5DX3B

Estrogen receptor alpha ligand binding domain y537s mutant in complex with stapled peptide src2-p3 and estradiol
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
241
structure length
224
Chain Sequence
LSLTADQMVSALLDAEPPILYSEFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKMVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGYTFKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Stapled Peptides with gamma-Methylated Hydrocarbon Chains for the Estrogen Receptor/Coactivator Interaction.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Hormone receptor/peptide
source organism Homo sapiens
total genus 88
structure length 224
sequence length 241
ec nomenclature
pdb deposition date 2015-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5dx3B00
5C4TA 1M7WA 3SZ1A 2G44A 2HB7A 4IV2A 4M8EA 1E3GA 1NQ2A 5DX3B 4R6SA 3E7CA 3GZ9A 3IMYA 2V0VA 4XLDA 5DKGA 1I38A 1RKGA 2FVJA 4G21A 4IW8A 5DXPA 4IWCA 3GN8A 3PO9A 1K74D 3OLFA 5AWJA 1XB7A 3B0TA 4IU7A 4S0TA 3WGPA 3CLDA 5E15A 1T65A 4TUZA 5E14A 2IOKA 5DI7A 5DIDA 1QKUA 5AYGA 2QZOB 1OVLA 1UPVA 2QA6A 3UP3A 2YLYA 4RWVA 3FXVA 4E4QA 3S9SA 4OH6A 2Z4BA 1FM6D 5EJVA 2W8YA 2ATHA 1XVPA 2PKLA 2HFPA 2NXXE 1T73A 3OOFA 4QE8A 3B65A 1PQCA 1GWQA 2Z4JA 3W0GA 3B3KA 5EHJA 5DV6A 4A2JA 1G5YA 2AX9A 2Q5PA 3PBAA 2I4PA 3DZYD 1UHLA 5DXBB 3KDTA 4Q0AC 3VI8A 2PIVA 3CDPA 4G1ZA 4WHGA 3RLLA 1BSXA 5CJ6A 5AZTA 3RVFA 1N46A 3L0EA 2AMBA 1R20D 3CDSA 4YNKA 5JJMB 3K8SA 3PCUA 3DT3A 1S0ZA 4OEAA 1ZDUA 4RZGA 4Y29A 5GIEA 3A9EA 3IPQA 2PIXA 4JL4A 4TV1B 5DZHA 5HJSA 3W0JA 3UUDB 4NY9A 2B23A 4XHDA 4CI4A 4WHFA 1G2NA 1M13A 4IUIA 4MG9B 5B41A 3FEJA 4J5XC 4RZFA 3D24A 4DK7A 2YLPA 1PDUA 4ONIA 5SYZA 5DKSA 5DWLA 2R6WA 4OIUA 1I7IA 4L96A 4ZJRA 5DKBA 1YYEA 2Q59A 3NOAA 5L7GA 2NXXA 2PIRA 1Y0XX 2GPUA 5APJA 1XZXX 2VV4B 3L3XA 5DZ1A 5AAUA 2PIWA 4PP6A 3VRWA 1U9EA 3UP0A 2YJDA 3B1MA 1R1KD 1T7MA 2H79A 4OKBA 4P6XA 2QA8A 1EXXA 4BCRA 5LWPA 2G5OA 3E94A 4E2JA 4JYIA 3V9VA 2I4ZA 5DIGA 2GPOA 1T7FA 3VTCA 3OMMA 3W0IA 2PIPL 4KZJA 2Q1VA 2PINA 3V9TA 2PITA 2GPVA 5E0WA 3L0LA 1NDEA 3Q95A 5DVSA 5C4UA 4B7WA 2PJLA 2H77A 3OKIA 4XAOA 2AMAA 3R8IA 3TKCA 4OC7A 4MGCA 2I0GA 3V3QA 5DMCA 1T7RA 4N5GA 4MG7B 3LMPA 3IPSA 1MZNA 2OVHA 1XNNA 3W0YA 3LBDA 4OEYA 3K22A 1IE8A 1XV9B 2VSRA 4JYHA 3D57A 5E0XA 1R5KA 4PLDA 3VRTA 4MGAA 2OZ7A 3P88A 4LNXA 3UU7A 2G0HA 1KKQA 2ZNOA 4QJRA 4ZNHA 5APKA 5G43A 4A4VA 4LNWA 5DV3A 4E4KA 5DZIA 1M2ZA 2B50A 3KMZA 3V9YA 1RK3A 1ZAFA 4OILA 5L7HA 2AX6A 4CSJA 4RE8A 2J4AA 4PF3A 1GWRA 1XLSE 3UUAB 1HG4A 3VTDA 1ZKYA 4MDDA 4G2HA 3CWDA 4IV4A 4JGVA 3WMHA 5GICA 5DVCA 2QW4A 2Q7JA 3GYTA 4Q13A 1X78A 1XIUA 2ZK0A 1XAPA 4ZNSA 3X1HA 2HASA 5KRFA 3FUGA 3OSIA 1FM6A 1Y0SA 