4OEAA

Crystal structure of ar-lbd
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
249
structure length
242
Chain Sequence
QPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSAMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIASCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of a new androgen receptor (AR) co-regulator BUD31 and related peptides to suppress wild-type and mutated AR-mediated prostate cancer growth via peptide screening and X-ray structure analysis.
pubmed doi rcsb
molecule keywords Androgen receptor
molecule tags Hormone receptor
source organism Homo sapiens
total genus 93
structure length 242
sequence length 249
ec nomenclature
pdb deposition date 2014-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4oeaA00
3R5MA 3V49A 3KDTA 2VV0A 1UPVA 3ZQTA 3WTQA 1XZXX 3L3XA 5ICKA 3MNOA 4R2UA 2AWHA 2QGTA 5B5BA 5DKBA 4REFA 4RZFA 5L7HA 4RMEA 3RLLA 2P1TA 5EJVA 2IHQA 5KRCA 3UVVA 5DRJA 3E94A 5DXMA 4UDBA 3L03A 2ZK4A 5KCDA 2OAXA 2XYJA 3B67A 5DI7A 3F7DA 1PDUA 5HYRA 1H9UA 3D24A 5DMCA 2GIUA 1I7IA 5AK2A 1T79A 4S15A 2AA5A 3BC5A 1FM6A 4PWLA 4RUPA 5I4VA 5E15A 2O4RA 4QE8A 1EXAA 2HVCA 5AVIA 3HC6A 5HJPB 1X78A 2AB2A 4X1GA 3SP9A 3A3ZX 4IW8A 4REEA 3K6PA 3F5CA 1Z5XU 1T7RA 4MGCA 4R06A 3V4AA 2PIPL 1R6GA 1FCZA 1PRGA 2FVJA 3R29A 2ZMHA 4KZJA 2NXXE 1EXXA 3UUAB 1N46A 2YJDA 3V3QA 1PZLA 2AX6A 5DKGA 5DXQA 5KRMA 5DXBB 4S0SA 3ADUA 5DVSA 3VI8A 2Q1VA 4NIEA 2QA8A 5GIDA 4CI5A 1M13A 3R2AA 5C4SA 4ZNHA 2B1ZA 4MG8B 3P88A 3A2IA 5DU5A 4ONIA 4OKBA 5DWEA 3VHWA 1G5YA 2YATA 2P1VA 5DXRA 5KROA 5AZVA 5APKA 3OS8A 4OJ4A 4NQAB 3ADWA 3PEQA 3R8DA 1Y0SA 2Q1HA 2I4PA 4IUIA 3DY6A 1NAXA 3OMOA 4IV4A 4OK1A 2ZXMA 3B1MA 3D6DA 3FUGA 3VT7A 1G1UA 5AWJA 2AM9A 4RMCA 2Q7IA 3OKHA 2YLQA 1X76A 1IE9A 3FXVA 2JFAA 2QNVA 3NSPA 4MG5A 3VT6A 4ZNTA 5HYKA 5KRIA 5E19A 3NOAA 1ZGYA 2VV3A 4PP5A 5DIEA 2A3IA 1FM9D 1T7FA 2BJ4B 4XAOA 1ZH7A 4E4KA 2YLOA 4PP3A 3ADXA 2VV1A 2HFPA 1T73A 4MGBB 1YUCA 1OT7A 1RKHA 2OM9A 1G2NA 2ZMJA 4PLDA 4PVUA 1U3SA 2G0HA 2P15A 4LNWA 3L3ZA 5DVVA 1KKQA 3W5PA 4POHA 4YMQA 3VSPA 4IQRA 2ZXZA 4OARA 2ZFXA 1Z5XE 2ZXNA 5AWKA 3WMHA 5B41A 1X7BA 3B0QA 4S0TA 3D90A 5KR9A 1PQ6A 2Q5GA 4EMAA 2Q59A 5FQSA 4NY9A 1XLSE 3CDPA 4E4QA 3W5QA 1LV2A 2G5OA 2QGWA 3A2HA 1TFCA 1U3QA 4OILA 3KWYA 1XV9B 1XPCA 2QW4A 2YJAB 3GWSX 4KZMA 3OS9A 5IXKA 5DXGA 5JJMA 3X1HA 1N83A 5DZ3A 1YJEA 1OVLB 1OSHA 4HEEX 2G44A 2HWQA 4OFRA 2P4YA 3HZFA 4FN9A 3SZ1A 3W0IA 3VJHA 1UPWA 5APHA 3W5TA 1TXIA 3KPZA 3W0JA 3B0RA 1XP1A 3AURA 3MNPA 4ZNUA 5G5WA 3UUCA 1A28A 1XVPA 3K22A 4IVWA 4ZN7A 5L11A 3G8OA 4XTAA 2AA7A 5M96A 1RDTD 2W8YA 1XDKB 2V0VA 3TX7B 2Q6RA 5DXKA 1A52A 3V3EA 2OUZA 2NV7A 2ZK5A 1BSXA 1T7MA 5DP0A 5DYDA 4ZO1X 3W0CA 3AZ3A 3RY9A 3VRVA 2YFEA 4OFUA 2EWPA 1ZDTA 4TV1B 4OIVA 3VHUA 3WWRA 1XIUA 3TKCA 1QKNA 1RJKA 5G43A 4OGHA 4N1YA 5DXEA 3Q95B 4MDDA 5A86A 2PIVA 1GS4A 2PRGA 3JZBA 5G42A 5DVCA 5DZIA 4XUHA 5DIGA 3FURA 2HBHA 2QXSA 1NYXA 2Q61A 5DX3A 3FC6A 3OKIA 1NQ7A 3ZRAA 3VRWA 2B50A 3GD2A 3ILZA 4JGVA 4N5GA 1R1KD 3CWDA 4RZGA 1KV6A 1HG4A 3VRTA 3HQ5A 4PPPA 5CJ6A 4WLBA 1GWRA 3G8IA 3L0JA 4G1YA 4QK4A 5DUEA 3W5RA 3K23A 5L7EA 5KRAA 2VV4B 3A78A 3A9EA 1XB7A 5DMFA 3VT5A 2B1VA 4A4VA 4E2JA 5G46A 2J7XA 1T76A 2ZKCA 3KMGA 1S9PA 4MG7B 5DL4A 3OZJA 2I0GA 4MGDA 4OZTU 4WQPA 1FBYA 1RDTA 4M8EA 2O4JA 3PCUA 1XQ3A 2H77A 3PO9A 4IA7A 4Q0AC 3R5NA 5DIDA 1MV9A 5HZCA 2HB7A 2ZY0A 4L96A 4F9MA 2PIUA 1XNXA 2HARA 3HODA 3TY0A 3DZUD 5KRKA 5DWJA 5IAWA 1FCYA 3VT3A 4YPQA 2V7CA 2Q5SA 5DKEA 1L2JA 1M7WA 4IW6A 1YIMA 1OSVA 3AZ2A 3ET1A 2PIQA 3UU7B 4LTWA 2NW4A 4FNEA 1R1KA 3OLLA 5DK9A 2R6YA 5E0XA 1XP6A 4NB6A 4CI4A 5KCTA 5KD9A 1L2IA 2ATHA 1NAVA 1UHLA 4MGAB 3DZYD 1K4WA 2ACLB 3T03A 1S19A 4RZEA 3VT8A 4Q50A 3FALA 4X1FA 3OSAA 3RUUA 4G20A 1LBDA 3UUDA 4OEAA 4CSJA 1YINA 3M7RA 2R40D 1U9EA 1SQNA 3AN3A 5L7GA 2QSEA 2BAWA 3OSIA 5DZ1A 3VTDA 2YLPA 5LGAA 3P0UA 5GT4A 4OEYA 4J5WA 2QABA 3VT4A 5AZTA 3W0AA 5EC9A 3BQDA 3IPSA 4K6IA 4QM0A 1YA3A 4N8RA 4OEDA 4XUMA 1DKFB 1NDEA 2QZOB 4MG9B 3IXPD 3CS4A 4JAZA 2GPOA 4OZTE 3GWXA 3VN2A 2QMVA 1S9QA 2Z4BA 3QT0A 2AO6A 1IE8A 3RUTA 4DQMA 3O1DA 4L98A 1YMTA 3HC5A 5DV6A 5E14A 1T65A 3DZUA 5DSHA 3ADTA 4G2HA 5DUHA 3PRGA 4IWFA 4IS8A 2NPAA 1K74D 5HCVA 2POBA 4LNXA 5G3JA 5HJPA 5KYAA 1NUOA 5KYJA 4S14A 1YYEA 5EI1A 2LBDA 3N00A 3ET3A 2AX9A 3OLSA 5DWLA 3H0AD 3UUAA 4TUZB 3DZYA 2QE4A 2I0JA 5DXBA 1NQ2A 2JF9A 3D57A 4JL4A 4K4JA 3V9TA 2I4ZA 3R8IA 2GPUA 4FHIA 4MG8A 4ZNSA 2Q6SA 3AFRA 2R40A 2XKWA 3DCUA 1ZDUA 2Q7LA 4ZOMA 3HM1A 1QKUA 1XJ7A 4XLDA 2PIRA 2ZLCA 4G1ZA 1X7JA 3W0GA 1S0ZA 2G0GA 4ZNVA 1NHZA 3OGTA 4RUJA 5AAVB 4IA1A 5KRJA 5DV8A 2J14A 3E00D 1T5ZA 2AYRA 3LMPA 5G44A 4DK8A 2AX7A 4OKXA 1ZAFA 1FM9A 3IXPA 4ZO1B 3GYUA 5C4OA 1ZUCA 3GYTA 4OEZA 2O9IA 4ZNWA 4DORA 3HLVA 5EHJA 3WJ5A 3VJTA 4ZN9A 1FCXA 2IOGA 3AUQA 3UP0A 4RMDA 1QKTA 4QL8A 1NQ0A 4J5WC 5KCFA 4QE6A 3W0HA 1XAPA 4WVDA 1K74A 2Z4JA 2BJ4A 5KRFA 2E2RA 4WHGA 4UDCA 3P89A 3CJWA 3UVVB 5AYGA 1P8DA 4MGBA 4POJA 3WFGA 3WFFA 2HCDA 2ZNOA 4WPFA 2AX8A 2J7YA 3H0AA 5DY8A 5G45A 3VHVA 3KDUA 4NUFA 1R5KA 3L0EA 3JZCA 5ETHA 1I37A 3WT5A 2ZK2A 2PIXA 2ZNNA 4R6SA 2PINA 1DB1A 3WJ4A 1SR7A 3B5RA 4HLWA 3KMZA 3F5CB 1YOKA 2YHDA 1UOMA 3IMYA 3O1EA 4MG6A 4OH6A 3U9QA 2OVMA 4G2IA 1E3GA 1RK3A 2ZNPA 4ZJWA 3AUNA 3LBDA 4PLEA 3WT7A 4PRGA 5DLRA 3E00A 4DMAA 2VSTA 1XV9A 4G21A 4RWVA 3OOKA 2QA8B 4XT9A 1X7EA 5ACCA 3GBKA 4K7AA 1S0XA 2REWA 1SKXA 1SJ0A 1OVLA 3P8XA 3AN4A 1K7LA 3VT9A 3IPUA 3OLFA 3OOFA 4PXMA 2Q7KA 2GP7A 5DWGA 2AMAA 4DM8A 2XHSA 4XI3A 2GPVA 3DT3A 4IV2A 4PPSA 5KRLA 2GTKA 3ET0A 3HO0A 3HVLA 1Y0XX 4QJRA 1PCGA 3B3KA 3AZ1A 4XHDA 1ZEOA 1XDKA 3B65A 3OAPA 2JFAB 4OLMA 2HAMA 2QXMA 2AAXA 3SP6A 1GWXA 2P7AA 2AA6A 1FD0A 2ZVTA 3H52A 3B66A 4J5XA 4OKWA 5DZHA 4A4WA 4ZI1A 4G1DA 5GICA 1E3KA 4RE8A 2Q6JA 2ZASA 2ZK6A 2VV1B 1MVCA 2YLYA 2P1UA 3OSWA 2P54A 4TV1A 4DOSA 1XP9A 3KYTA 4RAKA 2HB8A 5DYBA 5DTVA 2HWRA 3BEJA 3Q95A 3CS6A 4YNKA 1Y9RA 1ILGA 1HJ1A 4OHAA 2GL8A 5K13A 5FQRA 1ILHA 3B68A 4Q13A 4OJBA 2ZK1A 3ADVA 3FEJA 2Q8SA 2J4AA 4APUA 3KFCA 5APJA 3CTBA 5E7VA 2AMBA 5HJSA 3OMQA 2HC4A 5E1CA 4B7WA 3K8SA 4FHHA 5DRMA 5C4UA 2XYWA 3ERDA 2Q59B 4LSJA 4P6XA 3A2JA 2ZK3A 3IA6A 1N4HA 2PIOA 2VV4A 2ZNQA 4WHFA 4BCRA 1NRLA 3VSOA 4J26A 1XOWA 1WM0X 4MG7A 3OZ0A 5JJMB 4KZIA 1PQ9A 2NXXA 3CQVA 1U3RA 5DWIA 1M2ZA 4EM9A 4ITEA 2IOKA 2PJLA 2ZLAA 1ERRA 3R8AA 4IWCA 3OMMA 4DM6A 4IVYA 5DXPA 1R20D 4ZJRA 2F4BA 2Q3YA 4PP6A 3CS8A 3ET2A 2QR9A 2AA2A 2ZK0A 2QH6A 2PKLA 3VTCA 1PQCA 3WT6A 1XVPB 4YT1A 3WGPA 1Q4XA 4OIUA 5KCUA 3KMRA 5AVLA 1I7GA 3ERTA 5DV3A 1Z95A 3OMKA 2PITA 