2G0H A;  4OH5 A;  2OZ7 A;  4CI5 A;  1FCY A;  2NXX A;  3PRG A;  3KYT A;  4N73 A;  2NPA A;  2ZNN A;  3CS8 A;  3FEJ A;  3HOD A;  3KBA A;  4OFR A;  4UDD A;  5DK9 A;  3OKH A;  2H79 A;  5B41 A;  3U9Q A;  4OEY A;  2QZO B;  3O1E A;  3OLF A;  2PJL A;  4RAK A;  4RUO X;  3VJH A;  1ILG A;  5ICK A;  2QW4 A;  5DMC A;  1OSH A;  4OIV A;  3UUC A;  2QH6 A;  4DK7 A;  4DM6 A;  3JZC A;  3CJW A;  5HCV A;  3VTD A;  1UOM A;  1KNU A;  2YLQ A;  4JL4 A;  5F9B A;  4RE8 A;  4XAO A;  2REW A;  1OVL A;  3VRW A;  5KRL A;  3DR1 A;  1K74 D;  4MG5 A;  5AVL A;  4DMA A;  4L98 A;  3ET2 A;  2BAW A;  3UP0 A;  2ZFX A;  3O1D A;  1KKQ A;  1OT7 A;  1VJB A;  1T73 A;  3FUR A;  2F4B A;  4XLD A;  2HCD A;  4ZNV A;  5DXB B;  2YLY A;  4MGD B;  3V49 A;  5DV3 A;  3ADV A;  2Q1H A;  3OMO A;  1YMT A;  5EJV A;  3VT3 A;  3WFF A;  4R2U A;  2AA2 A;  3BC5 A;  3L3X A;  4RFW A;  4X1G A;  2AX8 A;  2VV1 B;  2YAT A;  3H0A A;  2PIW A;  5FQV A;  3OZJ A;  2V7C A;  2GL8 A;  1HG4 A;  5EHJ A;  1PQ6 A;  1Z5X U;  2PIX A;  4MGA B;  5FQS A;  1YUC A;  1NAX A;  3FEI A;  2ZK1 A;  3F5C A;  2PIR A;  3W0G A;  2PIT A;  4APU A;  4J26 A;  4K7A A;  5DKB A;  3R8I A;  5DYB A;  4IA3 A;  5AAV B;  4POH A;  1YIN A;  5AWK A;  4IW8 A;  5KCF A;  5KRI A;  3WWR A;  5DL4 A;  2XYW A;  1XAP A;  1S9Q A;  4OZR E;  4YMQ A;  4DQM A;  4G1Y A;  3G8O A;  4IV4 A;  4OEZ A;  3G0W A;  3W0H A;  3V9T A;  4Q13 A;  2LBD A;  3K8S A;  3ADU A;  2PRG A;  1NUO A;  5DKS A;  1XIU A;  2PKL A;  2QGW A;  3HC5 A;  3W0Y A;  1ZH7 A;  4PLD A;  3BQD A;  2HWQ A;  3L03 A;  1GWQ A;  2G5O A;  3R5M A;  3MNP A;  3IPS A;  5DY8 A;  1N4H A;  3CWD A;  3P8X A;  5KCD A;  5C4S A;  1K74 A;  3ADX A;  3X1I A;  5DZ1 A;  1YOW A;  2QNV A;  2ZNQ A;  3W0A A;  2ZK5 A;  3GYT A;  1YOK A;  2EWP A;  5FQR A;  3VRU A;  5DZI A;  3VTB A;  5DI7 A;  3VHV A;  3VT5 A;  2IOK A;  4IVY A;  5DIE A;  5G3J A;  3K6P A;  5GIE A;  4MG9 A;  2W8Y A;  5KRA A;  1P93 A;  2FVJ A;  3HLV A;  3E00 D;  2I0G A;  1TFC A;  3KWY A;  5HJP A;  5KCC A;  2Q6R A;  2J7Y A;  1PK5 A;  2I4P A;  2O4J A;  1FBY A;  2Q7K A;  2V0V A;  2ZL9 A;  4IVW A;  4DOR A;  4PVU A;  1ZEO A;  5KRH A;  1DKF A;  5DYD A;  4QL8 A;  