3X1IA 2QGWA 1ILGA 3W0HA 1DKFB 2IOGA 5DYBA 3VRUA 4N73A 2YATA 5FQTA 4F9MA 4ZI1A 5DY8A 4OFUA 3FC6B 4UDBA 3R8AA 4J5WC 3FS1A 4S0SA 5H1EA 3X31A 3KDUA 1P8DA 2I0JA 4OJBA 2AAXA 2Q60A 2ZBSA 1LV2A 1YY4A 2QSEA 4MGBA 4OJ9A 1XPCA 3UUCA 1YOWA 3W5QA 4EMAA 3HM1A 2YHDA 5HYRA 3RLJA 5LGAA 1T63A 2FAIA 5AWKA 5DXMA 3UVVB 3B0QA 1T5ZA 4LSJA 3VT9A 5I4VA 4QL8A 5AK2A 4P6WA 1ZUCA 2HAMA 2OVMA 2HWQA 2HCDA 3L3ZA 3IPUA 5HJPA 1ZGYA 3X36A 1R20A 1MVCA 5KRMA 3DR1A 3ILZA 3R5NA 1YIMA 1XLSA 4NIEA 2ZVTA 3K6PA 2ZMIA 2ACLB 5E7VA 3ERDA 4PP5A 2R6YA 3OMQA 4PRGA 5HZCA 4XUMA 1NQ7A 1NQ0A 3HC5A 4QM0A 2ZNPA 5KYAA 5G45A 2J7XA 4HLWA 4JAZA 5DWJA 3FALB 1K4WA 4HEEX 2OCFA 5FQSA 5C4SA 2QMVA 2QABA 5G5WA 3OOKA 4DQMA 2Q1HA 4NQAB 4OZTU 2Q6JA 3ADVA 1NAVA 3OMKA 4OGHA 4OH5A 4RZEA 3O1DA 1NRLA 5KR9A 1X7BA 2P7AA 2Q3YA 4ZO1X 4UDDA 5DIEA 3P0UA 5DUHA 1R1KA 2HVCA 2AWHA 2JJ3A 2YLOA 2AX8A 3G0WA 5KCUA 5KRKA 2QPYA 4UDAA 1IE9A 5JJMA 3F7DA 3AN3A 2JF9A 3OZ0A 5KRJA 3HVLA 1N4HA 2B1VA 3WFGA 4OZTE 4TV1A 5EGVA 3R5MA 3TKMA 4N1YA 3UUDA 3V49A 5KROA 5EC9A 3W5RA 5ICKA 4ZN7A 3R2AA 4OJ4A 4MG9A 5DXBA 3OS8C 3VT6A 3HZFA 3VSOA 2AO6A 2HBHA 2GP7A 3VT8A 3KMGA 2POBA 5K13A 5KCFA 1OVLB 1X7JA 2VV4A 1A28A 1ZH7A 2ZY0A 3AZ1A 3B0WA 3CJWA 3D90A 5AZVA 1T76A 3CS4A 2P7ZA 2A3IA 1LBDA 2HB8A 3IXPD 4G2IA 5DRJA 1S0XA 3B66A 5KRLA 2ZNNA 3B67A 4CI5A 3HODA 3M7RA 1S9PA 5G44A 2QR9A 5DXQA 5AVIA 4XUHA 2Q5SA 5JI0D 1NAXA 4MG6A 3VHVA 3OAPA 2ABIA 4MG7A 3BQDA 4WVDA 3VTBA 3FURA 3GWXA 4Q50A 1ZDTA 3JZCA 1XV9A 4PPPA 1L2IA 4DK8A 3AN4A 3DCTA 5KRCA 1K7LA 2REWA 3B5RA 2VV2A 5KYJA 3A9EB 4OKXA 5KRHA 2P1VA 2VSTA 2AM9A 2PIUA 1PRGA 4J26A 4ZO1B 3ADXA 5G3JA 1KV6A 4RUJA 2PRGA 4RMCA 3P8XA 3W0CA 2XYJA 3A3ZX 4YMQA 2ZXMA 3PRGA 1FM9A 1GWXA 4IA2A 5G46A 2Q6RA 2ZLAA 3AUQA 2AA6A 2BJ4B 1Z95A 2Q59B 3F5CB 3KMRA 4OHAA 1U3RA 1XP9A 3DCUA 5AAVA 3BEJA 3OMOA 1FBYA 2ZXNA 3OLSA 2O9IA 1DKFA 4PPSA 1FCXA 3EYBA 3L1BA 3R29A 4R06A 4APUA 4POJA 4ZOMA 1G1UA 2G0GA 4RMDA 2ZKCA 1YJEA 1SQNA 1XDKB 5APHA 2AA7A 5JY3A 1OSHA 2P15A 4MG8A 3W0AA 1YMTA 4RMEA 2HARA 2HC4A 1Y9RA 4FGYA 4A4WA 4ZNVA 3OKHA 4XI3A 4YPQA 3VSPA 2OUZA 2QXMA 4OARA 2QE4A 4XTAA 5B5BA 3JZBA 2GWXA 2O4JA 3ERTA 4OKWA 3DY6A 3KBAA 4G1DA 1SKXA 3DZUD 3SP6A 1MV9A 3ZRBA 3CTBA 3ADTA 4KZIA 5KCDA 1U3QA 3OZJA 4DMAA 1RJKA 1TFCA 3ZR7A 5DUEA 2VV3A 5DXEA 4PVUA 3KYTA 3BC5A 1SR7A 3VT7A 5DX3A 5KCTA 2XKWA 3ADWA 4IVWA 3OSAA 1X7EA 3G8OA 3V4AA 3W5PA 2P7GA 3ET1A 1VJBA 2JFAB 4J5XA 5KCEA 1FM9D 3WWRA 3GD2A 5FQPA 5L11A 1XP6A 4O8FA 2VV1B 5KCWA 5DWIA 3B0RA 3E00D 4MGDB 1U3SA 2QZOA 4ITEA 3WT6A 4DM8A 1T74A 5ETHA 5GIDA 2AA5A 4ZNWA 3OSWA 2IHQA 3W5TA 4FHHA 4WLBA 1PCGA 2ZMJA 1DB1A 2ZK1A 1NHZA 1ZEOA 1XQCA 3IXPA 4ZNTA 5M96A 1QKTA 2ZK4A 4FHIA 4UDCA 3CS6A 2J7YA 4IA1A 4IW6A 3ET0A 