5SYZA 3X36A 4PF3A 5JI0D 2Q5PA 4RFWA 5KRHA 4J5XC 4O8FA 3ZRBA 3KBAA 3B0WA 3UU7A 1XNNA 3VJIA 4JYGA 3DR1A 1QKMA 3E7CA 4OZRU 2QPYA 4M8HA 3G9EA 1KNUA 4MGAA 4N73A 3W0YA 4OJ9A 2ACLA 3UP3A 2GPPA 3EYBA 5DX3B 2VSRA 5GIEA 3X31A 3FC6B 3DCTA 4LBDA 2XYXA 3GN8A 4JYHA 3X1IA 1NQ1A 5H1EA 2P7GA 3TKMA 5EITA 2P7ZA 2OZ7A 4A2JA 2FAIA 2ZMIA 1T7TA 1YOWA 4JYIA 1R20A 5IZ0A 1DKFA 2QZOA 3A9EB 3ADSA 4MG9A 1VJBA 3CDSA 1MZNA 4Y29A 3B0TA 5AAUA 2H79A 4IA2A 2GWXA 3GZ9A 4MGDB 3V9YA 5LWPA 2PIWA 1XLSA 3ZR7A 2OCFA 2VV2A 4UDAA 2B23A 4FGYA 3CLDA 1PK5A 2PNUA 3OS8C 1XQCA 3VTBA 1GWQA 2HASA 2AXAA 5DUGA 1I38A 4IA3A 3PBAA 4OKTA 2Q60A 3FLIA 3AX8A 4ITFA 5DZ0A 3L0LA 2POGA 3VJSA 5KCWA 1YP0A 4RUOX 4TUZA 1FM6D 1EREA 3L1BA 2FSZA 5FQVA 5FQPA 5JY3A 2R6WA 2ABIA 3G0WA 5DKSA 2JJ3A 4UDDA 1X7RA 2OVHA 4IU7A 3D5FA 5E0WA 2Q7JA 3V9VA 5EGVA 2ZL9A 3FEIA 3IPQA 3NSQA 4OC7A 3S9SA 4OZRE 4DK7A 1T63A 2I4JA 1ZKYA 1RKGA 3VRUA 5KCEA 1T74A 5C4TA 5KCCA 1UHLB 1P93A 3RVFA 3OMPA 2ZBSA 5AAVA 3A40X 4J24A 3RLJA 2QTUA 2QA6A 3FS1A 3PLZA 3FALB 4P6WA 5F9BA 2Q70A 1G50A 3UUDB 5FQTA 3MNEA 4OH5A 1YY4A
chains in the Genus database with same CATH superfamily
3R5MA 3V49A 3KDTA 2VV0A 1UPVA 3ZQTA 3WTQA 1XZXX 3L3XA 5ICKA 3MNOA 4R2UA 2AWHA 2QGTA 5B5BA 5DKBA 4REFA 4RZFA 5L7HA 4RMEA 3RLLA 2P1TA 5EJVA 2IHQA 5KRCA 3UVVA 5DRJA 3E94A 5DXMA 4UDBA 3L03A 2ZK4A 5KCDA 2OAXA 2XYJA 3B67A 5DI7A 3F7DA 1PDUA 5HYRA 1H9UA 3D24A 5DMCA 2GIUA 1I7IA 5AK2A 1T79A 4S15A 2AA5A 3BC5A 1FM6A 4PWLA 4RUPA 5I4VA 5E15A 2O4RA 4QE8A 1EXAA 2HVCA 5AVIA 3HC6A 5HJPB 1X78A 2AB2A 4X1GA 3SP9A 3A3ZX 4IW8A 4REEA 3K6PA 3F5CA 1Z5XU 1T7RA 4MGCA 4R06A 3V4AA 2PIPL 1R6GA 1FCZA 1PRGA 2FVJA 3R29A 2ZMHA 4KZJA 2NXXE 1EXXA 3UUAB 1N46A 2YJDA 3V3QA 1PZLA 2AX6A 5DKGA 5DXQA 5KRMA 5DXBB 4S0SA 3ADUA 5DVSA 3VI8A 2Q1VA 4NIEA 2QA8A 5GIDA 4CI5A 1M13A 3R2AA 5C4SA 4ZNHA 2B1ZA 4MG8B 3P88A 3A2IA 5DU5A 4ONIA 4OKBA 5DWEA 3VHWA 1G5YA 2YATA 2P1VA 5DXRA 5KROA 5AZVA 5APKA 3OS8A 4OJ4A 4NQAB 3ADWA 3PEQA 3R8DA 1Y0SA 2Q1HA 2I4PA 4IUIA 3DY6A 1NAXA 3OMOA 4IV4A 4OK1A 2ZXMA 3B1MA 3D6DA 3FUGA 3VT7A 1G1UA 5AWJA 2AM9A 4RMCA 2Q7IA 3OKHA 2YLQA 1X76A 1IE9A 3FXVA 2JFAA 2QNVA 3NSPA 4MG5A 3VT6A 4ZNTA 5HYKA 5KRIA 5E19A 3NOAA 1ZGYA 2VV3A 4PP5A 5DIEA 2A3IA 1FM9D 1T7FA 2BJ4B 4XAOA 1ZH7A 4E4KA 2YLOA 4PP3A 3ADXA 2VV1A 2HFPA 1T73A 4MGBB 1YUCA 1OT7A 1RKHA 2OM9A 1G2NA 2ZMJA 4PLDA 4PVUA 1U3SA 2G0HA 2P15A 4LNWA 3L3ZA 5DVVA 1KKQA 3W5PA 4POHA 4YMQA 3VSPA 4IQRA 2ZXZA 4OARA 2ZFXA 1Z5XE 2ZXNA 5AWKA 3WMHA 5B41A 1X7BA 3B0QA 4S0TA 3D90A 5KR9A 1PQ6A 2Q5GA 4EMAA 2Q59A 5FQSA 4NY9A 1XLSE 3CDPA 4E4QA 3W5QA 1LV2A 2G5OA 2QGWA 3A2HA 1TFCA 1U3QA 4OILA 3KWYA 1XV9B 1XPCA 2QW4A 2YJAB 3GWSX 4KZMA 3OS9A 5IXKA 5DXGA 5JJMA 3X1HA 1N83A 5DZ3A 1YJEA 1OVLB 1OSHA 4HEEX 2G44A 2HWQA 4OFRA 2P4YA 3HZFA 4FN9A 3SZ1A 3W0IA 3VJHA 1UPWA 5APHA 3W5TA 1TXIA 3KPZA 3W0JA 3B0RA 1XP1A 3AURA 3MNPA 4ZNUA 5G5WA 3UUCA 1A28A 1XVPA 3K22A 4IVWA 4ZN7A 5L11A 3G8OA 4XTAA 2AA7A 5M96A 1RDTD 2W8YA 1XDKB 2V0VA 3TX7B 2Q6RA 5DXKA 1A52A 3V3EA 2OUZA 2NV7A 2ZK5A 1BSXA 1T7MA 5DP0A 5DYDA 4ZO1X 3W0CA 3AZ3A 3RY9A 3VRVA 2YFEA 4OFUA 2EWPA 1ZDTA 4TV1B 4OIVA 3VHUA 3WWRA 1XIUA 3TKCA 1QKNA 1RJKA 5G43A 4OGHA 4N1YA 5DXEA 3Q95B 4MDDA 5A86A 2PIVA 1GS4A 2PRGA 3JZBA 5G42A 5DVCA 5DZIA 4XUHA 5DIGA 3FURA 2HBHA 2QXSA 1NYXA 2Q61A 5DX3A 3FC6A 3OKIA 1NQ7A 3ZRAA 3VRWA 2B50A 3GD2A 3ILZA 4JGVA 4N5GA 1R1KD 3CWDA 4RZGA 1KV6A 1HG4A 3VRTA 3HQ5A 4PPPA 5CJ6A 4WLBA 1GWRA 3G8IA 3L0JA 4G1YA 4QK4A 5DUEA 3W5RA 3K23A 5L7EA 5KRAA 2VV4B 3A78A 3A9EA 1XB7A 5DMFA 3VT5A 2B1VA 4A4VA 4E2JA 5G46A 2J7XA 1T76A 2ZKCA 3KMGA 1S9PA 4MG7B 5DL4A 3OZJA 2I0GA 4MGDA 4OZTU 4WQPA 1FBYA 1RDTA 4M8EA 2O4JA 3PCUA 1XQ3A 2H77A 3PO9A 4IA7A 4Q0AC 3R5NA 5DIDA 1MV9A 5HZCA 2HB7A 2ZY0A 4L96A 4F9MA 2PIUA 1XNXA 2HARA 3HODA 3TY0A 3DZUD 5KRKA 5DWJA 5IAWA 1FCYA 3VT3A 4YPQA 2V7CA 2Q5SA 5DKEA 1L2JA 1M7WA 4IW6A 1YIMA 1OSVA 3AZ2A 3ET1A 2PIQA 3UU7B 4LTWA 2NW4A 4FNEA 1R1KA 3OLLA 5DK9A 2R6YA 5E0XA 1XP6A 4NB6A 4CI4A 5KCTA 5KD9A 1L2IA 2ATHA 1NAVA 1UHLA 4MGAB 3DZYD 1K4WA 2ACLB 3T03A 1S19A 4RZEA 3VT8A 4Q50A 3FALA 4X1FA 3OSAA 3RUUA 4G20A 1LBDA 3UUDA 4OEAA 4CSJA 1YINA 3M7RA 2R40D 1U9EA 1SQNA 3AN3A 5L7GA 2QSEA 2BAWA 3OSIA 5DZ1A 3VTDA 2YLPA 5LGAA 3P0UA 5GT4A 4OEYA 4J5WA 2QABA 3VT4A 5AZTA 3W0AA 5EC9A 3BQDA 3IPSA 4K6IA 4QM0A 1YA3A 4N8RA 4OEDA 4XUMA 1DKFB 1NDEA 2QZOB 4MG9B 3IXPD 3CS4A 4JAZA 2GPOA 4OZTE 3GWXA 3VN2A 2QMVA 1S9QA 2Z4BA 3QT0A 2AO6A 1IE8A 3RUTA 4DQMA 3O1DA 4L98A 1YMTA 3HC5A 5DV6A 5E14A 1T65A 3DZUA 5DSHA 3ADTA 4G2HA 5DUHA 3PRGA 4IWFA 4IS8A 2NPAA 1K74D 5HCVA 2POBA 4LNXA 5G3JA 5HJPA 5KYAA 1NUOA 5KYJA 4S14A 1YYEA 5EI1A 2LBDA 3N00A 3ET3A 2AX9A 3OLSA 5DWLA 3H0AD 3UUAA 4TUZB 3DZYA 2QE4A 2I0JA 5DXBA 1NQ2A 2JF9A 3D57A 4JL4A 4K4JA 3V9TA 2I4ZA 3R8IA 2GPUA 4FHIA 4MG8A 4ZNSA 2Q6SA 3AFRA 2R40A 2XKWA 3DCUA 1ZDUA 2Q7LA 4ZOMA 3HM1A 1QKUA 1XJ7A 4XLDA 2PIRA 2ZLCA 4G1ZA 1X7JA 3W0GA 1S0ZA 2G0GA 4ZNVA 1NHZA 3OGTA 4RUJA 5AAVB 4IA1A 5KRJA 5DV8A 2J14A 3E00D 1T5ZA 2AYRA 3LMPA 5G44A 4DK8A 2AX7A 4OKXA 1ZAFA 1FM9A 3IXPA 4ZO1B 3GYUA 5C4OA 1ZUCA 3GYTA 4OEZA 2O9IA 4ZNWA 4DORA 3HLVA 5EHJA 3WJ5A 3VJTA 4ZN9A 1FCXA 2IOGA 3AUQA 3UP0A 4RMDA 1QKTA 4QL8A 1NQ0A 4J5WC 5KCFA 4QE6A 3W0HA 1XAPA 4WVDA 1K74A 2Z4JA 2BJ4A 5KRFA 2E2RA 4WHGA 4UDCA 3P89A 3CJWA 3UVVB 5AYGA 1P8DA 4MGBA 4POJA 3WFGA 3WFFA 2HCDA 2ZNOA 4WPFA 2AX8A 2J7YA 3H0AA 5DY8A 5G45A 3VHVA 3KDUA 4NUFA 1R5KA 3L0EA 3JZCA 5ETHA 1I37A 3WT5A 2ZK2A 2PIXA 2ZNNA 4R6SA 2PINA 1DB1A 3WJ4A 1SR7A 3B5RA 4HLWA 3KMZA 3F5CB 1YOKA 2YHDA 1UOMA 3IMYA 3O1EA 4MG6A 4OH6A 3U9QA 2OVMA 4G2IA 1E3GA 1RK3A 2ZNPA 4ZJWA 3AUNA 3LBDA 4PLEA 3WT7A 4PRGA 5DLRA 3E00A 4DMAA 2VSTA 1XV9A 4G21A 4RWVA 3OOKA 2QA8B 4XT9A 1X7EA 5ACCA 3GBKA 4K7AA 1S0XA 2REWA 1SKXA 1SJ0A 1OVLA 3P8XA 3AN4A 1K7LA 3VT9A 3IPUA 3OLFA 3OOFA 4PXMA 2Q7KA 2GP7A 5DWGA 2AMAA 4DM8A 2XHSA 4XI3A 2GPVA 3DT3A 4IV2A 4PPSA 5KRLA 2GTKA 3ET0A 3HO0A 3HVLA 1Y0XX 4QJRA 1PCGA 3B3KA 3AZ1A 4XHDA 1ZEOA 1XDKA 3B65A 3OAPA 2JFAB 4OLMA 2HAMA 2QXMA 2AAXA 3SP6A 1GWXA 2P7AA 2AA6A 1FD0A 2ZVTA 3H52A 3B66A 4J5XA 4OKWA 5DZHA 4A4WA 4ZI1A 4G1DA 5GICA 1E3KA 4RE8A 2Q6JA 2ZASA 2ZK6A 2VV1B 1MVCA 2YLYA 2P1UA 3OSWA 2P54A 4TV1A 4DOSA 1XP9A 3KYTA 4RAKA 2HB8A 5DYBA 5DTVA 2HWRA 3BEJA 3Q95A 3CS6A 4YNKA 1Y9RA 1ILGA 1HJ1A 4OHAA 2GL8A 5K13A 5FQRA 1ILHA 3B68A 4Q13A 4OJBA 2ZK1A 3ADVA 3FEJA 2Q8SA 2J4AA 4APUA 3KFCA 5APJA 3CTBA 5E7VA 2AMBA 5HJSA 3OMQA 2HC4A 5E1CA 4B7WA 3K8SA 4FHHA 5DRMA 5C4UA 2XYWA 3ERDA 2Q59B 4LSJA 4P6XA 3A2JA 2ZK3A 3IA6A 1N4HA 2PIOA 2VV4A 2ZNQA 4WHFA 4BCRA 1NRLA 3VSOA 