3TKC A;  3RLJ A;  5IZ0 A;  3OGT A;  2QAB A;  3OKI A;  3RUU A;  3VSO A;  5KRM A;  1UPV A;  3SP9 A;  2ACL B;  3IPU A;  1FM9 D;  3NSP A;  4OEA A;  4QE8 A;  1U9E A;  4P6X A;  5DZH A;  3Q95 B;  2PIP L;  5DSH A;  2AA7 A;  5G46 A;  5DWG A;  4MGB B;  5KD9 A;  2VST A;  4UDA A;  5GIC A;  1X7J A;  5G42 A;  2AXA A;  4WQP A;  2PIQ A;  4ZJW A;  3OZ0 A;  3R5N A;  4ONI A;  1XVP B;  2AX6 A;  4PRG A;  3VN2 A;  3BEJ A;  3CTB A;  5DX3 B;  1RDT D;  2QXM A;  4YPQ A;  2ZNP A;  4OZT U;  2XYJ A;  3CS6 A;  5AK2 A;  2OM9 A;  3E00 A;  3MNE A;  1FM6 D;  3X36 A;  4YNK A;  5DV6 A;  4M8H A;  3CDS A;  5EIT A;  2ZMJ A;  2PNU A;  2QA8 B;  4KZJ A;  2B23 A;  2ZMI A;  1S0X A;  3L0J A;  5DTV A;  4A4V A;  5HYK A;  2O4R A;  1M7W A;  1XV9 B;  2GPP A;  2Q6J A;  2VV3 A;  3EYB A;  2QPY A;  3F7D A;  1XDK B;  1XQC A;  3AUN A;  3FAL A;  3VJS A;  3VT8 A;  2J7X A;  4N1Y A;  5DXK A;  1M2Z A;  3FC6 A;  5JY3 A;  3R8A A;  3UVV B;  4PXM A;  4UDB A;  4J5W C;  1I7I A;  1S0Z A;  3B68 A;  4IU7 A;  3RVF A;  4XHD A;  2ZY0 A;  1R20 D;  3VT9 A;  3D5F A;  3M7R A;  2P7G A;  4G21 A;  1RJK A;  3A78 A;  4OIU A;  3UUA B;  4F9M A;  3DZY D;  1KV6 A;  5C4O A;  3OAP A;  5KRJ A;  3AFR A;  3E7C A;  3OLS A;  1L2I A;  2IOG A;  2GPV A;  2Q5G A;  4OIL A;  1RDT A;  3FLI A;  4A2J A;  1U3R A;  2Q3Y A;  4PPS A;  2BJ4 A;  4LNX A;  4KZI A;  1H9U A;  4WHF A;  2P1V A;  4YT1 A;  1Y9R A;  4LTW A;  4MG8 A;  3SZ1 A;  4RME A;  2AO6 A;  3SP6 A;  2Q59 B;  1FM6 A;  3UUD B;  1LV2 A;  3B3K A;  3W5Q A;  3OS8 A;  1T76 A;  4BCR A;  1Y0S A;  1A28 A;  4NY9 A;  3LBD A;  3GWS X;  2VV4 A;  1T5Z A;  3ERD A;  4KZM A;  1MVC A;  4OK1 A;  1Y0X X;  2GPU A;  2P7A A;  2PIN A;  4OKT A;  4RWV A;  2FSZ A;  2ZK6 A;  1RKH A;  1XNX A;  4OJ4 A;  4WPF A;  1X7R A;  1SKX A;  1RK3 A;  2R40 D;  2H77 A;  3W5P A;  4PPP A;  3VT4 A;  1K4W A;  4E4Q A;  5GT4 A;  2I4J A;  1UHL B;  2YJA B;  2PIU A;  3PLZ A;  2R6Y A;  4OKB A;  4PLE A;  4CI4 A;  3H52 A;  5E15 A;  4Y29 A;  2B1V A;  2QTU A;  3P0U A;  4X1F A;  5FQP A;  2HBH A;  3DCT A;  2QZO A;  4IA1 A;  4IA2 A;  3OSI A;  4IUI A;  2HAM A;  2YHD A;  4IV2 A;  4N5G A;  4RZG A;  5DV8 A;  5H1E A;  3WFG A;  