2AA2A 1N83A 1XNXA 1OT7A 1ILHA 2GTKA 4IQRA 1T79A 2E2RA 3AZ2A 3K23A 3VHWA 5ACCA 3WFFA 5L7EA 1RKHA 5EI1A 3A78A 1GS4A 3H0AD 2QH6A 5DZ3A 2QNVA 3NSPA 2ZK3A 5DUGA 4ZN9A 3WTQA 5DV8A 5F9BA 3VN2A 2NPAA 1WM0X 3VJHA 3VT3A 3HC6A 5HJPB 5IZ0A 3WT7A 1PQ9A 3GBKA 5EITA 1NYXA 1ERRA 3QT0A 3VJTA 4QK4A 2ZMHA 2FSZA 3D6DA 5DZ0A 4R2UA 4K7AA 5DU5A 5DXGA 2OM9A 3SP9A 1T7TA 3HLVA 2R40D 3HO0A 5C4OA 1SJ0A 4G20A 3N00A 5DLRA 5GT4A 4TUZB 2Q7LA 2ZK5A 3G9EA 1EREA 2Q5GA 2PIQA 3CQVA 1YOKA 3O1EA 2F4BA 1RDTD 4PP3A 2P1TA 2Q70A 4PWLA 4RUOX 3GYUA 4IA3A 4OZRU 1XVPB 2QGTA 2YFEA 4PLEA 3FEIA 3GWSX 4NB6A 2EWPA 4J5WA 5DVVA 1S9QA 4G1YA 3OLLA 3V3EA 2V7CA 2ZXZA 4OEZA 3A2IA 3B68A 2QXSA 4L98A 3RUUA 1Z5XU 1XQ3A 2NW4A 2P54A 2YLQA 3TY0A 5HYKA 3TX7B 4WPFA 2XYXA 2O4RA 2AXAA 5KCCA 2HWRA 1UHLB 2Q7IA 5DWGA 3VT4A 3WJ5A 3AZ3A 3ADSA 4OZRE 5KRAA 5DRMA 4DOSA 3DZUA 4QE6A 2OAXA 1FCZA 1X7RA 3CS8A 1A52A 2ZLCA 5E19A 3VRVA 2ZK6A 3MNEA 3RY9A 4S14A 1Z5XE 4LBDA 2BJ4A 5DL4A 3F5CA 1XP1A 2ZASA 5DXRA 5G42A 2AB2A 3ET2A 4ZJWA 1X76A 3A2JA 5DKEA 4OKTA 4YT1A 4DORA 2LBDA 1I37A 4OFRA 1PK5A 4PXMA 2Q6SA 3UUAA 1TXIA 4FNEA 5HCVA 4J24A 3ZRAA 2AYRA 4MG5A 3E00A 3OS9A 1XDKA 4REEA 3D5FA 3VHUA 2I4JA 3MNPA 4IA7A 4EM9A 1FCYA 1Q4XA 4N8RA 5DYDA 4JYGA 1R6GA 3H52A 4S15A 3KPZA 5FQVA 3AUNA 1YA3A 2VV0A 2Q61A 3IA6A 4POHA 3WJ4A 2QA8B 4RUPA 2GL8A 1QKMA 5DK9A 3R8DA 3AFRA 5DP0A 3OGTA 4OK1A 3FC6A 4X1FA 5KRIA 3VT5A 4DM6A 4RFWA 3FLIA 3T03A 5DWEA 1YINA 1G50A 3OMPA 3Q95B 2AX7A 5E1CA 2XHSA 2Q8SA 2ZL9A 3UVVA 3ZQTA 2ZNQA 3ET3A 2GPPA 3KWYA 2Q7KA 3OS8A 1YUCA 3H0AA 4OIVA 4X1GA 1UOMA 1L2JA 2JFAA 2PNUA 2ZK2A 3HQ5A 4K6IA 4LTWA 2B1ZA 5A86A 2VV1A 3L0JA 4MGAB 1K74A 2P4YA 3UU7B 4MGDA 2ZFXA 5KD9A 4OLMA 4KZMA 2ACLA 4ITFA 5DXKA 3L03A 1XOWA 3PEQA 3G8IA 4IVYA 1EXAA 4XT9A 5AVLA 5FQRA 3A40X 4IWFA 5AAVB 5IXKA 1P93A 1S19A 1NUOA 1QKNA 4REFA 2R40A 5IAWA 2J14A 2GIUA 1E3KA 1PZLA 3FALA 4IS8A 4RAKA 1KNUA 2P1UA 3U9QA 4FN9A 3A2HA 5DSHA 3WT5A 2QTUA 3PLZA 4MG8B 4OEDA 3VJIA 5DTVA 1PQ6A 1RDTA 1UPWA 1XJ7A 2POGA 4NUFA 4M8HA 1YP0A 4WQPA 3VJSA 1I7GA 1OSVA 2XYWA 3RUTA 1HJ1A 3AURA 3DZYA 1FD0A 2NV7A 2PIOA 1H9UA 3AX8A 2YJAB 3P89A 3ADUA 3KFCA 3MNOA 4ZNUA 2BAWA 4K4JA 4MGBB 5DMFA 1NQ1A 3NSQA
chains in the Genus database with same CATH superfamily
5C4TA 1M7WA 3SZ1A 2G44A 2HB7A 4IV2A 4M8EA 1E3GA 1NQ2A 5DX3B 4R6SA 3E7CA 3GZ9A 3IMYA 2V0VA 4XLDA 5DKGA 1I38A 1RKGA 2FVJA 4G21A 4IW8A 5DXPA 4IWCA 3GN8A 3PO9A 1K74D 3OLFA 5AWJA 1XB7A 3B0TA 4IU7A 4S0TA 3WGPA 3CLDA 5E15A 1T65A 4TUZA 5E14A 2IOKA 5DI7A 5DIDA 1QKUA 5AYGA 2QZOB 1OVLA 1UPVA 2QA6A 3UP3A 2YLYA 4RWVA 3FXVA 4E4QA 3S9SA 4OH6A 2Z4BA 1FM6D 5EJVA 2W8YA 2ATHA 1XVPA 2PKLA 2HFPA 2NXXE 1T73A 3OOFA 4QE8A 3B65A 1PQCA 1GWQA 2Z4JA 3W0GA 