4J26A 1XOWA 1WM0X 4MG7A 3OZ0A 5JJMB 4KZIA 1PQ9A 2NXXA 3CQVA 1U3RA 5DWIA 1M2ZA 4EM9A 4ITEA 2IOKA 2PJLA 2ZLAA 1ERRA 3R8AA 4IWCA 3OMMA 4DM6A 4IVYA 5DXPA 1R20D 4ZJRA 2F4BA 2Q3YA 4PP6A 3CS8A 3ET2A 2QR9A 2AA2A 2ZK0A 2QH6A 2PKLA 3VTCA 1PQCA 3WT6A 1XVPB 4YT1A 3WGPA 1Q4XA 4OIUA 5KCUA 3KMRA 5AVLA 1I7GA 3ERTA 5DV3A 1Z95A 3OMKA 2PITA 5SYZA 3X36A 4PF3A 5JI0D 2Q5PA 4RFWA 5KRHA 4J5XC 4O8FA 3ZRBA 3KBAA 3B0WA 3UU7A 1XNNA 3VJIA 4JYGA 3DR1A 1QKMA 3E7CA 4OZRU 2QPYA 4M8HA 3G9EA 1KNUA 4MGAA 4N73A 3W0YA 4OJ9A 2ACLA 3UP3A 2GPPA 3EYBA 5DX3B 2VSRA 5GIEA 3X31A 3FC6B 3DCTA 4LBDA 2XYXA 3GN8A 4JYHA 3X1IA 1NQ1A 5H1EA 2P7GA 3TKMA 5EITA 2P7ZA 2OZ7A 4A2JA 2FAIA 2ZMIA 1T7TA 1YOWA 4JYIA 1R20A 5IZ0A 1DKFA 2QZOA 3A9EB 3ADSA 4MG9A 1VJBA 3CDSA 1MZNA 4Y29A 3B0TA 5AAUA 2H79A 4IA2A 2GWXA 3GZ9A 4MGDB 3V9YA 5LWPA 2PIWA 1XLSA 3ZR7A 2OCFA 2VV2A 4UDAA 2B23A 4FGYA 3CLDA 1PK5A 2PNUA 3OS8C 1XQCA 3VTBA 1GWQA 2HASA 2AXAA 5DUGA 1I38A 4IA3A 3PBAA 4OKTA 2Q60A 3FLIA 3AX8A 4ITFA 5DZ0A 3L0LA 2POGA 3VJSA 5KCWA 1YP0A 4RUOX 4TUZA 1FM6D 1EREA 3L1BA 2FSZA 5FQVA 5FQPA 5JY3A 2R6WA 2ABIA 3G0WA 5DKSA 2JJ3A 4UDDA 1X7RA 2OVHA 4IU7A 3D5FA 5E0WA 2Q7JA 3V9VA 5EGVA 2ZL9A 3FEIA 3IPQA 3NSQA 4OC7A 3S9SA 4OZRE 4DK7A 1T63A 2I4JA 1ZKYA 1RKGA 3VRUA 5KCEA 1T74A 5C4TA 5KCCA 1UHLB 1P93A 3RVFA 3OMPA 2ZBSA 5AAVA 3A40X 4J24A 3RLJA 2QTUA 2QA6A 3FS1A 3PLZA 3FALB 4P6WA 5F9BA 2Q70A 1G50A 3UUDB 5FQTA 3MNEA 4OH5A 1YY4A
chains in the Genus database with same CATH topology
3R5MA 3V49A 3KDTA 2VV0A 1UPVA 3ZQTA 3WTQA 1XZXX 3L3XA 5ICKA 3MNOA 4R2UA 2AWHA 2QGTA 5B5BA 5DKBA 4REFA 4RZFA 5L7HA 4RMEA 3RLLA 2P1TA 5EJVA 2IHQA 5KRCA 3UVVA 5DRJA 3E94A 5DXMA 4UDBA 3L03A 2ZK4A 5KCDA 2OAXA 2XYJA 3B67A 5DI7A 3F7DA 1PDUA 5HYRA 1H9UA 3D24A 5DMCA 2GIUA 1I7IA 5AK2A 1T79A 4S15A 2AA5A 3BC5A 1FM6A 4PWLA 4RUPA 5I4VA 5E15A 2O4RA 4QE8A 1EXAA 2HVCA 5AVIA 3HC6A 5HJPB 1X78A 2AB2A 4X1GA 3SP9A 3A3ZX 4IW8A 4REEA 3K6PA 3F5CA 1Z5XU 1T7RA 4MGCA 4R06A 3V4AA 2PIPL 1R6GA 1FCZA 1PRGA 2FVJA 3R29A 2ZMHA 4KZJA 2NXXE 1EXXA 3UUAB 1N46A 2YJDA 3V3QA 1PZLA 2AX6A 5DKGA 5DXQA 5KRMA 5DXBB 4S0SA 3ADUA 5DVSA 3VI8A 2Q1VA 4NIEA 2QA8A 5GIDA 4CI5A 1M13A 3R2AA 5C4SA 4ZNHA 2B1ZA 4MG8B 3P88A 3A2IA 5DU5A 4ONIA 4OKBA 5DWEA 3VHWA 1G5YA 2YATA 2P1VA 5DXRA 5KROA 5AZVA 5APKA 3OS8A 4OJ4A 4NQAB 3ADWA 3PEQA 3R8DA 1Y0SA 2Q1HA 2I4PA 4IUIA 3DY6A 1NAXA 3OMOA 4IV4A 4OK1A 2ZXMA 3B1MA 3D6DA 3FUGA 3VT7A 1G1UA 5AWJA 2AM9A 4RMCA 2Q7IA 3OKHA 2YLQA 1X76A 1IE9A 3FXVA 2JFAA 2QNVA 3NSPA 4MG5A 3VT6A 4ZNTA 5HYKA 5KRIA 5E19A 3NOAA 1ZGYA 2VV3A 4PP5A 5DIEA 2A3IA 1FM9D 1T7FA 2BJ4B 4XAOA 1ZH7A 4E4KA 2YLOA 4PP3A 3ADXA 2VV1A 2HFPA 1T73A 4MGBB 1YUCA 1OT7A 1RKHA 2OM9A 1G2NA 2ZMJA 4PLDA 4PVUA 1U3SA 2G0HA 2P15A 4LNWA 3L3ZA 5DVVA 1KKQA 3W5PA 4POHA 4YMQA 3VSPA 4IQRA 2ZXZA 4OARA 2ZFXA 1Z5XE 2ZXNA 5AWKA 3WMHA 5B41A 1X7BA 3B0QA 4S0TA 3D90A 5KR9A 1PQ6A 2Q5GA 4EMAA 2Q59A 5FQSA 4NY9A 1XLSE 3CDPA 4E4QA 3W5QA 1LV2A 2G5OA 2QGWA 3A2HA 1TFCA 1U3QA 4OILA 3KWYA 1XV9B 1XPCA 2QW4A 2YJAB 3GWSX 4KZMA 3OS9A 5IXKA 5DXGA 5JJMA 3X1HA 1N83A 5DZ3A 1YJEA 1OVLB 1OSHA 4HEEX 2G44A 2HWQA 4OFRA 2P4YA 3HZFA 4FN9A 3SZ1A 3W0IA 3VJHA 1UPWA 5APHA 3W5TA 1TXIA 3KPZA 3W0JA 3B0RA 1XP1A 3AURA 3MNPA 4ZNUA 5G5WA 3UUCA 1A28A 1XVPA 3K22A 4IVWA 4ZN7A 5L11A 3G8OA 4XTAA 2AA7A 5M96A 1RDTD 2W8YA 1XDKB 2V0VA 3TX7B 2Q6RA 5DXKA 1A52A 3V3EA 2OUZA 2NV7A 2ZK5A 1BSXA 1T7MA 5DP0A 5DYDA 4ZO1X 3W0CA 3AZ3A 3RY9A 3VRVA 2YFEA 4OFUA 2EWPA 1ZDTA 4TV1B 4OIVA 3VHUA 3WWRA 1XIUA 3TKCA 1QKNA 1RJKA 5G43A 4OGHA 4N1YA 5DXEA 3Q95B 4MDDA 5A86A 2PIVA 1GS4A 2PRGA 3JZBA 5G42A 5DVCA 5DZIA 4XUHA 5DIGA 3FURA 2HBHA 2QXSA 1NYXA 2Q61A 5DX3A 3FC6A 3OKIA 1NQ7A 3ZRAA 3VRWA 2B50A 3GD2A 3ILZA 4JGVA 4N5GA 1R1KD 3CWDA 4RZGA 1KV6A 1HG4A 3VRTA 3HQ5A 4PPPA 5CJ6A 4WLBA 1GWRA 3G8IA 3L0JA 4G1YA 4QK4A 5DUEA 3W5RA 3K23A 5L7EA 5KRAA 2VV4B 3A78A 3A9EA 1XB7A 5DMFA 3VT5A 2B1VA 4A4VA 4E2JA 5G46A 2J7XA 1T76A 2ZKCA 3KMGA 1S9PA 4MG7B 5DL4A 3OZJA 2I0GA 4MGDA 4OZTU 4WQPA 1FBYA 1RDTA 4M8EA 2O4JA 3PCUA 1XQ3A 2H77A 3PO9A 4IA7A 4Q0AC 3R5NA 5DIDA 1MV9A 5HZCA 2HB7A 2ZY0A 4L96A 4F9MA 2PIUA 1XNXA 2HARA 3HODA 3TY0A 3DZUD 5KRKA 5DWJA 5IAWA 1FCYA 3VT3A 4YPQA 2V7CA 2Q5SA 5DKEA 1L2JA 1M7WA 4IW6A 1YIMA 1OSVA 3AZ2A 3ET1A 2PIQA 3UU7B 4LTWA 2NW4A 4FNEA 1R1KA 3OLLA 5DK9A 2R6YA 5E0XA 1XP6A 4NB6A 4CI4A 5KCTA 5KD9A 1L2IA 2ATHA 1NAVA 1UHLA 4MGAB 3DZYD 1K4WA 2ACLB 3T03A 1S19A 4RZEA 3VT8A 4Q50A 3FALA 4X1FA 3OSAA 3RUUA 4G20A 1LBDA 3UUDA 4OEAA 4CSJA 1YINA 3M7RA 2R40D 1U9EA 1SQNA 3AN3A 5L7GA 2QSEA 2BAWA 3OSIA 5DZ1A 3VTDA 2YLPA 5LGAA 3P0UA 5GT4A 4OEYA 4J5WA 2QABA 3VT4A 5AZTA 3W0AA 5EC9A 3BQDA 3IPSA 4K6IA 4QM0A 1YA3A 4N8RA 4OEDA 4XUMA 1DKFB 1NDEA 2QZOB 4MG9B 3IXPD 3CS4A 4JAZA 2GPOA 4OZTE 3GWXA 3VN2A 2QMVA 1S9QA 2Z4BA 3QT0A 2AO6A 1IE8A 3RUTA 4DQMA 3O1DA 4L98A 1YMTA 3HC5A 5DV6A 5E14A 1T65A 3DZUA 5DSHA 3ADTA 4G2HA 5DUHA 3PRGA 4IWFA 4IS8A 2NPAA 1K74D 5HCVA 2POBA 4LNXA 5G3JA 5HJPA 5KYAA 1NUOA 5KYJA 4S14A 1YYEA 5EI1A 2LBDA 3N00A 3ET3A 2AX9A 3OLSA 5DWLA 3H0AD 3UUAA 4TUZB 3DZYA 2QE4A 2I0JA 5DXBA 1NQ2A 2JF9A 3D57A 4JL4A 4K4JA 3V9TA 2I4ZA 3R8IA 2GPUA 4FHIA 4MG8A 4ZNSA 2Q6SA 3AFRA 2R40A 2XKWA 3DCUA 1ZDUA 2Q7LA 4ZOMA 3HM1A 1QKUA 1XJ7A 4XLDA 2PIRA 2ZLCA 4G1ZA 1X7JA 3W0GA 1S0ZA 2G0GA 4ZNVA 1NHZA 3OGTA 4RUJA 5AAVB 4IA1A 5KRJA 5DV8A 2J14A 3E00D 1T5ZA 2AYRA 3LMPA 5G44A 4DK8A 2AX7A 4OKXA 1ZAFA 1FM9A 3IXPA 4ZO1B 3GYUA 5C4OA 1ZUCA 3GYTA 4OEZA 2O9IA 4ZNWA 4DORA 3HLVA 5EHJA 3WJ5A 3VJTA 4ZN9A 1FCXA 2IOGA 3AUQA 3UP0A 4RMDA 1QKTA 4QL8A 1NQ0A 4J5WC 5KCFA 4QE6A 3W0HA 1XAPA 4WVDA 1K74A 2Z4JA 2BJ4A 5KRFA 2E2RA 4WHGA 4UDCA 3P89A 3CJWA 3UVVB 5AYGA 1P8DA 4MGBA 4POJA 3WFGA 3WFFA 2HCDA 2ZNOA 4WPFA 2AX8A 2J7YA 3H0AA 5DY8A 5G45A 3VHVA 3KDUA 4NUFA 1R5KA 3L0EA 3JZCA 5ETHA 1I37A 3WT5A 2ZK2A 2PIXA 2ZNNA 4R6SA 2PINA 1DB1A 3WJ4A 1SR7A 3B5RA 4HLWA 3KMZA 3F5CB 1YOKA 2YHDA 1UOMA 3IMYA 3O1EA 4MG6A 4OH6A 3U9QA 2OVMA 4G2IA 1E3GA 1RK3A 2ZNPA 4ZJWA 3AUNA 3LBDA 4PLEA 3WT7A 4PRGA 5DLRA 3E00A 4DMAA 2VSTA 1XV9A 4G21A 4RWVA 3OOKA 2QA8B 4XT9A 1X7EA 5ACCA 3GBKA 4K7AA 1S0XA 2REWA 1SKXA 1SJ0A 1OVLA 3P8XA 3AN4A 1K7LA 3VT9A 3IPUA 3OLFA 3OOFA 4PXMA 2Q7KA 2GP7A 5DWGA 2AMAA 4DM8A 2XHSA 4XI3A 2GPVA 3DT3A 4IV2A 4PPSA 5KRLA 2GTKA 3ET0A 3HO0A 3HVLA 1Y0XX 4QJRA 1PCGA 3B3KA 3AZ1A 4XHDA 1ZEOA 1XDKA 3B65A 3OAPA 2JFAB 4OLMA 2HAMA 2QXMA 2AAXA 3SP6A 1GWXA 2P7AA 2AA6A 1FD0A 2ZVTA 3H52A 3B66A 4J5XA 4OKWA 5DZHA 4A4WA 4ZI1A 4G1DA 5GICA 1E3KA 4RE8A 2Q6JA 2ZASA 2ZK6A 2VV1B 1MVCA 2YLYA 2P1UA 3OSWA 2P54A 4TV1A 4DOSA 1XP9A 3KYTA 4RAKA 2HB8A 5DYBA 