1GWR A;  3A3Z X;  1T79 A;  5L7E A;  1A52 A;  4PWL A;  3WT7 A;  2Q7I A;  4RMC A;  4HEE X;  4QJR A;  1YIM A;  3ZRA A;  3CQV A;  1T65 A;  3GYU A;  1G1U A;  2AYR A;  3N00 A;  4IWF A;  1SR7 A;  5SYZ A;  2VV0 A;  1QKU A;  2ZLC A;  4OLM A;  5IAW A;  5G44 A;  1FD0 A;  3IPQ A;  5DXB A;  1E3K A;  1TXI A;  1ZGY A;  4MGD A;  5L7H A;  3VT7 A;  4P6W A;  2YLP A;  4FN9 A;  4ZNH A;  3RY9 A;  3CS4 A;  4J5W A;  4IQR A;  2E2R A;  4FNE A;  1Z5X E;  1QKN A;  4NB6 A;  1BSX A;  1LBD A;  3GWX A;  4FHI A;  1T7R A;  4MG6 A;  3VSP A;  3ET0 A;  3AN3 A; 
#chains in the Genus database with same CATH homology
 5G43 A;  5DXG A;  4TV1 B;  5EC9 A;  1XQ3 A;  4MGA A;  2R40 A;  4DK8 A;  2P1U A;  2ZK3 A;  3CLD A;  4LNW A;  1YY4 A;  5JJM B;  4R06 A;  3FS1 A;  4OGH A;  2AA5 A;  3HVL A;  2Q61 A;  3D57 A;  4FHH A;  3W5T A;  5KCT A;  5I4V A;  5AZT A;  3OSW A;  1XPC A;  2P4Y A;  2Q5S A;  5AAV A;  4TUZ B;  5KCW A;  3AZ3 A;  2ZK2 A;  3IXP D;  1IE9 A;  2AMA A;  1YJE A;  5APK A;  1EXX A;  4Q50 A;  5DXE A;  4OKX A;  3W0I A;  3V9Y A;  2P54 A;  1U3Q A;  1M13 A;  1K7L A;  4HLW A;  3TKM A;  2HAR A;  3HC6 A;  5E0W A;  3IMY A;  1MV9 A;  2YJD A;  3P88 A;  2QSE A;  4OJB A;  3V4A A;  1T63 A;  1RKG A;  4ITE A;  5LGA A;  3OOF A;  5KRC A;  3B1M A;  1ZAF A;  5DLR A;  1XP1 A;  3R2A A;  2AX9 A;  3UU7 B;  3A2I A;  1HJ1 A;  4J5X C;  3AN4 A;  2OVM A;  5G45 A;  3OMP A;  1I38 A;  3B65 A;  2Z4J A;  3A9E B;  4MG7 B;  4FGY A;  4Q0A C;  3AX8 A;  3KFC A;  4LSJ A;  2GTK A;  3FC6 B;  4WHG A;  3WTQ A;  3DT3 A;  2YLO A;  3WJ5 A;  4JYH A;  3ERT A;  4S0S A;  3G9E A;  4K6I A;  4RMD A;  2ZNO A;  3KDT A;  2Q6S A;  3X31 A;  3S9S A;  2J4A A;  3A40 X;  4ZNS A;  3V9V A;  5HZC A;  1G2N A;  2AB2 A;  3B0Q A;  3GD2 A;  3R29 A;  4L96 A;  1NDE A;  2GP7 A;  3RUT A;  3B0W A;  1UPW A;  1XB7 A;  3VHW A;  3WT6 A;  5KRO A;  4PF3 A;  3IXP A;  1ZKY A;  3JZB A;  2VSR A;  1XOW A;  4XT9 A;  5C4U A;  5AYG A;  4OC7 A;  5DKE A;  3VJT A;  1R5K A;  1Z95 A;  1XLS E;  1OVL B;  1YA3 A;  1U3S A;  3L3Z A;  4REF A;  4ZOM A;  4MG8 B;  1FM9 A;  4IA7 A;  3FUG A;  5DZ0 A;  2ACL A;  4ZO1 B;  1FCZ A;  4RZF A;  3Q95 A;  5DUG A;  2ZVT A;  