3B3KA 5EHJA 5DV6A 4A2JA 1G5YA 2AX9A 2Q5PA 3PBAA 2I4PA 3DZYD 1UHLA 5DXBB 3KDTA 4Q0AC 3VI8A 2PIVA 3CDPA 4G1ZA 4WHGA 3RLLA 1BSXA 5CJ6A 5AZTA 3RVFA 1N46A 3L0EA 2AMBA 1R20D 3CDSA 4YNKA 5JJMB 3K8SA 3PCUA 3DT3A 1S0ZA 4OEAA 1ZDUA 4RZGA 4Y29A 5GIEA 3A9EA 3IPQA 2PIXA 4JL4A 4TV1B 5DZHA 5HJSA 3W0JA 3UUDB 4NY9A 2B23A 4XHDA 4CI4A 4WHFA 1G2NA 1M13A 4IUIA 4MG9B 5B41A 3FEJA 4J5XC 4RZFA 3D24A 4DK7A 2YLPA 1PDUA 4ONIA 5SYZA 5DKSA 5DWLA 2R6WA 4OIUA 1I7IA 4L96A 4ZJRA 5DKBA 1YYEA 2Q59A 3NOAA 5L7GA 2NXXA 2PIRA 1Y0XX 2GPUA 5APJA 1XZXX 2VV4B 3L3XA 5DZ1A 5AAUA 2PIWA 4PP6A 3VRWA 1U9EA 3UP0A 2YJDA 3B1MA 1R1KD 1T7MA 2H79A 4OKBA 4P6XA 2QA8A 1EXXA 4BCRA 5LWPA 2G5OA 3E94A 4E2JA 4JYIA 3V9VA 2I4ZA 5DIGA 2GPOA 1T7FA 3VTCA 3OMMA 3W0IA 2PIPL 4KZJA 2Q1VA 2PINA 3V9TA 2PITA 2GPVA 5E0WA 3L0LA 1NDEA 3Q95A 5DVSA 5C4UA 4B7WA 2PJLA 2H77A 3OKIA 4XAOA 2AMAA 3R8IA 3TKCA 4OC7A 4MGCA 2I0GA 3V3QA 5DMCA 1T7RA 4N5GA 4MG7B 3LMPA 3IPSA 1MZNA 2OVHA 1XNNA 3W0YA 3LBDA 4OEYA 3K22A 1IE8A 1XV9B 2VSRA 4JYHA 3D57A 5E0XA 1R5KA 4PLDA 3VRTA 4MGAA 2OZ7A 3P88A 4LNXA 3UU7A 2G0HA 1KKQA 2ZNOA 4QJRA 4ZNHA 5APKA 5G43A 4A4VA 4LNWA 5DV3A 4E4KA 5DZIA 1M2ZA 2B50A 3KMZA 3V9YA 1RK3A 1ZAFA 4OILA 5L7HA 2AX6A 4CSJA 4RE8A 2J4AA 4PF3A 1GWRA 1XLSE 3UUAB 1HG4A 3VTDA 1ZKYA 4MDDA 4G2HA 3CWDA 4IV4A 4JGVA 3WMHA 5GICA 5DVCA 2QW4A 2Q7JA 3GYTA 4Q13A 1X78A 1XIUA 2ZK0A 1XAPA 4ZNSA 3X1HA 2HASA 5KRFA 3FUGA 3OSIA 1FM6A 1Y0SA 3X1IA 2QGWA 1ILGA 3W0HA 1DKFB 2IOGA 5DYBA 3VRUA 4N73A 2YATA 5FQTA 4F9MA 4ZI1A 5DY8A 4OFUA 3FC6B 4UDBA 3R8AA 4J5WC 3FS1A 4S0SA 5H1EA 3X31A 3KDUA 1P8DA 2I0JA 4OJBA 2AAXA 2Q60A 2ZBSA 1LV2A 1YY4A 2QSEA 4MGBA 4OJ9A 1XPCA 3UUCA 1YOWA 3W5QA 4EMAA 3HM1A 2YHDA 5HYRA 3RLJA 5LGAA 1T63A 2FAIA 5AWKA 5DXMA 3UVVB 3B0QA 1T5ZA 4LSJA 3VT9A 5I4VA 4QL8A 5AK2A 4P6WA 1ZUCA 2HAMA 2OVMA 2HWQA 2HCDA 3L3ZA 3IPUA 5HJPA 1ZGYA 3X36A 1R20A 1MVCA 5KRMA 3DR1A 3ILZA 3R5NA 1YIMA 1XLSA 4NIEA 2ZVTA 3K6PA 2ZMIA 2ACLB 5E7VA 3ERDA 4PP5A 2R6YA 3OMQA 4PRGA 5HZCA 4XUMA 1NQ7A 1NQ0A 3HC5A 4QM0A 2ZNPA 5KYAA 5G45A 2J7XA 4HLWA 4JAZA 5DWJA 3FALB 1K4WA 4HEEX 2OCFA 5FQSA 5C4SA 2QMVA 2QABA 5G5WA 3OOKA 4DQMA 2Q1HA 4NQAB 4OZTU 2Q6JA 3ADVA 1NAVA 3OMKA 4OGHA 4OH5A 4RZEA 3O1DA 1NRLA 5KR9A 1X7BA 2P7AA 2Q3YA 4ZO1X 4UDDA 5DIEA 3P0UA 5DUHA 1R1KA 2HVCA 2AWHA 2JJ3A 2YLOA 2AX8A 3G0WA 5KCUA 5KRKA 2QPYA 4UDAA 1IE9A 5JJMA 3F7DA 3AN3A 2JF9A 3OZ0A 5KRJA 3HVLA 1N4HA 2B1VA 3WFGA 4OZTE 4TV1A 5EGVA 3R5MA 3TKMA 4N1YA 3UUDA 3V49A 5KROA 5EC9A 3W5RA 5ICKA 4ZN7A 3R2AA 4OJ4A 4MG9A 5DXBA 3OS8C 3VT6A 3HZFA 3VSOA 2AO6A 2HBHA 2GP7A 3VT8A 3KMGA 2POBA 5K13A 5KCFA 1OVLB 1X7JA 2VV4A 1A28A 1ZH7A 2ZY0A 3AZ1A 3B0WA 3CJWA 3D90A 5AZVA 1T76A 3CS4A 2P7ZA 2A3IA 1LBDA 2HB8A 3IXPD 4G2IA 