5DTVA 2HWRA 3BEJA 3Q95A 3CS6A 4YNKA 1Y9RA 1ILGA 1HJ1A 4OHAA 2GL8A 5K13A 5FQRA 1ILHA 3B68A 4Q13A 4OJBA 2ZK1A 3ADVA 3FEJA 2Q8SA 2J4AA 4APUA 3KFCA 5APJA 3CTBA 5E7VA 2AMBA 5HJSA 3OMQA 2HC4A 5E1CA 4B7WA 3K8SA 4FHHA 5DRMA 5C4UA 2XYWA 3ERDA 2Q59B 4LSJA 4P6XA 3A2JA 2ZK3A 3IA6A 1N4HA 2PIOA 2VV4A 2ZNQA 4WHFA 4BCRA 1NRLA 3VSOA 4J26A 1XOWA 1WM0X 4MG7A 3OZ0A 5JJMB 4KZIA 1PQ9A 2NXXA 3CQVA 1U3RA 5DWIA 1M2ZA 4EM9A 4ITEA 2IOKA 2PJLA 2ZLAA 1ERRA 3R8AA 4IWCA 3OMMA 4DM6A 4IVYA 5DXPA 1R20D 4ZJRA 2F4BA 2Q3YA 4PP6A 3CS8A 3ET2A 2QR9A 2AA2A 2ZK0A 2QH6A 2PKLA 3VTCA 1PQCA 3WT6A 1XVPB 4YT1A 3WGPA 1Q4XA 4OIUA 5KCUA 3KMRA 5AVLA 1I7GA 3ERTA 5DV3A 1Z95A 3OMKA 2PITA 5SYZA 3X36A 4PF3A 5JI0D 2Q5PA 4RFWA 5KRHA 4J5XC 4O8FA 3ZRBA 3KBAA 3B0WA 3UU7A 1XNNA 3VJIA 4JYGA 3DR1A 1QKMA 3E7CA 4OZRU 2QPYA 4M8HA 3G9EA 1KNUA 4MGAA 4N73A 3W0YA 4OJ9A 2ACLA 3UP3A 2GPPA 3EYBA 5DX3B 2VSRA 5GIEA 3X31A 3FC6B 3DCTA 4LBDA 2XYXA 3GN8A 4JYHA 3X1IA 1NQ1A 5H1EA 2P7GA 3TKMA 5EITA 2P7ZA 2OZ7A 4A2JA 2FAIA 2ZMIA 1T7TA 1YOWA 4JYIA 1R20A 5IZ0A 1DKFA 2QZOA 3A9EB 3ADSA 4MG9A 1VJBA 3CDSA 1MZNA 4Y29A 3B0TA 5AAUA 2H79A 4IA2A 2GWXA 3GZ9A 4MGDB 3V9YA 5LWPA 2PIWA 1XLSA 3ZR7A 2OCFA 2VV2A 4UDAA 2B23A 4FGYA 3CLDA 1PK5A 2PNUA 3OS8C 1XQCA 3VTBA 1GWQA 2HASA 2AXAA 5DUGA 1I38A 4IA3A 3PBAA 4OKTA 2Q60A 3FLIA 3AX8A 4ITFA 5DZ0A 3L0LA 2POGA 3VJSA 5KCWA 1YP0A 4RUOX 4TUZA 1FM6D 1EREA 3L1BA 2FSZA 5FQVA 5FQPA 5JY3A 2R6WA 2ABIA 3G0WA 5DKSA 2JJ3A 4UDDA 1X7RA 2OVHA 4IU7A 3D5FA 5E0WA 2Q7JA 3V9VA 5EGVA 2ZL9A 3FEIA 3IPQA 3NSQA 4OC7A 3S9SA 4OZRE 4DK7A 1T63A 2I4JA 1ZKYA 1RKGA 3VRUA 5KCEA 1T74A 5C4TA 5KCCA 1UHLB 1P93A 3RVFA 3OMPA 2ZBSA 5AAVA 3A40X 4J24A 3RLJA 2QTUA 2QA6A 3FS1A 3PLZA 3FALB 4P6WA 5F9BA 2Q70A 1G50A 3UUDB 5FQTA 3MNEA 4OH5A 1YY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R5M A;  3V49 A;  3KDT A;  2VV0 A;  1UPV A;  3ZQT A;  3WTQ A;  1XZX X;  3L3X A;  5ICK A;  3MNO A;  4R2U A;  2AWH A;  2QGT A;  5B5B A;  5DKB A;  4REF A;  4RZF A;  5L7H A;  4RME A;  3RLL A;  2P1T A;  5EJV A;  2IHQ A;  5KRC A;  3UVV A;  5DRJ A;  3E94 A;  5DXM A;  4UDB A;  3L03 A;  2ZK4 A;  5KCD A;  2OAX A;  2XYJ A;  3B67 A;  5DI7 A;  3F7D A;  1PDU A;  5HYR A;  1H9U A;  3D24 A;  5DMC A;  2GIU A;  1I7I A;  5AK2 A;  1T79 A;  4S15 A;  2AA5 A;  3BC5 A;  1FM6 A;  4PWL A;  4RUP A;  5I4V A;  5E15 A;  2O4R A;  4QE8 A;  1EXA A;  2HVC A;  5AVI A;  3HC6 A;  5HJP B;  1X78 A;  2AB2 A;  4X1G A;  3SP9 A;  3A3Z X;  4IW8 A;  4REE A;  3K6P A;  3F5C A;  1Z5X U;  1T7R A;  4MGC A;  4R06 A;  3V4A A;  2PIP L;  1R6G A;  1FCZ A;  1PRG A;  2FVJ A;  3R29 A;  2ZMH A;  4KZJ A;  2NXX E;  1EXX A;  3UUA B;  1N46 A;  2YJD A;  3V3Q A;  1PZL A;  2AX6 A;  5DKG A;  5DXQ A;  5KRM A;  5DXB B;  4S0S A;  3ADU A;  5DVS A;  3VI8 A;  2Q1V A;  4NIE A;  2QA8 A;  5GID A;  4CI5 A;  1M13 A;  3R2A A;  5C4S A;  4ZNH A;  2B1Z A;  4MG8 B;  3P88 A;  3A2I A;  5DU5 A;  4ONI A;  4OKB A;  5DWE A;  3VHW A;  1G5Y A;  2YAT A;  2P1V A;  5DXR A;  5KRO A;  5AZV A;  5APK A;  3OS8 A;  4OJ4 A;  4NQA B;  3ADW A;  3PEQ A;  3R8D A;  1Y0S A;  2Q1H A;  2I4P A;  4IUI A;  3DY6 A;  1NAX A;  3OMO A;  4IV4 A;  4OK1 A;  2ZXM A;  3B1M A;  3D6D A;  3FUG A;  3VT7 A;  1G1U A;  5AWJ A;  2AM9 A;  4RMC A;  2Q7I A;  3OKH A;  2YLQ A;  1X76 A;  1IE9 A;  3FXV A;  2JFA A;  2QNV A;  3NSP A;  4MG5 A;  3VT6 A;  4ZNT A;  5HYK A;  5KRI A;  5E19 A;  3NOA A;  1ZGY A;  2VV3 A;  4PP5 A;  5DIE A;  2A3I A;  1FM9 D;  1T7F A;  2BJ4 B;  4XAO A;  1ZH7 A;  4E4K A;  2YLO A;  4PP3 A;  3ADX A;  2VV1 A;  2HFP A;  1T73 A;  4MGB B;  1YUC A;  1OT7 A;  1RKH A;  2OM9 A;  1G2N A;  2ZMJ A;  4PLD A;  4PVU A;  1U3S A;  2G0H A;  2P15 A;  4LNW A;  3L3Z A;  5DVV A;  1KKQ A;  3W5P A;  4POH A;  4YMQ A;  3VSP A;  4IQR A;  2ZXZ A;  4OAR A;  2ZFX A;  1Z5X E;  2ZXN A;  5AWK A;  3WMH A;  5B41 A;  1X7B A;  3B0Q A;  4S0T A;  3D90 A;  5KR9 A;  1PQ6 A;  2Q5G A;  4EMA A;  2Q59 A;  5FQS A;  4NY9 A;  1XLS E;  3CDP A;  4E4Q A;  3W5Q A;  1LV2 A;  2G5O A;  2QGW A;  3A2H A;  1TFC A;  1U3Q A;  4OIL A;  3KWY A;  1XV9 B;  1XPC A;  2QW4 A;  2YJA B;  3GWS X;  4KZM A;  3OS9 A;  5IXK A;  5DXG A;  5JJM A;  3X1H A;  1N83 A;  5DZ3 A;  1YJE A;  1OVL B;  1OSH A;  4HEE X;  2G44 A;  2HWQ A;  4OFR A;  2P4Y A;  3HZF A;  4FN9 A;  3SZ1 A;  3W0I A;  3VJH A;  1UPW A;  5APH A;  3W5T A;  1TXI A;  3KPZ A;  3W0J A;  3B0R A;  1XP1 A;  3AUR A;  3MNP A;  4ZNU A;  5G5W A;  3UUC A;  1A28 A;  1XVP A;  3K22 A;  4IVW A;  4ZN7 A;  5L11 A;  3G8O A;  4XTA A;  2AA7 A;  5M96 A;  1RDT D;  2W8Y A;  1XDK B;  2V0V A;  3TX7 B;  2Q6R A;  5DXK A;  1A52 A;  3V3E A;  2OUZ A;  2NV7 A;  2ZK5 A;  1BSX A;  1T7M A;  5DP0 A;  5DYD A;  4ZO1 X;  3W0C A;  3AZ3 A;  3RY9 A;  3VRV A;  2YFE A;  4OFU A;  2EWP A;  1ZDT A;  4TV1 B;  4OIV A;  3VHU A;  3WWR A;  1XIU A;  3TKC A;  1QKN A;  1RJK A;  5G43 A;  4OGH A;  4N1Y A;  5DXE A;  3Q95 B;  4MDD A;  5A86 A;  2PIV A;  1GS4 A;  2PRG A;  3JZB A;  5G42 A;  5DVC A;  5DZI A;  4XUH A;  5DIG A;  3FUR A;  2HBH A;  2QXS A;  1NYX A;  2Q61 A;  5DX3 A;  3FC6 A;  3OKI A;  1NQ7 A;  3ZRA A;  3VRW A;  2B50 A;  3GD2 A;  3ILZ A;  4JGV A;  4N5G A;  1R1K D;  3CWD A;  4RZG A;  1KV6 A;  1HG4 A;  3VRT A;  3HQ5 A;  4PPP A;  5CJ6 A;  4WLB A;  1GWR A;  3G8I A;  3L0J A;  4G1Y A;  4QK4 A;  5DUE A;  3W5R A;  3K23 A;  5L7E A;  5KRA A;  2VV4 B;  3A78 A;  3A9E A;  1XB7 A;  5DMF A;  3VT5 A;  2B1V A;  4A4V A;  4E2J A;  5G46 A;  2J7X A;  1T76 A;  2ZKC A;  3KMG A;  1S9P A;  4MG7 B;  5DL4 A;  3OZJ A;  2I0G A;  4MGD A;  4OZT U;  4WQP A;  1FBY A;  1RDT A;  4M8E A;  2O4J A;  3PCU A;  1XQ3 A;  2H77 A;  3PO9 A;  4IA7 A;  4Q0A C;  3R5N A;  5DID A;  1MV9 A;  5HZC A;  2HB7 A;  2ZY0 A;  4L96 A;  4F9M A;  2PIU A;  1XNX A;  2HAR A;  3HOD A;  3TY0 A;  3DZU D;  5KRK A;  5DWJ A;  5IAW A;  1FCY A;  3VT3 A;  4YPQ A;  2V7C A;  2Q5S A;  5DKE A;  1L2J A;  1M7W A;  4IW6 A;  1YIM A;  1OSV A;  3AZ2 A;  3ET1 A;  2PIQ A;  3UU7 B;  4LTW A;  2NW4 A;  4FNE A;  1R1K A;  3OLL A;  5DK9 A;  2R6Y A;  5E0X A;  1XP6 A;  4NB6 A;  4CI4 A;  5KCT A;  5KD9 A;  1L2I A;  2ATH A;  1NAV A;  1UHL A;  4MGA B;  3DZY D;  1K4W A;  2ACL B;  3T03 A;  1S19 A;  4RZE A;  3VT8 A;  4Q50 A;  3FAL A;  4X1F A;  3OSA A;  3RUU A;  4G20 A;  1LBD A;  3UUD A;  4OEA A;  4CSJ A;  1YIN A;  3M7R A;  2R40 D;  1U9E A;  1SQN A;  3AN3 A;  5L7G A;  2QSE A;  2BAW A;  3OSI A;  5DZ1 A;  3VTD A;  2YLP A;  5LGA A;  3P0U A;  5GT4 A;  4OEY A;  4J5W A;  2QAB A;  3VT4 A;  5AZT A;  3W0A A;  5EC9 A;  3BQD A;  3IPS A;  4K6I A;  