5DVV A;  5KYJ A;  4RZE A;  2AX7 A;  2Z4B A;  4MGB A;  2Q1V A;  4OED A;  3L0L A;  1XJ7 A;  4J24 A;  3DCU A;  5E14 A;  1NQ7 A;  3H0A D;  4NUF A;  4XUM A;  1FCX A;  5IXK A;  4ZNW A;  4ZNU A;  1XVP A;  3TX7 B;  4POJ A;  3D90 A;  3QT0 A;  5DX3 A;  3OS9 A;  3F5C B;  2FAI A;  1QKM A;  3L0E A;  5KYA A;  1XP6 A;  3HO0 A;  2ZXN A;  2JFA A;  2OUZ A;  2OAX A;  5DXM A;  1ILH A;  3KMG A;  4QK4 A;  2Q7J A;  2HFP A;  1PCG A;  3B0R A;  3AUQ A;  4ZI1 A;  5HYR A;  3A2J A;  5EGV A;  2ATH A;  1XP9 A;  5L11 A;  2QA8 A;  5AVI A;  3L1B A;  4OZR U;  3G8I A;  4G1D A;  2AM9 A;  2ZAS A;  1GWX A;  1XV9 A;  2HB8 A;  1I7G A;  1E3G A;  3GBK A;  5GID A;  1XDK A;  3HZF A;  3OLL A;  5AAU A;  5DUE A;  5FQT A;  3T03 A;  4J5X A;  4RUP A;  3V3Q A;  1XZX X;  2NXX E;  2O9I A;  3ADS A;  3D6D A;  3VT6 A;  4OH6 A;  2QGT A;  2QMV A;  2YFE A;  3VTC A;  2POG A;  4REE A;  1PQ9 A;  3B66 A;  5DU5 A;  1NYX A;  5KRF A;  2ZKC A;  1EXA A;  4N8R A;  5G5W A;  3UVV A;  3VJI A;  4DOS A;  2HB7 A;  3IA6 A;  5ETH A;  3DZU D;  2XHS A;  3V3E A;  2Q8S A;  4MGC A;  1R20 A;  2NV7 A;  3ET3 A;  4OKW A;  2XKW A;  1T7M A;  5DIG A;  5E19 A;  3TY0 A;  2G0G A;  5KR9 A;  3DZY A;  3UUA A;  4MG9 B;  3KPZ A;  3WMH A;  1NRL A;  4ZJR A;  2ZXZ A;  1R1K D;  4ITF A;  2Q60 A;  1R6G A;  3PCU A;  5HJP B;  2XYX A;  3OMK A;  2GIU A;  4IS8 A;  3KDU A;  5KCU A;  2G44 A;  2ZK0 A;  2AAX A;  3KMR A;  5DP0 A;  3WGP A;  4M8E A;  3LMP A;  3ZR7 A;  4E4K A;  4G2I A;  1S9P A;  1SQN A;  4PP3 A;  2Q59 A;  5DWI A;  2OVH A;  3UUD A;  1DKF B;  1G50 A;  3ILZ A;  3W0J A;  5KRK A;  2QE4 A;  2POB A;  4OJ9 A;  3W0C A;  3NOA A;  4G1Z A;  2HAS A;  3AUR A;  1X78 A;  2HC4 A;  1ZUC A;  3UP3 A;  4EMA A;  1PQC A;  2VV1 A;  2OCF A;  2GPO A;  5A86 A;  2ZBS A;  3B0T A;  2GWX A;  4A4W A;  1NQ1 A;  2Q5P A;  2A3I A;  4XUH A;  2PIV A;  3OMQ A;  2P7Z A;  3OMM A;  3A2H A;  1G5Y A;  1NQ2 A;  5DXR A;  1T7T A;  1S19 A;  4S0T A;  3R8D A;  2AA6 A;  1X7B A;  1UHL A;  2VV2 A;  3ET1 A;  4OFU A;  5DVS A;  5JI0 D;  4G2H A;  3DZU A;  3FXV A;  4LBD A;  1DB1 A;  2B50 A;  2Q7L A;  2B1Z A;  4ZNT A;  1T7F A;  3HQ5 A;  3KMZ A;  3W5R A;  5C4T A;  1ERR A;  