5DRJA 1S0XA 3B66A 5KRLA 2ZNNA 3B67A 4CI5A 3HODA 3M7RA 1S9PA 5G44A 2QR9A 5DXQA 5AVIA 4XUHA 2Q5SA 5JI0D 1NAXA 4MG6A 3VHVA 3OAPA 2ABIA 4MG7A 3BQDA 4WVDA 3VTBA 3FURA 3GWXA 4Q50A 1ZDTA 3JZCA 1XV9A 4PPPA 1L2IA 4DK8A 3AN4A 3DCTA 5KRCA 1K7LA 2REWA 3B5RA 2VV2A 5KYJA 3A9EB 4OKXA 5KRHA 2P1VA 2VSTA 2AM9A 2PIUA 1PRGA 4J26A 4ZO1B 3ADXA 5G3JA 1KV6A 4RUJA 2PRGA 4RMCA 3P8XA 3W0CA 2XYJA 3A3ZX 4YMQA 2ZXMA 3PRGA 1FM9A 1GWXA 4IA2A 5G46A 2Q6RA 2ZLAA 3AUQA 2AA6A 2BJ4B 1Z95A 2Q59B 3F5CB 3KMRA 4OHAA 1U3RA 1XP9A 3DCUA 5AAVA 3BEJA 3OMOA 1FBYA 2ZXNA 3OLSA 2O9IA 1DKFA 4PPSA 1FCXA 3EYBA 3L1BA 3R29A 4R06A 4APUA 4POJA 4ZOMA 1G1UA 2G0GA 4RMDA 2ZKCA 1YJEA 1SQNA 1XDKB 5APHA 2AA7A 5JY3A 1OSHA 2P15A 4MG8A 3W0AA 1YMTA 4RMEA 2HARA 2HC4A 1Y9RA 4FGYA 4A4WA 4ZNVA 3OKHA 4XI3A 4YPQA 3VSPA 2OUZA 2QXMA 4OARA 2QE4A 4XTAA 5B5BA 3JZBA 2GWXA 2O4JA 3ERTA 4OKWA 3DY6A 3KBAA 4G1DA 1SKXA 3DZUD 3SP6A 1MV9A 3ZRBA 3CTBA 3ADTA 4KZIA 5KCDA 1U3QA 3OZJA 4DMAA 1RJKA 1TFCA 3ZR7A 5DUEA 2VV3A 5DXEA 4PVUA 3KYTA 3BC5A 1SR7A 3VT7A 5DX3A 5KCTA 2XKWA 3ADWA 4IVWA 3OSAA 1X7EA 3G8OA 3V4AA 3W5PA 2P7GA 3ET1A 1VJBA 2JFAB 4J5XA 5KCEA 1FM9D 3WWRA 3GD2A 5FQPA 5L11A 1XP6A 4O8FA 2VV1B 5KCWA 5DWIA 3B0RA 3E00D 4MGDB 1U3SA 2QZOA 4ITEA 3WT6A 4DM8A 1T74A 5ETHA 5GIDA 2AA5A 4ZNWA 3OSWA 2IHQA 3W5TA 4FHHA 4WLBA 1PCGA 2ZMJA 1DB1A 2ZK1A 1NHZA 1ZEOA 1XQCA 3IXPA 4ZNTA 5M96A 1QKTA 2ZK4A 4FHIA 4UDCA 3CS6A 2J7YA 4IA1A 4IW6A 3ET0A 2AA2A 1N83A 1XNXA 1OT7A 1ILHA 2GTKA 4IQRA 1T79A 2E2RA 3AZ2A 3K23A 3VHWA 5ACCA 3WFFA 5L7EA 1RKHA 5EI1A 3A78A 1GS4A 3H0AD 2QH6A 5DZ3A 2QNVA 3NSPA 2ZK3A 5DUGA 4ZN9A 3WTQA 5DV8A 5F9BA 3VN2A 2NPAA 1WM0X 3VJHA 3VT3A 3HC6A 5HJPB 5IZ0A 3WT7A 1PQ9A 3GBKA 5EITA 1NYXA 1ERRA 3QT0A 3VJTA 4QK4A 2ZMHA 2FSZA 3D6DA 5DZ0A 4R2UA 4K7AA 5DU5A 5DXGA 2OM9A 3SP9A 1T7TA 3HLVA 2R40D 3HO0A 5C4OA 1SJ0A 4G20A 3N00A 5DLRA 5GT4A 4TUZB 2Q7LA 2ZK5A 3G9EA 1EREA 2Q5GA 2PIQA 3CQVA 1YOKA 3O1EA 2F4BA 1RDTD 4PP3A 2P1TA 2Q70A 4PWLA 4RUOX 3GYUA 4IA3A 4OZRU 1XVPB 2QGTA 2YFEA 4PLEA 3FEIA 3GWSX 4NB6A 2EWPA 4J5WA 5DVVA 1S9QA 4G1YA 3OLLA 3V3EA 2V7CA 2ZXZA 4OEZA 3A2IA 3B68A 2QXSA 4L98A 3RUUA 1Z5XU 1XQ3A 2NW4A 2P54A 2YLQA 3TY0A 5HYKA 3TX7B 4WPFA 2XYXA 2O4RA 2AXAA 5KCCA 2HWRA 1UHLB 2Q7IA 5DWGA 3VT4A 3WJ5A 3AZ3A 3ADSA 4OZRE 5KRAA 5DRMA 4DOSA 3DZUA 4QE6A 2OAXA 1FCZA 1X7RA 3CS8A 1A52A 2ZLCA 5E19A 3VRVA 2ZK6A 3MNEA 3RY9A 4S14A 1Z5XE 4LBDA 2BJ4A 5DL4A 3F5CA 1XP1A 2ZASA 5DXRA 5G42A 2AB2A 3ET2A 4ZJWA 1X76A 3A2JA 5DKEA 4OKTA 4YT1A 4DORA 2LBDA 1I37A 4OFRA 1PK5A 4PXMA 2Q6SA 3UUAA 1TXIA 4FNEA 5HCVA 4J24A 3ZRAA 2AYRA 4MG5A 3E00A 3OS9A 1XDKA 4REEA 3D5FA 3VHUA 2I4JA 3MNPA 4IA7A 4EM9A 1FCYA 1Q4XA 4N8RA 5DYDA 4JYGA 1R6GA 3H52A 4S15A 3KPZA 5FQVA 3AUNA 1YA3A 