4QM0 A;  1YA3 A;  4N8R A;  4OED A;  4XUM A;  1DKF B;  1NDE A;  2QZO B;  4MG9 B;  3IXP D;  3CS4 A;  4JAZ A;  2GPO A;  4OZT E;  3GWX A;  3VN2 A;  2QMV A;  1S9Q A;  2Z4B A;  3QT0 A;  2AO6 A;  1IE8 A;  3RUT A;  4DQM A;  3O1D A;  4L98 A;  1YMT A;  3HC5 A;  5DV6 A;  5E14 A;  1T65 A;  3DZU A;  5DSH A;  3ADT A;  4G2H A;  5DUH A;  3PRG A;  4IWF A;  4IS8 A;  2NPA A;  1K74 D;  5HCV A;  2POB A;  4LNX A;  5G3J A;  5HJP A;  5KYA A;  1NUO A;  5KYJ A;  4S14 A;  1YYE A;  5EI1 A;  2LBD A;  3N00 A;  3ET3 A;  2AX9 A;  3OLS A;  5DWL A;  3H0A D;  3UUA A;  4TUZ B;  3DZY A;  2QE4 A;  2I0J A;  5DXB A;  1NQ2 A;  2JF9 A;  3D57 A;  4JL4 A;  4K4J A;  3V9T A;  2I4Z A;  3R8I A;  2GPU A;  4FHI A;  4MG8 A;  4ZNS A;  2Q6S A;  3AFR A;  2R40 A;  2XKW A;  3DCU A;  1ZDU A;  2Q7L A;  4ZOM A;  3HM1 A;  1QKU A;  1XJ7 A;  4XLD A;  2PIR A;  2ZLC A;  4G1Z A;  1X7J A;  3W0G A;  1S0Z A;  2G0G A;  4ZNV A;  1NHZ A;  3OGT A;  4RUJ A;  5AAV B;  4IA1 A;  5KRJ A;  5DV8 A;  2J14 A;  3E00 D;  1T5Z A;  2AYR A;  3LMP A;  5G44 A;  4DK8 A;  2AX7 A;  4OKX A;  1ZAF A;  1FM9 A;  3IXP A;  4ZO1 B;  3GYU A;  5C4O A;  1ZUC A;  3GYT A;  4OEZ A;  2O9I A;  4ZNW A;  4DOR A;  3HLV A;  5EHJ A;  3WJ5 A;  3VJT A;  4ZN9 A;  1FCX A;  2IOG A;  3AUQ A;  3UP0 A;  4RMD A;  1QKT A;  4QL8 A;  1NQ0 A;  4J5W C;  5KCF A;  4QE6 A;  3W0H A;  1XAP A;  4WVD A;  1K74 A;  2Z4J A;  2BJ4 A;  5KRF A;  2E2R A;  4WHG A;  4UDC A;  3P89 A;  3CJW A;  3UVV B;  5AYG A;  1P8D A;  4MGB A;  4POJ A;  3WFG A;  3WFF A;  2HCD A;  2ZNO A;  4WPF A;  2AX8 A;  2J7Y A;  3H0A A;  5DY8 A;  5G45 A;  3VHV A;  3KDU A;  4NUF A;  1R5K A;  3L0E A;  3JZC A;  5ETH A;  1I37 A;  3WT5 A;  2ZK2 A;  2PIX A;  2ZNN A;  4R6S A;  2PIN A;  1DB1 A;  3WJ4 A;  1SR7 A;  3B5R A;  4HLW A;  3KMZ A;  3F5C B;  1YOK A;  2YHD A;  1UOM A;  3IMY A;  3O1E A;  4MG6 A;  4OH6 A;  3U9Q A;  2OVM A;  4G2I A;  1E3G A;  1RK3 A;  2ZNP A;  4ZJW A;  3AUN A;  3LBD A;  4PLE A;  3WT7 A;  4PRG A;  5DLR A;  3E00 A;  4DMA A;  2VST A;  1XV9 A;  4G21 A;  4RWV A;  3OOK A;  2QA8 B;  4XT9 A;  1X7E A;  5ACC A;  3GBK A;  4K7A A;  1S0X A;  2REW A;  1SKX A;  1SJ0 A;  1OVL A;  3P8X A;  3AN4 A;  1K7L A;  3VT9 A;  3IPU A;  3OLF A;  3OOF A;  4PXM A;  2Q7K A;  2GP7 A;  5DWG A;  2AMA A;  4DM8 A;  2XHS A;  4XI3 A;  2GPV A;  3DT3 A;  4IV2 A;  4PPS A;  5KRL A;  2GTK A;  3ET0 A;  3HO0 A;  3HVL A;  1Y0X X;  4QJR A;  1PCG A;  3B3K A;  3AZ1 A;  4XHD A;  1ZEO A;  1XDK A;  3B65 A;  3OAP A;  2JFA B;  4OLM A;  2HAM A;  2QXM A;  2AAX A;  3SP6 A;  1GWX A;  2P7A A;  2AA6 A;  1FD0 A;  2ZVT A;  3H52 A;  3B66 A;  4J5X A;  4OKW A;  5DZH A;  4A4W A;  4ZI1 A;  4G1D A;  5GIC A;  1E3K A;  4RE8 A;  2Q6J A;  2ZAS A;  2ZK6 A;  2VV1 B;  1MVC A;  2YLY A;  2P1U A;  3OSW A;  2P54 A;  4TV1 A;  4DOS A;  1XP9 A;  3KYT A;  4RAK A;  2HB8 A;  5DYB A;  5DTV A;  2HWR A;  3BEJ A;  3Q95 A;  3CS6 A;  4YNK A;  1Y9R A;  1ILG A;  1HJ1 A;  4OHA A;  2GL8 A;  5K13 A;  5FQR A;  1ILH A;  3B68 A;  4Q13 A;  4OJB A;  2ZK1 A;  3ADV A;  3FEJ A;  2Q8S A;  2J4A A;  4APU A;  3KFC A;  5APJ A;  3CTB A;  5E7V A;  2AMB A;  5HJS A;  3OMQ A;  2HC4 A;  5E1C A;  4B7W A;  3K8S A;  4FHH A;  5DRM A;  5C4U A;  2XYW A;  3ERD A;  2Q59 B;  4LSJ A;  4P6X A;  3A2J A;  2ZK3 A;  3IA6 A;  1N4H A;  2PIO A;  2VV4 A;  2ZNQ A;  4WHF A;  4BCR A;  1NRL A;  3VSO A;  4J26 A;  1XOW A;  1WM0 X;  4MG7 A;  3OZ0 A;  5JJM B;  4KZI A;  1PQ9 A;  2NXX A;  3CQV A;  1U3R A;  5DWI A;  1M2Z A;  4EM9 A;  4ITE A;  2IOK A;  2PJL A;  2ZLA A;  1ERR A;  3R8A A;  4IWC A;  3OMM A;  4DM6 A;  4IVY A;  5DXP A;  1R20 D;  4ZJR A;  2F4B A;  2Q3Y A;  4PP6 A;  3CS8 A;  3ET2 A;  2QR9 A;  2AA2 A;  2ZK0 A;  2QH6 A;  2PKL A;  3VTC A;  1PQC A;  3WT6 A;  1XVP B;  4YT1 A;  3WGP A;  1Q4X A;  4OIU A;  5KCU A;  3KMR A;  5AVL A;  1I7G A;  3ERT A;  5DV3 A;  1Z95 A;  3OMK A;  2PIT A;  5SYZ A;  3X36 A;  4PF3 A;  5JI0 D;  2Q5P A;  4RFW A;  5KRH A;  4J5X C;  4O8F A;  3ZRB A;  3KBA A;  3B0W A;  3UU7 A;  1XNN A;  3VJI A;  4JYG A;  3DR1 A;  1QKM A;  3E7C A;  4OZR U;  2QPY A;  4M8H A;  3G9E A;  1KNU A;  4MGA A;  4N73 A;  3W0Y A;  4OJ9 A;  2ACL A;  3UP3 A;  2GPP A;  3EYB A;  5DX3 B;  2VSR A;  5GIE A;  3X31 A;  3FC6 B;  3DCT A;  4LBD A;  2XYX A;  3GN8 A;  4JYH A;  3X1I A;  1NQ1 A;  5H1E A;  2P7G A;  3TKM A;  5EIT A;  2P7Z A;  2OZ7 A;  4A2J A;  2FAI A;  2ZMI A;  1T7T A;  1YOW A;  4JYI A;  1R20 A;  5IZ0 A;  1DKF A;  2QZO A;  3A9E B;  3ADS A;  4MG9 A;  1VJB A;  3CDS A;  1MZN A;  4Y29 A;  3B0T A;  5AAU A;  2H79 A;  4IA2 A;  2GWX A;  3GZ9 A;  4MGD B;  3V9Y A;  5LWP A;  2PIW A;  1XLS A;  3ZR7 A;  2OCF A;  2VV2 A;  4UDA A;  2B23 A;  4FGY A;  3CLD A;  1PK5 A;  2PNU A;  3OS8 C;  1XQC A;  3VTB A;  1GWQ A;  2HAS A;  2AXA A;  5DUG A;  1I38 A;  4IA3 A;  3PBA A;  4OKT A;  2Q60 A;  3FLI A;  3AX8 A;  4ITF A;  5DZ0 A;  3L0L A;  2POG A;  3VJS A;  5KCW A;  1YP0 A;  4RUO X;  4TUZ A;  1FM6 D;  1ERE A;  3L1B A;  2FSZ A;  5FQV A;  5FQP A;  5JY3 A;  2R6W A;  2ABI A;  3G0W A;  5DKS A;  2JJ3 A;  4UDD A;  1X7R A;  2OVH A;  4IU7 A;  3D5F A;  5E0W A;  2Q7J A;  3V9V A;  5EGV A;  2ZL9 A;  3FEI A;  3IPQ A;  3NSQ A;  4OC7 A;  3S9S A;  4OZR E;  4DK7 A;  1T63 A;  2I4J A;  1ZKY A;  1RKG A;  3VRU A;  5KCE A;  1T74 A;  5C4T A;  5KCC A;  1UHL B;  1P93 A;  3RVF A;  3OMP A;  2ZBS A;  5AAV A;  3A40 X;  4J24 A;  3RLJ A;  2QTU A;  2QA6 A;  3FS1 A;  3PLZ A;  3FAL B;  4P6W A;  5F9B A;  2Q70 A;  1G50 A;  3UUD B;  5FQT A;  3MNE A;  4OH5 A;  1YY4 A; 
#chains in the Genus database with same CATH topology