1PZL A;  2AMB A;  3B5R A;  4XI3 A;  1PDU A;  2J14 A;  1QKT A;  2ZK4 A;  1R1K A;  2ABI A;  1YP0 A;  3AZ2 A;  5DWE A;  2ZLA A;  2AWH A;  5DXQ A;  1NHZ A;  1MZN A;  5APJ A;  4DM8 A;  3K22 A;  1WM0 X;  2P1T A;  5DZ3 A;  2QA6 A;  5CJ6 A;  5DXP A;  3GN8 A;  3PO9 A;  4RUJ A;  3ZQT A;  4B7W A;  2JJ3 A;  4QE6 A;  3FAL B;  2P15 A;  5M96 A;  4UDC A;  3P89 A;  1XNN A;  1L2J A;  1X76 A;  3VI8 A;  5DRM A;  3CDP A;  4JGV A;  1X7E A;  2QXS A;  2I4Z A;  1GS4 A;  1P8D A;  5B5B A;  3B67 A;  1XLS A;  3OS8 C;  4PP5 A;  5E1C A;  1T74 A;  5DVC A;  5LWP A;  4S15 A;  5ACC A;  4TV1 A;  5KCE A;  2PIO A;  4G20 A;  4JAZ A;  4OAR A;  4PP6 A;  5DRJ A;  5AWJ A;  3K23 A;  5JJM A;  5DKG A;  5L7G A;  4OHA A;  5DWL A;  3ADT A;  2ZXM A;  5K13 A;  2HWR A;  3HM1 A;  3NSQ A;  3X1H A;  2IHQ A;  4TUZ A;  4WLB A;  4NQA B;  5HJS A;  4EM9 A;  1I37 A;  3AZ1 A;  4K4J A;  1ERE A;  4JYI A;  3WT5 A;  3OSA A;  1PRG A;  1ZDT A;  1YYE A;  2BJ4 B;  2NW4 A;  2ZMH A;  4S14 A;  1NAV A;  4ZO1 X;  4WVD A;  2JFA B;  5DMF A;  5EI1 A;  1IE8 A;  3VRT A;  3VRV A;  2R6W A;  3PBA A;  5DWJ A;  1N46 A;  4IW6 A;  2I0J A;  4ZN7 A;  4IWC A;  2Q70 A;  3DY6 A;  5APH A;  4QM0 A;  1N83 A;  3GZ9 A;  5AZV A;  4R6S A;  4ZN9 A;  5E7V A;  3ADW A;  4CSJ A;  1ZDU A;  2VV4 B;  3OOK A;  5DID A;  2QR9 A;  3WJ4 A;  3UU7 A;  3E94 A;  2HVC A;  1Q4X A;  4NIE A;  4O8F A;  3PEQ A;  4XTA A;  3D24 A;  1OSV A;  4OZT E;  4E2J A;  5E0X A;  3RLL A;  2JF9 A;  3VHU A;  3A9E A;  4MG7 A;  5DUH A;  4MDD A;  1SJ0 A;  1NQ0 A;  4JYG A;  3ZRB A;  3MNO A;  2G0H A;  4OH5 A;  2OZ7 A;  4CI5 A;  1FCY A;  2NXX A;  3PRG A;  3KYT A;  4N73 A;  2NPA A;  2ZNN A;  3CS8 A;  3FEJ A;  3HOD A;  3KBA A;  4OFR A;  4UDD A;  5DK9 A;  3OKH A;  2H79 A;  5B41 A;  3U9Q A;  4OEY A;  2QZO B;  3O1E A;  3OLF A;  2PJL A;  4RAK A;  4RUO X;  3VJH A;  1ILG A;  5ICK A;  2QW4 A;  5DMC A;  1OSH A;  4OIV A;  3UUC A;  2QH6 A;  4DK7 A;  4DM6 A;  3JZC A;  3CJW A;  5HCV A;  3VTD A;  1UOM A;  1KNU A;  2YLQ A;  4JL4 A;  5F9B A;  4RE8 A;  4XAO A;  2REW A;  1OVL A;  3VRW A;  5KRL A;  3DR1 A;  1K74 D;  4MG5 A;  5AVL A;  4DMA A;  4L98 A;  3ET2 A;  2BAW A;  3UP0 A;  2ZFX