2VV0A 2Q61A 3IA6A 4POHA 3WJ4A 2QA8B 4RUPA 2GL8A 1QKMA 5DK9A 3R8DA 3AFRA 5DP0A 3OGTA 4OK1A 3FC6A 4X1FA 5KRIA 3VT5A 4DM6A 4RFWA 3FLIA 3T03A 5DWEA 1YINA 1G50A 3OMPA 3Q95B 2AX7A 5E1CA 2XHSA 2Q8SA 2ZL9A 3UVVA 3ZQTA 2ZNQA 3ET3A 2GPPA 3KWYA 2Q7KA 3OS8A 1YUCA 3H0AA 4OIVA 4X1GA 1UOMA 1L2JA 2JFAA 2PNUA 2ZK2A 3HQ5A 4K6IA 4LTWA 2B1ZA 5A86A 2VV1A 3L0JA 4MGAB 1K74A 2P4YA 3UU7B 4MGDA 2ZFXA 5KD9A 4OLMA 4KZMA 2ACLA 4ITFA 5DXKA 3L03A 1XOWA 3PEQA 3G8IA 4IVYA 1EXAA 4XT9A 5AVLA 5FQRA 3A40X 4IWFA 5AAVB 5IXKA 1P93A 1S19A 1NUOA 1QKNA 4REFA 2R40A 5IAWA 2J14A 2GIUA 1E3KA 1PZLA 3FALA 4IS8A 4RAKA 1KNUA 2P1UA 3U9QA 4FN9A 3A2HA 5DSHA 3WT5A 2QTUA 3PLZA 4MG8B 4OEDA 3VJIA 5DTVA 1PQ6A 1RDTA 1UPWA 1XJ7A 2POGA 4NUFA 4M8HA 1YP0A 4WQPA 3VJSA 1I7GA 1OSVA 2XYWA 3RUTA 1HJ1A 3AURA 3DZYA 1FD0A 2NV7A 2PIOA 1H9UA 3AX8A 2YJAB 3P89A 3ADUA 3KFCA 3MNOA 4ZNUA 2BAWA 4K4JA 4MGBB 5DMFA 1NQ1A 3NSQA
chains in the Genus database with same CATH topology
5C4TA 1M7WA 3SZ1A 2G44A 2HB7A 4IV2A 4M8EA 1E3GA 1NQ2A 5DX3B 4R6SA 3E7CA 3GZ9A 3IMYA 2V0VA 4XLDA 5DKGA 1I38A 1RKGA 2FVJA 4G21A 4IW8A 5DXPA 4IWCA 3GN8A 3PO9A 1K74D 3OLFA 5AWJA 1XB7A 3B0TA 4IU7A 4S0TA 3WGPA 3CLDA 5E15A 1T65A 4TUZA 5E14A 2IOKA 5DI7A 5DIDA 1QKUA 5AYGA 2QZOB 1OVLA 1UPVA 2QA6A 3UP3A 2YLYA 4RWVA 3FXVA 4E4QA 3S9SA 4OH6A 2Z4BA 1FM6D 5EJVA 2W8YA 2ATHA 1XVPA 2PKLA 2HFPA 2NXXE 1T73A 3OOFA 4QE8A 3B65A 1PQCA 1GWQA 2Z4JA 3W0GA 3B3KA 5EHJA 5DV6A 4A2JA 1G5YA 2AX9A 2Q5PA 3PBAA 2I4PA 3DZYD 1UHLA 5DXBB 3KDTA 4Q0AC 3VI8A 2PIVA 3CDPA 4G1ZA 4WHGA 3RLLA 1BSXA 5CJ6A 5AZTA 3RVFA 1N46A 3L0EA 2AMBA 1R20D 3CDSA 4YNKA 5JJMB 3K8SA 3PCUA 3DT3A 1S0ZA 4OEAA 1ZDUA 4RZGA 4Y29A 5GIEA 3A9EA 3IPQA 2PIXA 4JL4A 4TV1B 5DZHA 5HJSA 3W0JA 3UUDB 4NY9A 2B23A 4XHDA 4CI4A 4WHFA 1G2NA 1M13A 4IUIA 4MG9B 5B41A 3FEJA 4J5XC 4RZFA 3D24A 4DK7A 2YLPA 1PDUA 4ONIA 5SYZA 5DKSA 5DWLA 2R6WA 4OIUA 1I7IA 4L96A 4ZJRA 5DKBA 1YYEA 2Q59A 3NOAA 5L7GA 2NXXA 2PIRA 1Y0XX 2GPUA 5APJA 1XZXX 2VV4B 3L3XA 5DZ1A 5AAUA 2PIWA 4PP6A 3VRWA 1U9EA 3UP0A 2YJDA 3B1MA 1R1KD 1T7MA 2H79A 4OKBA 4P6XA 2QA8A 1EXXA 4BCRA 5LWPA 2G5OA 3E94A 4E2JA 4JYIA 3V9VA 2I4ZA 5DIGA 2GPOA 1T7FA 3VTCA 3OMMA 3W0IA 2PIPL 4KZJA 2Q1VA 2PINA 3V9TA 2PITA 2GPVA 5E0WA 3L0LA 1NDEA 3Q95A 5DVSA 5C4UA 4B7WA 2PJLA 2H77A 3OKIA 4XAOA 2AMAA 3R8IA 3TKCA 4OC7A 4MGCA 2I0GA 3V3QA 5DMCA 1T7RA 4N5GA 4MG7B 3LMPA 3IPSA 1MZNA 2OVHA 1XNNA 3W0YA 3LBDA 4OEYA 3K22A 1IE8A 1XV9B 2VSRA 4JYHA 3D57A 5E0XA 1R5KA 4PLDA 3VRTA 4MGAA 2OZ7A 3P88A 4LNXA 3UU7A 2G0HA 1KKQA 2ZNOA 4QJRA 4ZNHA 5APKA 5G43A 4A4VA 4LNWA 5DV3A 4E4KA 5DZIA 1M2ZA 2B50A 3KMZA 3V9YA 1RK3A 1ZAFA 4OILA 5L7HA 2AX6A 4CSJA 4RE8A 2J4AA 4PF3A 1GWRA 1XLSE 3UUAB 1HG4A 3VTDA 1ZKYA 4MDDA 4G2HA 