 3R5M A;  3V49 A;  3KDT A;  2VV0 A;  1UPV A;  3ZQT A;  3WTQ A;  1XZX X;  3L3X A;  5ICK A;  3MNO A;  4R2U A;  2AWH A;  2QGT A;  5B5B A;  5DKB A;  4REF A;  4RZF A;  5L7H A;  4RME A;  3RLL A;  2P1T A;  5EJV A;  2IHQ A;  5KRC A;  3UVV A;  5DRJ A;  3E94 A;  5DXM A;  4UDB A;  3L03 A;  2ZK4 A;  5KCD A;  2OAX A;  2XYJ A;  3B67 A;  5DI7 A;  3F7D A;  1PDU A;  5HYR A;  1H9U A;  3D24 A;  5DMC A;  2GIU A;  1I7I A;  5AK2 A;  1T79 A;  4S15 A;  2AA5 A;  3BC5 A;  1FM6 A;  4PWL A;  4RUP A;  5I4V A;  5E15 A;  2O4R A;  4QE8 A;  1EXA A;  2HVC A;  5AVI A;  3HC6 A;  5HJP B;  1X78 A;  2AB2 A;  4X1G A;  3SP9 A;  3A3Z X;  4IW8 A;  4REE A;  3K6P A;  3F5C A;  1Z5X U;  1T7R A;  4MGC A;  4R06 A;  3V4A A;  2PIP L;  1R6G A;  1FCZ A;  1PRG A;  2FVJ A;  3R29 A;  2ZMH A;  4KZJ A;  2NXX E;  1EXX A;  3UUA B;  1N46 A;  2YJD A;  3V3Q A;  1PZL A;  2AX6 A;  5DKG A;  5DXQ A;  5KRM A;  5DXB B;  4S0S A;  3ADU A;  5DVS A;  3VI8 A;  2Q1V A;  4NIE A;  2QA8 A;  5GID A;  4CI5 A;  1M13 A;  3R2A A;  5C4S A;  4ZNH A;  2B1Z A;  4MG8 B;  3P88 A;  3A2I A;  5DU5 A;  4ONI A;  4OKB A;  5DWE A;  3VHW A;  1G5Y A;  2YAT A;  2P1V A;  5DXR A;  5KRO A;  5AZV A;  5APK A;  3OS8 A;  4OJ4 A;  4NQA B;  3ADW A;  3PEQ A;  3R8D A;  1Y0S A;  2Q1H A;  2I4P A;  4IUI A;  3DY6 A;  1NAX A;  3OMO A;  4IV4 A;  4OK1 A;  2ZXM A;  3B1M A;  3D6D A;  3FUG A;  3VT7 A;  1G1U A;  5AWJ A;  2AM9 A;  4RMC A;  2Q7I A;  3OKH A;  2YLQ A;  1X76 A;  1IE9 A;  3FXV A;  2JFA A;  2QNV A;  3NSP A;  4MG5 A;  3VT6 A;  4ZNT A;  5HYK A;  5KRI A;  5E19 A;  3NOA A;  1ZGY A;  2VV3 A;  4PP5 A;  5DIE A;  2A3I A;  1FM9 D;  1T7F A;  2BJ4 B;  4XAO A;  1ZH7 A;  4E4K A;  2YLO A;  4PP3 A;  3ADX A;  2VV1 A;  2HFP A;  1T73 A;  4MGB B;  1YUC A;  1OT7 A;  1RKH A;  2OM9 A;  1G2N A;  2ZMJ A;  4PLD A;  4PVU A;  1U3S A;  2G0H A;  2P15 A;  4LNW A;  3L3Z A;  5DVV A;  1KKQ A;  3W5P A;  4POH A;  4YMQ A;  3VSP A;  4IQR A;  2ZXZ A;  4OAR A;  2ZFX A;  1Z5X E;  2ZXN A;  5AWK A;  3WMH A;  5B41 A;  1X7B A;  3B0Q A;  4S0T A;  3D90 A;  5KR9 A;  1PQ6 A;  2Q5G A;  4EMA A;  2Q59 A;  5FQS A;  4NY9 A;  1XLS E;  3CDP A;  4E4Q A;  3W5Q A;  1LV2 A;  2G5O A;  2QGW A;  3A2H A;  1TFC A;  1U3Q A;  4OIL A;  3KWY A;  1XV9 B;  1XPC A;  2QW4 A;  2YJA B;  3GWS X;  4KZM A;  3OS9 A;  5IXK A;  5DXG A;  5JJM A;  3X1H A;  1N83 A;  5DZ3 A;  1YJE A;  1OVL B;  1OSH A;  4HEE X;  2G44 A;  2HWQ A;  4OFR A;  2P4Y A;  3HZF A;  4FN9 A;  3SZ1 A;  3W0I A;  3VJH A;  1UPW A;  5APH A;  3W5T A;  1TXI A;  3KPZ A;  3W0J A;  3B0R A;  1XP1 A;  3AUR A;  3MNP A;  4ZNU A;  5G5W A;  3UUC A;  1A28 A;  1XVP A;  3K22 A;  4IVW A;  4ZN7 A;  5L11 A;  3G8O A;  4XTA A;  2AA7 A;  5M96 A;  1RDT D;  2W8Y A;  1XDK B;  2V0V A;  3TX7 B;  2Q6R A;  5DXK A;  1A52 A;  3V3E A;  2OUZ A;  2NV7 A;  2ZK5 A;  1BSX A;  1T7M A;  5DP0 A;  5DYD A;  4ZO1 X;  3W0C A;  3AZ3 A;  3RY9 A;  3VRV A;  2YFE A;  4OFU A;  2EWP A;  1ZDT A;  4TV1 B;  4OIV A;  3VHU A;  3WWR A;  1XIU A;  3TKC A;  1QKN A;  1RJK A;  5G43 A;  4OGH A;  4N1Y A;  5DXE A;  3Q95 B;  4MDD A;  5A86 A;  2PIV A;  1GS4 A;  2PRG A;  3JZB A;  5G42 A;  5DVC A;  5DZI A;  4XUH A;  5DIG A;  3FUR A;  2HBH A;  2QXS A;  1NYX A;  2Q61 A;  5DX3 A;  3FC6 A;  3OKI A;  1NQ7 A;  3ZRA A;  3VRW A;  2B50 A;  3GD2 A;  3ILZ A;  4JGV A;  4N5G A;  1R1K D;  3CWD A;  4RZG A;  1KV6 A;  1HG4 A;  3VRT A;  3HQ5 A;  4PPP A;  5CJ6 A;  4WLB A;  1GWR A;  3G8I A;  3L0J A;  4G1Y A;  4QK4 A;  5DUE A;  3W5R A;  3K23 A;  5L7E A;  5KRA A;  2VV4 B;  3A78 A;  3A9E A;  1XB7 A;  5DMF A;  3VT5 A;  2B1V A;  4A4V A;  4E2J A;  5G46 A;  2J7X A;  1T76 A;  2ZKC A;  3KMG A;  1S9P A;  4MG7 B;  5DL4 A;  3OZJ A;  2I0G A;  4MGD A;  4OZT U;  4WQP A;  1FBY A;  1RDT A;  4M8E A;  2O4J A;  3PCU A;  1XQ3 A;  2H77 A;  3PO9 A;  4IA7 A;  4Q0A C;  3R5N A;  5DID A;  1MV9 A;  5HZC A;  2HB7 A;  2ZY0 A;  4L96 A;  4F9M A;  2PIU A;  1XNX A;  2HAR A;  3HOD A;  3TY0 A;  3DZU D;  5KRK A;  5DWJ A;  5IAW A;  1FCY A;  3VT3 A;  4YPQ A;  2V7C A;  2Q5S A;  5DKE A;  1L2J A;  1M7W A;  4IW6 A;  1YIM A;  1OSV A;  3AZ2 A;  3ET1 A;  2PIQ A;  3UU7 B;  4LTW A;  2NW4 A;  4FNE A;  1R1K A;  3OLL A;  5DK9 A;  2R6Y A;  5E0X A;  1XP6 A;  4NB6 A;  4CI4 A;  5KCT A;  5KD9 A;  1L2I A;  2ATH A;  1NAV A;  1UHL A;  4MGA B;  3DZY D;  1K4W A;  2ACL B;  3T03 A;  1S19 A;  4RZE A;  3VT8 A;  4Q50 A;  3FAL A;  4X1F A;  3OSA A;  3RUU A;  4G20 A;  1LBD A;  3UUD A;  4OEA A;  4CSJ A;  1YIN A;  3M7R A;  2R40 D;  1U9E A;  1SQN A;  3AN3 A;  5L7G A;  2QSE A;  2BAW A;  3OSI A;  5DZ1 A;  3VTD A;  2YLP A;  5LGA A;  3P0U A;  5GT4 A;  4OEY A;  4J5W A;  2QAB A;  3VT4 A;  5AZT A;  3W0A A;  5EC9 A;  3BQD A;  3IPS A;  4K6I A;  4QM0 A;  1YA3 A;  4N8R A;  4OED A;  4XUM A;  1DKF B;  1NDE A;  2QZO B;  4MG9 B;  3IXP D;  3CS4 A;  4JAZ A;  2GPO A;  4OZT E;  3GWX A;  3VN2 A;  2QMV A;  1S9Q A;  2Z4B A;  3QT0 A;  2AO6 A;  1IE8 A;  3RUT A;  4DQM A;  3O1D A;  4L98 A;  1YMT A;  3HC5 A;  5DV6 A;  5E14 A;  1T65 A;  3DZU A;  5DSH A;  3ADT A;  4G2H A;  5DUH A;  3PRG A;  4IWF A;  4IS8 A;  2NPA A;  1K74 D;  5HCV A;  2POB A;  4LNX A;  5G3J A;  5HJP A;  5KYA A;  1NUO A;  5KYJ A;  4S14 A;  1YYE A;  5EI1 A;  2LBD A;  3N00 A;  3ET3 A;  2AX9 A;  3OLS A;  5DWL A;  3H0A D;  3UUA A;  4TUZ B;  3DZY A;  2QE4 A;  2I0J A;  5DXB A;  1NQ2 A;  2JF9 A;  3D57 A;  4JL4 A;  4K4J A;  3V9T A;  2I4Z A;  3R8I A;  2GPU A;  4FHI A;  4MG8 A;  4ZNS A;  2Q6S A;  3AFR A;  2R40 A;  2XKW A;  3DCU A;  1ZDU A;  2Q7L A;  4ZOM A;  3HM1 A;  1QKU A;  1XJ7 A;  4XLD A;  2PIR A;  2ZLC A;  4G1Z A;  1X7J A;  3W0G A;  1S0Z A;  2G0G A;  4ZNV A;  1NHZ A;  3OGT A;  4RUJ A;  5AAV B;  4IA1 A;  5KRJ A;  5DV8 A;  2J14 A;  3E00 D;  1T5Z A;  2AYR A;  3LMP A;  5G44 A;  4DK8 A;  2AX7 A;  4OKX A;  1ZAF A;  1FM9 A;  3IXP A;  4ZO1 B;  3GYU A;  5C4O A;  1ZUC A;  3GYT A;  4OEZ A;  2O9I A;  4ZNW A;  4DOR A;  3HLV A;  5EHJ A;  3WJ5 A;  3VJT A;  4ZN9 A;  1FCX A;  2IOG A;  3AUQ A;  3UP0 A;  4RMD A;  1QKT A;  4QL8 A;  1NQ0 A;  4J5W C;  5KCF A;  4QE6 A;  3W0H A;  1XAP A;  4WVD A;  1K74 A;  2Z4J A;  2BJ4 A;  5KRF A;  2E2R A;  4WHG A;  4UDC A;  3P89 A;  3CJW A;  3UVV B;  5AYG A;  1P8D A;  4MGB A;  4POJ A;  3WFG A;  3WFF A;  2HCD A;  2ZNO A;  4WPF A;  2AX8 A;  2J7Y A;  3H0A A;  5DY8 A;  5G45 A;  3VHV A;  3KDU A;  4NUF A;  1R5K A;  3L0E A;  3JZC A;  5ETH A;  1I37 A;  3WT5 A;  2ZK2 A;  2PIX A;  2ZNN A;  4R6S A;  2PIN A;  1DB1 A;  3WJ4 A;  1SR7 A;  3B5R A;  4HLW A;  3KMZ A;  3F5C B;  1YOK A;  2YHD A;  1UOM A;  3IMY A;  3O1E A;  4MG6 A;  4OH6 A;  3U9Q A;  2OVM A;  4G2I A;  1E3G A;  1RK3 A;  2ZNP A;  4ZJW A;  3AUN A;  3LBD A;  4PLE A;  3WT7 A;  4PRG A;  5DLR A;  3E00 A;  4DMA A;  2VST A;  1XV9 A;  4G21 A;  4RWV A;  3OOK A;  2QA8 B;  4XT9 A;  1X7E A;  5ACC A;  3GBK A;  4K7A A;  1S0X A;  2REW A;  1SKX A;  1SJ0 A;  1OVL A;  3P8X A;  3AN4 A;  1K7L A;  3VT9 A;  3IPU A;  3OLF A;  3OOF A;  4PXM A;  2Q7K A;  2GP7 A;  5DWG A;  2AMA A;  4DM8 A;  2XHS A;  4XI3 A;  2GPV A;  3DT3 A;  4IV2 A;  4PPS A;  5KRL A;  2GTK A;  3ET0 A;  3HO0 A;  3HVL A;  1Y0X X;  4QJR A;  1PCG A;  3B3K A;  3AZ1 A;  4XHD A;  1ZEO A;  1XDK A;  3B65 A;  3OAP A;  2JFA B;  4OLM A;  2HAM A;  2QXM A;  2AAX A;  3SP6 A;  1GWX A;  2P7A A;  2AA6 A;  1FD0 A;  2ZVT A;  3H52 A;  3B66 A;  4J5X A;  4OKW A;  5DZH A;  4A4W A;  4ZI1 A;  4G1D A;  5GIC A;  1E3K A;  4RE8 A;  2Q6J A;  2ZAS A;  2ZK6 A;  2VV1 B;  1MVC A;  2YLY A;  2P1U A;  3OSW A;  