A;  3O1D A;  1KKQ A;  1OT7 A;  1VJB A;  1T73 A;  3FUR A;  2F4B A;  4XLD A;  2HCD A;  4ZNV A;  5DXB B;  2YLY A;  4MGD B;  3V49 A;  5DV3 A;  3ADV A;  2Q1H A;  3OMO A;  1YMT A;  5EJV A;  3VT3 A;  3WFF A;  4R2U A;  2AA2 A;  3BC5 A;  3L3X A;  4RFW A;  4X1G A;  2AX8 A;  2VV1 B;  2YAT A;  3H0A A;  2PIW A;  5FQV A;  3OZJ A;  2V7C A;  2GL8 A;  1HG4 A;  5EHJ A;  1PQ6 A;  1Z5X U;  2PIX A;  4MGA B;  5FQS A;  1YUC A;  1NAX A;  3FEI A;  2ZK1 A;  3F5C A;  2PIR A;  3W0G A;  2PIT A;  4APU A;  4J26 A;  4K7A A;  5DKB A;  3R8I A;  5DYB A;  4IA3 A;  5AAV B;  4POH A;  1YIN A;  5AWK A;  4IW8 A;  5KCF A;  5KRI A;  3WWR A;  5DL4 A;  2XYW A;  1XAP A;  1S9Q A;  4OZR E;  4YMQ A;  4DQM A;  4G1Y A;  3G8O A;  4IV4 A;  4OEZ A;  3G0W A;  3W0H A;  3V9T A;  4Q13 A;  2LBD A;  3K8S A;  3ADU A;  2PRG A;  1NUO A;  5DKS A;  1XIU A;  2PKL A;  2QGW A;  3HC5 A;  3W0Y A;  1ZH7 A;  4PLD A;  3BQD A;  2HWQ A;  3L03 A;  1GWQ A;  2G5O A;  3R5M A;  3MNP A;  3IPS A;  5DY8 A;  1N4H A;  3CWD A;  3P8X A;  5KCD A;  5C4S A;  1K74 A;  3ADX A;  3X1I A;  5DZ1 A;  1YOW A;  2QNV A;  2ZNQ A;  3W0A A;  2ZK5 A;  3GYT A;  1YOK A;  2EWP A;  5FQR A;  3VRU A;  5DZI A;  3VTB A;  5DI7 A;  3VHV A;  3VT5 A;  2IOK A;  4IVY A;  5DIE A;  5G3J A;  3K6P A;  5GIE A;  4MG9 A;  2W8Y A;  5KRA A;  1P93 A;  2FVJ A;  3HLV A;  3E00 D;  2I0G A;  1TFC A;  3KWY A;  5HJP A;  5KCC A;  2Q6R A;  2J7Y A;  1PK5 A;  2I4P A;  2O4J A;  1FBY A;  2Q7K A;  2V0V A;  2ZL9 A;  4IVW A;  4DOR A;  4PVU A;  1ZEO A;  5KRH A;  1DKF A;  5DYD A;  4QL8 A;  3TKC A;  3RLJ A;  5IZ0 A;  3OGT A;  2QAB A;  3OKI A;  3RUU A;  3VSO A;  5KRM A;  1UPV A;  3SP9 A;  2ACL B;  3IPU A;  1FM9 D;  3NSP A;  4OEA A;  4QE8 A;  1U9E A;  4P6X A;  5DZH A;  3Q95 B;  2PIP L;  5DSH A;  2AA7 A;  5G46 A;  5DWG A;  4MGB B;  5KD9 A;  2VST A;  4UDA A;  5GIC A;  1X7J A;  5G42 A;  2AXA A;  4WQP A;  2PIQ A;  4ZJW A;  3OZ0 A;  3R5N A;  4ONI A;  1XVP B;  2AX6 A;  4PRG A;  3VN2 A;  3BEJ A;  3CTB A;  5DX3 B;  1RDT D;  2QXM A;  4YPQ A;  2ZNP A;  4OZT U;  2XYJ A;  3CS6 A;  5AK2 A;  2OM9 A;  3E00 A;  3MNE A;  1FM6 D;  3X36 A;  4YNK A;  5DV6 A;  4M8H A;  3CDS A;  5EIT