3CWDA 4IV4A 4JGVA 3WMHA 5GICA 5DVCA 2QW4A 2Q7JA 3GYTA 4Q13A 1X78A 1XIUA 2ZK0A 1XAPA 4ZNSA 3X1HA 2HASA 5KRFA 3FUGA 3OSIA 1FM6A 1Y0SA 3X1IA 2QGWA 1ILGA 3W0HA 1DKFB 2IOGA 5DYBA 3VRUA 4N73A 2YATA 5FQTA 4F9MA 4ZI1A 5DY8A 4OFUA 3FC6B 4UDBA 3R8AA 4J5WC 3FS1A 4S0SA 5H1EA 3X31A 3KDUA 1P8DA 2I0JA 4OJBA 2AAXA 2Q60A 2ZBSA 1LV2A 1YY4A 2QSEA 4MGBA 4OJ9A 1XPCA 3UUCA 1YOWA 3W5QA 4EMAA 3HM1A 2YHDA 5HYRA 3RLJA 5LGAA 1T63A 2FAIA 5AWKA 5DXMA 3UVVB 3B0QA 1T5ZA 4LSJA 3VT9A 5I4VA 4QL8A 5AK2A 4P6WA 1ZUCA 2HAMA 2OVMA 2HWQA 2HCDA 3L3ZA 3IPUA 5HJPA 1ZGYA 3X36A 1R20A 1MVCA 5KRMA 3DR1A 3ILZA 3R5NA 1YIMA 1XLSA 4NIEA 2ZVTA 3K6PA 2ZMIA 2ACLB 5E7VA 3ERDA 4PP5A 2R6YA 3OMQA 4PRGA 5HZCA 4XUMA 1NQ7A 1NQ0A 3HC5A 4QM0A 2ZNPA 5KYAA 5G45A 2J7XA 4HLWA 4JAZA 5DWJA 3FALB 1K4WA 4HEEX 2OCFA 5FQSA 5C4SA 2QMVA 2QABA 5G5WA 3OOKA 4DQMA 2Q1HA 4NQAB 4OZTU 2Q6JA 3ADVA 1NAVA 3OMKA 4OGHA 4OH5A 4RZEA 3O1DA 1NRLA 5KR9A 1X7BA 2P7AA 2Q3YA 4ZO1X 4UDDA 5DIEA 3P0UA 5DUHA 1R1KA 2HVCA 2AWHA 2JJ3A 2YLOA 2AX8A 3G0WA 5KCUA 5KRKA 2QPYA 4UDAA 1IE9A 5JJMA 3F7DA 3AN3A 2JF9A 3OZ0A 5KRJA 3HVLA 1N4HA 2B1VA 3WFGA 4OZTE 4TV1A 5EGVA 3R5MA 3TKMA 4N1YA 3UUDA 3V49A 5KROA 5EC9A 3W5RA 5ICKA 4ZN7A 3R2AA 4OJ4A 4MG9A 5DXBA 3OS8C 3VT6A 3HZFA 3VSOA 2AO6A 2HBHA 2GP7A 3VT8A 3KMGA 2POBA 5K13A 5KCFA 1OVLB 1X7JA 2VV4A 1A28A 1ZH7A 2ZY0A 3AZ1A 3B0WA 3CJWA 3D90A 5AZVA 1T76A 3CS4A 2P7ZA 2A3IA 1LBDA 2HB8A 3IXPD 4G2IA 5DRJA 1S0XA 3B66A 5KRLA 2ZNNA 3B67A 4CI5A 3HODA 3M7RA 1S9PA 5G44A 2QR9A 5DXQA 5AVIA 4XUHA 2Q5SA 5JI0D 1NAXA 4MG6A 3VHVA 3OAPA 2ABIA 4MG7A 3BQDA 4WVDA 3VTBA 3FURA 3GWXA 4Q50A 1ZDTA 3JZCA 1XV9A 4PPPA 1L2IA 4DK8A 3AN4A 3DCTA 5KRCA 1K7LA 2REWA 3B5RA 2VV2A 5KYJA 3A9EB 4OKXA 5KRHA 2P1VA 2VSTA 2AM9A 2PIUA 1PRGA 4J26A 4ZO1B 3ADXA 5G3JA 1KV6A 4RUJA 2PRGA 4RMCA 3P8XA 3W0CA 2XYJA 3A3ZX 4YMQA 2ZXMA 3PRGA 1FM9A 1GWXA 4IA2A 5G46A 2Q6RA 2ZLAA 3AUQA 2AA6A 2BJ4B 1Z95A 2Q59B 3F5CB 3KMRA 4OHAA 1U3RA 1XP9A 3DCUA 5AAVA 3BEJA 3OMOA 1FBYA 2ZXNA 3OLSA 2O9IA 1DKFA 4PPSA 1FCXA 3EYBA 3L1BA 3R29A 4R06A 4APUA 4POJA 4ZOMA 1G1UA 2G0GA 4RMDA 2ZKCA 1YJEA 1SQNA 1XDKB 5APHA 2AA7A 5JY3A 1OSHA 2P15A 4MG8A 3W0AA 1YMTA 4RMEA 2HARA 2HC4A 1Y9RA 4FGYA 4A4WA 4ZNVA 3OKHA 4XI3A 4YPQA 3VSPA 2OUZA 2QXMA 4OARA 2QE4A 4XTAA 5B5BA 3JZBA 2GWXA 2O4JA 3ERTA 4OKWA 3DY6A 3KBAA 4G1DA 1SKXA 3DZUD 3SP6A 1MV9A 3ZRBA 3CTBA 3ADTA 4KZIA 5KCDA 1U3QA 3OZJA 4DMAA 1RJKA 1TFCA 3ZR7A 5DUEA 2VV3A 5DXEA 4PVUA 3KYTA 3BC5A 1SR7A 3VT7A 5DX3A 5KCTA 2XKWA 3ADWA 4IVWA 3OSAA 1X7EA 3G8OA 3V4AA 3W5PA 2P7GA 3ET1A 1VJBA 2JFAB 4J5XA 5KCEA 1FM9D 3WWRA 3GD2A 5FQPA 5L11A 1XP6A 4O8FA 2VV1B 5KCWA 5DWIA 3B0RA 3E00D 4MGDB 1U3SA 2QZOA 4ITEA 3WT6A 4DM8A 1T74A 5ETHA 5GIDA 2AA5A 4ZNWA 3OSWA 