2P54 A;  4TV1 A;  4DOS A;  1XP9 A;  3KYT A;  4RAK A;  2HB8 A;  5DYB A;  5DTV A;  2HWR A;  3BEJ A;  3Q95 A;  3CS6 A;  4YNK A;  1Y9R A;  1ILG A;  1HJ1 A;  4OHA A;  2GL8 A;  5K13 A;  5FQR A;  1ILH A;  3B68 A;  4Q13 A;  4OJB A;  2ZK1 A;  3ADV A;  3FEJ A;  2Q8S A;  2J4A A;  4APU A;  3KFC A;  5APJ A;  3CTB A;  5E7V A;  2AMB A;  5HJS A;  3OMQ A;  2HC4 A;  5E1C A;  4B7W A;  3K8S A;  4FHH A;  5DRM A;  5C4U A;  2XYW A;  3ERD A;  2Q59 B;  4LSJ A;  4P6X A;  3A2J A;  2ZK3 A;  3IA6 A;  1N4H A;  2PIO A;  2VV4 A;  2ZNQ A;  4WHF A;  4BCR A;  1NRL A;  3VSO A;  4J26 A;  1XOW A;  1WM0 X;  4MG7 A;  3OZ0 A;  5JJM B;  4KZI A;  1PQ9 A;  2NXX A;  3CQV A;  1U3R A;  5DWI A;  1M2Z A;  4EM9 A;  4ITE A;  2IOK A;  2PJL A;  2ZLA A;  1ERR A;  3R8A A;  4IWC A;  3OMM A;  4DM6 A;  4IVY A;  5DXP A;  1R20 D;  4ZJR A;  2F4B A;  2Q3Y A;  4PP6 A;  3CS8 A;  3ET2 A;  2QR9 A;  2AA2 A;  2ZK0 A;  2QH6 A;  2PKL A;  3VTC A;  1PQC A;  3WT6 A;  1XVP B;  4YT1 A;  3WGP A;  1Q4X A;  4OIU A;  5KCU A;  3KMR A;  5AVL A;  1I7G A;  3ERT A;  5DV3 A;  1Z95 A;  3OMK A;  2PIT A;  5SYZ A;  3X36 A;  4PF3 A;  5JI0 D;  2Q5P A;  4RFW A;  5KRH A;  4J5X C;  4O8F A;  3ZRB A;  3KBA A;  3B0W A;  3UU7 A;  1XNN A;  3VJI A;  4JYG A;  3DR1 A;  1QKM A;  3E7C A;  4OZR U;  2QPY A;  4M8H A;  3G9E A;  1KNU A;  4MGA A;  4N73 A;  3W0Y A;  4OJ9 A;  2ACL A;  3UP3 A;  2GPP A;  3EYB A;  5DX3 B;  2VSR A;  5GIE A;  3X31 A;  3FC6 B;  3DCT A;  4LBD A;  2XYX A;  3GN8 A;  4JYH A;  3X1I A;  1NQ1 A;  5H1E A;  2P7G A;  3TKM A;  5EIT A;  2P7Z A;  2OZ7 A;  4A2J A;  2FAI A;  2ZMI A;  1T7T A;  1YOW A;  4JYI A;  1R20 A;  5IZ0 A;  1DKF A;  2QZO A;  3A9E B;  3ADS A;  4MG9 A;  1VJB A;  3CDS A;  1MZN A;  4Y29 A;  3B0T A;  5AAU A;  2H79 A;  4IA2 A;  2GWX A;  3GZ9 A;  4MGD B;  3V9Y A;  5LWP A;  2PIW A;  1XLS A;  3ZR7 A;  2OCF A;  2VV2 A;  4UDA A;  2B23 A;  4FGY A;  3CLD A;  1PK5 A;  2PNU A;  3OS8 C;  1XQC A;  3VTB A;  1GWQ A;  2HAS A;  2AXA A;  5DUG A;  1I38 A;  4IA3 A;  3PBA A;  4OKT A;  2Q60 A;  3FLI A;  3AX8 A;  4ITF A;  5DZ0 A;  3L0L A;  2POG A;  3VJS A;  5KCW A;  1YP0 A;  4RUO X;  4TUZ A;  1FM6 D;  1ERE A;  3L1B A;  2FSZ A;  5FQV A;  5FQP A;  5JY3 A;  2R6W A;  2ABI A;  3G0W A;  5DKS A;  2JJ3 A;  4UDD A;  1X7R A;  2OVH A;  4IU7 A;  3D5F A;  5E0W A;  2Q7J A;  3V9V A;  5EGV A;  2ZL9 A;  3FEI A;  3IPQ A;  3NSQ A;  4OC7 A;  3S9S A;  4OZR E;  4DK7 A;  1T63 A;  2I4J A;  1ZKY A;  1RKG A;  3VRU A;  5KCE A;  1T74 A;  5C4T A;  5KCC A;  1UHL B;  1P93 A;  3RVF A;  3OMP A;  2ZBS A;  5AAV A;  3A40 X;  4J24 A;  3RLJ A;  2QTU A;  2QA6 A;  3FS1 A;  3PLZ A;  3FAL B;  4P6W A;  5F9B A;  2Q70 A;  1G50 A;  3UUD B;  5FQT A;  3MNE A;  4OH5 A;  1YY4 A; 
#chains in the Genus database with same CATH homology
 3R5M A;  3V49 A;  3KDT A;  2VV0 A;  1UPV A;  3ZQT A;  3WTQ A;  1XZX X;  3L3X A;  5ICK A;  3MNO A;  4R2U A;  2AWH A;  2QGT A;  5B5B A;  5DKB A;  4REF A;  4RZF A;  5L7H A;  4RME A;  3RLL A;  2P1T A;  5EJV A;  2IHQ A;  5KRC A;  3UVV A;  5DRJ A;  3E94 A;  5DXM A;  4UDB A;  3L03 A;  2ZK4 A;  5KCD A;  2OAX A;  2XYJ A;  3B67 A;  5DI7 A;  3F7D A;  1PDU A;  5HYR A;  1H9U A;  3D24 A;  5DMC A;  2GIU A;  1I7I A;  5AK2 A;  1T79 A;  4S15 A;  2AA5 A;  3BC5 A;  1FM6 A;  4PWL A;  4RUP A;  5I4V A;  5E15 A;  2O4R A;  4QE8 A;  1EXA A;  2HVC A;  5AVI A;  3HC6 A;  5HJP B;  1X78 A;  2AB2 A;  4X1G A;  3SP9 A;  3A3Z X;  4IW8 A;  4REE A;  3K6P A;  3F5C A;  1Z5X U;  1T7R A;  4MGC A;  4R06 A;  3V4A A;  2PIP L;  1R6G A;  1FCZ A;  1PRG A;  2FVJ A;  3R29 A;  2ZMH A;  4KZJ A;  2NXX E;  1EXX A;  3UUA B;  1N46 A;  2YJD A;  3V3Q A;  1PZL A;  2AX6 A;  5DKG A;  5DXQ A;  5KRM A;  5DXB B;  4S0S A;  3ADU A;  5DVS A;  3VI8 A;  2Q1V A;  4NIE A;  2QA8 A;  5GID A;  4CI5 A;  1M13 A;  3R2A A;  5C4S A;  4ZNH A;  2B1Z A;  4MG8 B;  3P88 A;  3A2I A;  5DU5 A;  4ONI A;  4OKB A;  5DWE A;  3VHW A;  1G5Y A;  2YAT A;  2P1V A;  5DXR A;  5KRO A;  5AZV A;  5APK A;  3OS8 A;  4OJ4 A;  4NQA B;  3ADW A;  3PEQ A;  3R8D A;  1Y0S A;  2Q1H A;  2I4P A;  4IUI A;  3DY6 A;  1NAX A;  3OMO A;  4IV4 A;  4OK1 A;  2ZXM A;  3B1M A;  3D6D A;  3FUG A;  3VT7 A;  1G1U A;  5AWJ A;  2AM9 A;  4RMC A;  2Q7I A;  3OKH A;  2YLQ A;  1X76 A;  1IE9 A;  3FXV A;  2JFA A;  2QNV A;  3NSP A;  4MG5 A;  3VT6 A;  4ZNT A;  5HYK A;  5KRI A;  5E19 A;  3NOA A;  1ZGY A;  2VV3 A;  4PP5 A;  5DIE A;  2A3I A;  1FM9 D;  1T7F A;  2BJ4 B;  4XAO A;  1ZH7 A;  4E4K A;  2YLO A;  4PP3 A;  3ADX A;  2VV1 A;  2HFP A;  1T73 A;  4MGB B;  1YUC A;  1OT7 A;  1RKH A;  2OM9 A;  1G2N A;  2ZMJ A;  4PLD A;  4PVU A;  1U3S A;  2G0H A;  2P15 A;  4LNW A;  3L3Z A;  5DVV A;  1KKQ A;  3W5P A;  4POH A;  4YMQ A;  3VSP A;  4IQR A;  2ZXZ A;  4OAR A;  2ZFX A;  1Z5X E;  2ZXN A;  5AWK A;  3WMH A;  5B41 A;  1X7B A;  3B0Q A;  4S0T A;  3D90 A;  5KR9 A;  1PQ6 A;  2Q5G A;  4EMA A;  2Q59 A;  5FQS A;  4NY9 A;  1XLS E;  3CDP A;  4E4Q A;  3W5Q A;  1LV2 A;  2G5O A;  2QGW A;  3A2H A;  1TFC A;  1U3Q A;  4OIL A;  3KWY A;  1XV9 B;  1XPC A;  2QW4 A;  2YJA B;  3GWS X;  4KZM A;  3OS9 A;  5IXK A;  5DXG A;  5JJM A;  3X1H A;  1N83 A;  5DZ3 A;  1YJE A;  1OVL B;  1OSH A;  4HEE X;  2G44 A;  2HWQ A;  4OFR A;  2P4Y A;  3HZF A;  4FN9 A;  3SZ1 A;  3W0I A;  3VJH A;  1UPW A;  5APH A;  3W5T A;  1TXI A;  3KPZ A;  3W0J A;  3B0R A;  1XP1 A;  3AUR A;  3MNP A;  4ZNU A;  5G5W A;  3UUC A;  1A28 A;  1XVP A;  3K22 A;  4IVW A;  4ZN7 A;  5L11 A;  3G8O A;  4XTA A;  2AA7 A;  5M96 A;  1RDT D;  2W8Y A;  1XDK B;  2V0V A;  3TX7 B;  2Q6R A;  5DXK A;  1A52 A;  3V3E A;  2OUZ A;  2NV7 A;  2ZK5 A;  1BSX A;  1T7M A;  5DP0 A;  5DYD A;  4ZO1 X;  3W0C A;  3AZ3 A;  3RY9 A;  3VRV A;  2YFE A;  4OFU A;  2EWP A;  1ZDT A;  4TV1 B;  4OIV A;  3VHU A;  3WWR A;  1XIU A;  3TKC A;  1QKN A;  1RJK A;  5G43 A;  4OGH A;  4N1Y A;  5DXE A;  3Q95 B;  4MDD A;  5A86 A;  2PIV A;  1GS4 A;  2PRG A;  3JZB A;  5G42 A;  5DVC A;  5DZI A;  4XUH A;  5DIG A;  3FUR A;  2HBH A;  2QXS A;  1NYX A;  2Q61 A;  5DX3 A;  3FC6 A;  3OKI A;  1NQ7 A;  3ZRA A;  3VRW A;  2B50 A;  3GD2 A;  3ILZ A;  4JGV A;  4N5G A;  1R1K D;  3CWD A;  4RZG A;  1KV6 A;  1HG4 A;  3VRT A;  3HQ5 A;  4PPP A;  5CJ6 A;  4WLB A;  1GWR A;  3G8I A;  3L0J A;  4G1Y A;  4QK4 A;  5DUE A;  3W5R A;  3K23 A;  5L7E A;  5KRA A;  2VV4 B;  3A78 A;  3A9E A;  1XB7 A;  5DMF A;  3VT5 A;  2B1V A;  4A4V A;  4E2J A;  5G46 A;  2J7X A;  1T76 A;  2ZKC A;  3KMG A;  1S9P A;  4MG7 B;  5DL4 A;  3OZJ A;  2I0G A;  4MGD A;  4OZT U;  4WQP A;  1FBY A;  1RDT A;  