A;  2ZMJ A;  2PNU A;  2QA8 B;  4KZJ A;  2B23 A;  2ZMI A;  1S0X A;  3L0J A;  5DTV A;  4A4V A;  5HYK A;  2O4R A;  1M7W A;  1XV9 B;  2GPP A;  2Q6J A;  2VV3 A;  3EYB A;  2QPY A;  3F7D A;  1XDK B;  1XQC A;  3AUN A;  3FAL A;  3VJS A;  3VT8 A;  2J7X A;  4N1Y A;  5DXK A;  1M2Z A;  3FC6 A;  5JY3 A;  3R8A A;  3UVV B;  4PXM A;  4UDB A;  4J5W C;  1I7I A;  1S0Z A;  3B68 A;  4IU7 A;  3RVF A;  4XHD A;  2ZY0 A;  1R20 D;  3VT9 A;  3D5F A;  3M7R A;  2P7G A;  4G21 A;  1RJK A;  3A78 A;  4OIU A;  3UUA B;  4F9M A;  3DZY D;  1KV6 A;  5C4O A;  3OAP A;  5KRJ A;  3AFR A;  3E7C A;  3OLS A;  1L2I A;  2IOG A;  2GPV A;  2Q5G A;  4OIL A;  1RDT A;  3FLI A;  4A2J A;  1U3R A;  2Q3Y A;  4PPS A;  2BJ4 A;  4LNX A;  4KZI A;  1H9U A;  4WHF A;  2P1V A;  4YT1 A;  1Y9R A;  4LTW A;  4MG8 A;  3SZ1 A;  4RME A;  2AO6 A;  3SP6 A;  2Q59 B;  1FM6 A;  3UUD B;  1LV2 A;  3B3K A;  3W5Q A;  3OS8 A;  1T76 A;  4BCR A;  1Y0S A;  1A28 A;  4NY9 A;  3LBD A;  3GWS X;  2VV4 A;  1T5Z A;  3ERD A;  4KZM A;  1MVC A;  4OK1 A;  1Y0X X;  2GPU A;  2P7A A;  2PIN A;  4OKT A;  4RWV A;  2FSZ A;  2ZK6 A;  1RKH A;  1XNX A;  4OJ4 A;  4WPF A;  1X7R A;  1SKX A;  1RK3 A;  2R40 D;  2H77 A;  3W5P A;  4PPP A;  3VT4 A;  1K4W A;  4E4Q A;  5GT4 A;  2I4J A;  1UHL B;  2YJA B;  2PIU A;  3PLZ A;  2R6Y A;  4OKB A;  4PLE A;  4CI4 A;  3H52 A;  5E15 A;  4Y29 A;  2B1V A;  2QTU A;  3P0U A;  4X1F A;  5FQP A;  2HBH A;  3DCT A;  2QZO A;  4IA1 A;  4IA2 A;  3OSI A;  4IUI A;  2HAM A;  2YHD A;  4IV2 A;  4N5G A;  4RZG A;  5DV8 A;  5H1E A;  3WFG A;  1GWR A;  3A3Z X;  1T79 A;  5L7E A;  1A52 A;  4PWL A;  3WT7 A;  2Q7I A;  4RMC A;  4HEE X;  4QJR A;  1YIM A;  3ZRA A;  3CQV A;  1T65 A;  3GYU A;  1G1U A;  2AYR A;  3N00 A;  4IWF A;  1SR7 A;  5SYZ A;  2VV0 A;  1QKU A;  2ZLC A;  4OLM A;  5IAW A;  5G44 A;  1FD0 A;  3IPQ A;  5DXB A;  1E3K A;  1TXI A;  1ZGY A;  4MGD A;  5L7H A;  3VT7 A;  4P6W A;  2YLP A;  4FN9 A;  4ZNH A;  3RY9 A;  3CS4 A;  4J5W A;  4IQR A;  2E2R A;  4FNE A;  1Z5X E;  1QKN A;  4NB6 A;  1BSX A;  1LBD A;  3GWX A;  4FHI A;  1T7R A;  4MG6 A;  3VSP A;  3ET0 A;  3AN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...