4M8E A;  2O4J A;  3PCU A;  1XQ3 A;  2H77 A;  3PO9 A;  4IA7 A;  4Q0A C;  3R5N A;  5DID A;  1MV9 A;  5HZC A;  2HB7 A;  2ZY0 A;  4L96 A;  4F9M A;  2PIU A;  1XNX A;  2HAR A;  3HOD A;  3TY0 A;  3DZU D;  5KRK A;  5DWJ A;  5IAW A;  1FCY A;  3VT3 A;  4YPQ A;  2V7C A;  2Q5S A;  5DKE A;  1L2J A;  1M7W A;  4IW6 A;  1YIM A;  1OSV A;  3AZ2 A;  3ET1 A;  2PIQ A;  3UU7 B;  4LTW A;  2NW4 A;  4FNE A;  1R1K A;  3OLL A;  5DK9 A;  2R6Y A;  5E0X A;  1XP6 A;  4NB6 A;  4CI4 A;  5KCT A;  5KD9 A;  1L2I A;  2ATH A;  1NAV A;  1UHL A;  4MGA B;  3DZY D;  1K4W A;  2ACL B;  3T03 A;  1S19 A;  4RZE A;  3VT8 A;  4Q50 A;  3FAL A;  4X1F A;  3OSA A;  3RUU A;  4G20 A;  1LBD A;  3UUD A;  4OEA A;  4CSJ A;  1YIN A;  3M7R A;  2R40 D;  1U9E A;  1SQN A;  3AN3 A;  5L7G A;  2QSE A;  2BAW A;  3OSI A;  5DZ1 A;  3VTD A;  2YLP A;  5LGA A;  3P0U A;  5GT4 A;  4OEY A;  4J5W A;  2QAB A;  3VT4 A;  5AZT A;  3W0A A;  5EC9 A;  3BQD A;  3IPS A;  4K6I A;  4QM0 A;  1YA3 A;  4N8R A;  4OED A;  4XUM A;  1DKF B;  1NDE A;  2QZO B;  4MG9 B;  3IXP D;  3CS4 A;  4JAZ A;  2GPO A;  4OZT E;  3GWX A;  3VN2 A;  2QMV A;  1S9Q A;  2Z4B A;  3QT0 A;  2AO6 A;  1IE8 A;  3RUT A;  4DQM A;  3O1D A;  4L98 A;  1YMT A;  3HC5 A;  5DV6 A;  5E14 A;  1T65 A;  3DZU A;  5DSH A;  3ADT A;  4G2H A;  5DUH A;  3PRG A;  4IWF A;  4IS8 A;  2NPA A;  1K74 D;  5HCV A;  2POB A;  4LNX A;  5G3J A;  5HJP A;  5KYA A;  1NUO A;  5KYJ A;  4S14 A;  1YYE A;  5EI1 A;  2LBD A;  3N00 A;  3ET3 A;  2AX9 A;  3OLS A;  5DWL A;  3H0A D;  3UUA A;  4TUZ B;  3DZY A;  2QE4 A;  2I0J A;  5DXB A;  1NQ2 A;  2JF9 A;  3D57 A;  4JL4 A;  4K4J A;  3V9T A;  2I4Z A;  3R8I A;  2GPU A;  4FHI A;  4MG8 A;  4ZNS A;  2Q6S A;  3AFR A;  2R40 A;  2XKW A;  3DCU A;  1ZDU A;  2Q7L A;  4ZOM A;  3HM1 A;  1QKU A;  1XJ7 A;  4XLD A;  2PIR A;  2ZLC A;  4G1Z A;  1X7J A;  3W0G A;  1S0Z A;  2G0G A;  4ZNV A;  1NHZ A;  3OGT A;  4RUJ A;  5AAV B;  4IA1 A;  5KRJ A;  5DV8 A;  2J14 A;  3E00 D;  1T5Z A;  2AYR A;  3LMP A;  5G44 A;  4DK8 A;  2AX7 A;  4OKX A;  1ZAF A;  1FM9 A;  3IXP A;  4ZO1 B;  3GYU A;  5C4O A;  1ZUC A;  3GYT A;  4OEZ A;  2O9I A;  4ZNW A;  4DOR A;  3HLV A;  5EHJ A;  3WJ5 A;  3VJT A;  4ZN9 A;  1FCX A;  2IOG A;  3AUQ A;  3UP0 A;  4RMD A;  1QKT A;  4QL8 A;  1NQ0 A;  4J5W C;  5KCF A;  4QE6 A;  3W0H A;  1XAP A;  4WVD A;  1K74 A;  2Z4J A;  2BJ4 A;  5KRF A;  2E2R A;  4WHG A;  4UDC A;  3P89 A;  3CJW A;  3UVV B;  5AYG A;  1P8D A;  4MGB A;  4POJ A;  3WFG A;  3WFF A;  2HCD A;  2ZNO A;  4WPF A;  2AX8 A;  2J7Y A;  3H0A A;  5DY8 A;  5G45 A;  3VHV A;  3KDU A;  4NUF A;  1R5K A;  3L0E A;  3JZC A;  5ETH A;  1I37 A;  3WT5 A;  2ZK2 A;  2PIX A;  2ZNN A;  4R6S A;  2PIN A;  1DB1 A;  3WJ4 A;  1SR7 A;  3B5R A;  4HLW A;  3KMZ A;  3F5C B;  1YOK A;  2YHD A;  1UOM A;  3IMY A;  3O1E A;  4MG6 A;  4OH6 A;  3U9Q A;  2OVM A;  4G2I A;  1E3G A;  1RK3 A;  2ZNP A;  4ZJW A;  3AUN A;  3LBD A;  4PLE A;  3WT7 A;  4PRG A;  5DLR A;  3E00 A;  4DMA A;  2VST A;  1XV9 A;  4G21 A;  4RWV A;  3OOK A;  2QA8 B;  4XT9 A;  1X7E A;  5ACC A;  3GBK A;  4K7A A;  1S0X A;  2REW A;  1SKX A;  1SJ0 A;  1OVL A;  3P8X A;  3AN4 A;  1K7L A;  3VT9 A;  3IPU A;  3OLF A;  3OOF A;  4PXM A;  2Q7K A;  2GP7 A;  5DWG A;  2AMA A;  4DM8 A;  2XHS A;  4XI3 A;  2GPV A;  3DT3 A;  4IV2 A;  4PPS A;  5KRL A;  2GTK A;  3ET0 A;  3HO0 A;  3HVL A;  1Y0X X;  4QJR A;  1PCG A;  3B3K A;  3AZ1 A;  4XHD A;  1ZEO A;  1XDK A;  3B65 A;  3OAP A;  2JFA B;  4OLM A;  2HAM A;  2QXM A;  2AAX A;  3SP6 A;  1GWX A;  2P7A A;  2AA6 A;  1FD0 A;  2ZVT A;  3H52 A;  3B66 A;  4J5X A;  4OKW A;  5DZH A;  4A4W A;  4ZI1 A;  4G1D A;  5GIC A;  1E3K A;  4RE8 A;  2Q6J A;  2ZAS A;  2ZK6 A;  2VV1 B;  1MVC A;  2YLY A;  2P1U A;  3OSW A;  2P54 A;  4TV1 A;  4DOS A;  1XP9 A;  3KYT A;  4RAK A;  2HB8 A;  5DYB A;  5DTV A;  2HWR A;  3BEJ A;  3Q95 A;  3CS6 A;  4YNK A;  1Y9R A;  1ILG A;  1HJ1 A;  4OHA A;  2GL8 A;  5K13 A;  5FQR A;  1ILH A;  3B68 A;  4Q13 A;  4OJB A;  2ZK1 A;  3ADV A;  3FEJ A;  2Q8S A;  2J4A A;  4APU A;  3KFC A;  5APJ A;  3CTB A;  5E7V A;  2AMB A;  5HJS A;  3OMQ A;  2HC4 A;  5E1C A;  4B7W A;  3K8S A;  4FHH A;  5DRM A;  5C4U A;  2XYW A;  3ERD A;  2Q59 B;  4LSJ A;  4P6X A;  3A2J A;  2ZK3 A;  3IA6 A;  1N4H A;  2PIO A;  2VV4 A;  2ZNQ A;  4WHF A;  4BCR A;  1NRL A;  3VSO A;  4J26 A;  1XOW A;  1WM0 X;  4MG7 A;  3OZ0 A;  5JJM B;  4KZI A;  1PQ9 A;  2NXX A;  3CQV A;  1U3R A;  5DWI A;  1M2Z A;  4EM9 A;  4ITE A;  2IOK A;  2PJL A;  2ZLA A;  1ERR A;  3R8A A;  4IWC A;  3OMM A;  4DM6 A;  4IVY A;  5DXP A;  1R20 D;  4ZJR A;  2F4B A;  2Q3Y A;  4PP6 A;  3CS8 A;  3ET2 A;  2QR9 A;  2AA2 A;  2ZK0 A;  2QH6 A;  2PKL A;  3VTC A;  1PQC A;  3WT6 A;  1XVP B;  4YT1 A;  3WGP A;  1Q4X A;  4OIU A;  5KCU A;  3KMR A;  5AVL A;  1I7G A;  3ERT A;  5DV3 A;  1Z95 A;  3OMK A;  2PIT A;  5SYZ A;  3X36 A;  4PF3 A;  5JI0 D;  2Q5P A;  4RFW A;  5KRH A;  4J5X C;  4O8F A;  3ZRB A;  3KBA A;  3B0W A;  3UU7 A;  1XNN A;  3VJI A;  4JYG A;  3DR1 A;  1QKM A;  3E7C A;  4OZR U;  2QPY A;  4M8H A;  3G9E A;  1KNU A;  4MGA A;  4N73 A;  3W0Y A;  4OJ9 A;  2ACL A;  3UP3 A;  2GPP A;  3EYB A;  5DX3 B;  2VSR A;  5GIE A;  3X31 A;  3FC6 B;  3DCT A;  4LBD A;  2XYX A;  3GN8 A;  4JYH A;  3X1I A;  1NQ1 A;  5H1E A;  2P7G A;  3TKM A;  5EIT A;  2P7Z A;  2OZ7 A;  4A2J A;  2FAI A;  2ZMI A;  1T7T A;  1YOW A;  4JYI A;  1R20 A;  5IZ0 A;  1DKF A;  2QZO A;  3A9E B;  3ADS A;  4MG9 A;  1VJB A;  3CDS A;  1MZN A;  4Y29 A;  3B0T A;  5AAU A;  2H79 A;  4IA2 A;  2GWX A;  3GZ9 A;  4MGD B;  3V9Y A;  5LWP A;  2PIW A;  1XLS A;  3ZR7 A;  2OCF A;  2VV2 A;  4UDA A;  2B23 A;  4FGY A;  3CLD A;  1PK5 A;  2PNU A;  3OS8 C;  1XQC A;  3VTB A;  1GWQ A;  2HAS A;  2AXA A;  5DUG A;  1I38 A;  4IA3 A;  3PBA A;  4OKT A;  2Q60 A;  3FLI A;  3AX8 A;  4ITF A;  5DZ0 A;  3L0L A;  2POG A;  3VJS A;  5KCW A;  1YP0 A;  4RUO X;  4TUZ A;  1FM6 D;  1ERE A;  3L1B A;  2FSZ A;  5FQV A;  5FQP A;  5JY3 A;  2R6W A;  2ABI A;  3G0W A;  5DKS A;  2JJ3 A;  4UDD A;  1X7R A;  2OVH A;  4IU7 A;  3D5F A;  5E0W A;  2Q7J A;  3V9V A;  5EGV A;  2ZL9 A;  3FEI A;  3IPQ A;  3NSQ A;  4OC7 A;  3S9S A;  4OZR E;  4DK7 A;  1T63 A;  2I4J A;  1ZKY A;  1RKG A;  3VRU A;  5KCE A;  1T74 A;  5C4T A;  5KCC A;  1UHL B;  1P93 A;  3RVF A;  3OMP A;  2ZBS A;  5AAV A;  3A40 X;  4J24 A;  3RLJ A;  2QTU A;  2QA6 A;  3FS1 A;  3PLZ A;  3FAL B;  4P6W A;  5F9B A;  2Q70 A;  1G50 A;  3UUD B;  5FQT A;  3MNE A;  4OH5 A;  1YY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...