2IHQA 3W5TA 4FHHA 4WLBA 1PCGA 2ZMJA 1DB1A 2ZK1A 1NHZA 1ZEOA 1XQCA 3IXPA 4ZNTA 5M96A 1QKTA 2ZK4A 4FHIA 4UDCA 3CS6A 2J7YA 4IA1A 4IW6A 3ET0A 2AA2A 1N83A 1XNXA 1OT7A 1ILHA 2GTKA 4IQRA 1T79A 2E2RA 3AZ2A 3K23A 3VHWA 5ACCA 3WFFA 5L7EA 1RKHA 5EI1A 3A78A 1GS4A 3H0AD 2QH6A 5DZ3A 2QNVA 3NSPA 2ZK3A 5DUGA 4ZN9A 3WTQA 5DV8A 5F9BA 3VN2A 2NPAA 1WM0X 3VJHA 3VT3A 3HC6A 5HJPB 5IZ0A 3WT7A 1PQ9A 3GBKA 5EITA 1NYXA 1ERRA 3QT0A 3VJTA 4QK4A 2ZMHA 2FSZA 3D6DA 5DZ0A 4R2UA 4K7AA 5DU5A 5DXGA 2OM9A 3SP9A 1T7TA 3HLVA 2R40D 3HO0A 5C4OA 1SJ0A 4G20A 3N00A 5DLRA 5GT4A 4TUZB 2Q7LA 2ZK5A 3G9EA 1EREA 2Q5GA 2PIQA 3CQVA 1YOKA 3O1EA 2F4BA 1RDTD 4PP3A 2P1TA 2Q70A 4PWLA 4RUOX 3GYUA 4IA3A 4OZRU 1XVPB 2QGTA 2YFEA 4PLEA 3FEIA 3GWSX 4NB6A 2EWPA 4J5WA 5DVVA 1S9QA 4G1YA 3OLLA 3V3EA 2V7CA 2ZXZA 4OEZA 3A2IA 3B68A 2QXSA 4L98A 3RUUA 1Z5XU 1XQ3A 2NW4A 2P54A 2YLQA 3TY0A 5HYKA 3TX7B 4WPFA 2XYXA 2O4RA 2AXAA 5KCCA 2HWRA 1UHLB 2Q7IA 5DWGA 3VT4A 3WJ5A 3AZ3A 3ADSA 4OZRE 5KRAA 5DRMA 4DOSA 3DZUA 4QE6A 2OAXA 1FCZA 1X7RA 3CS8A 1A52A 2ZLCA 5E19A 3VRVA 2ZK6A 3MNEA 3RY9A 4S14A 1Z5XE 4LBDA 2BJ4A 5DL4A 3F5CA 1XP1A 2ZASA 5DXRA 5G42A 2AB2A 3ET2A 4ZJWA 1X76A 3A2JA 5DKEA 4OKTA 4YT1A 4DORA 2LBDA 1I37A 4OFRA 1PK5A 4PXMA 2Q6SA 3UUAA 1TXIA 4FNEA 5HCVA 4J24A 3ZRAA 2AYRA 4MG5A 3E00A 3OS9A 1XDKA 4REEA 3D5FA 3VHUA 2I4JA 3MNPA 4IA7A 4EM9A 1FCYA 1Q4XA 4N8RA 5DYDA 4JYGA 1R6GA 3H52A 4S15A 3KPZA 5FQVA 3AUNA 1YA3A 2VV0A 2Q61A 3IA6A 4POHA 3WJ4A 2QA8B 4RUPA 2GL8A 1QKMA 5DK9A 3R8DA 3AFRA 5DP0A 3OGTA 4OK1A 3FC6A 4X1FA 5KRIA 3VT5A 4DM6A 4RFWA 3FLIA 3T03A 5DWEA 1YINA 1G50A 3OMPA 3Q95B 2AX7A 5E1CA 2XHSA 2Q8SA 2ZL9A 3UVVA 3ZQTA 2ZNQA 3ET3A 2GPPA 3KWYA 2Q7KA 3OS8A 1YUCA 3H0AA 4OIVA 4X1GA 1UOMA 1L2JA 2JFAA 2PNUA 2ZK2A 3HQ5A 4K6IA 4LTWA 2B1ZA 5A86A 2VV1A 3L0JA 4MGAB 1K74A 2P4YA 3UU7B 4MGDA 2ZFXA 5KD9A 4OLMA 4KZMA 2ACLA 4ITFA 5DXKA 3L03A 1XOWA 3PEQA 3G8IA 4IVYA 1EXAA 4XT9A 5AVLA 5FQRA 3A40X 4IWFA 5AAVB 5IXKA 1P93A 1S19A 1NUOA 1QKNA 4REFA 2R40A 5IAWA 2J14A 2GIUA 1E3KA 1PZLA 3FALA 4IS8A 4RAKA 1KNUA 2P1UA 3U9QA 4FN9A 3A2HA 5DSHA 3WT5A 2QTUA 3PLZA 4MG8B 4OEDA 3VJIA 5DTVA 1PQ6A 1RDTA 1UPWA 1XJ7A 2POGA 4NUFA 4M8HA 1YP0A 4WQPA 3VJSA 1I7GA 1OSVA 2XYWA 3RUTA 1HJ1A 3AURA 3DZYA 1FD0A 2NV7A 2PIOA 1H9UA 3AX8A 2YJAB 3P89A 3ADUA 3KFCA 3MNOA 4ZNUA 2BAWA 4K4JA 4MGBB 5DMFA 1NQ1A 3NSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4T A;  1M7W A;  3SZ1 A;  2G44 A;  2HB7 A;  4IV2 A;  4M8E A;  1E3G A;  1NQ2 A;  5DX3 B;  4R6S A;  3E7C A;  3GZ9 A;  3IMY A;  2V0V A;  4XLD A;  5DKG A;  1I38 A;  1RKG A;  2FVJ A;  4G21 A;  4IW8 A;  5DXP A;  4IWC A;  3GN8 A;  3PO9 A;  1K74 D;  3OLF A;  5AWJ A;  1XB7 A;  3B0T A;  4IU7 A;  4S0T A;  3WGP A;  3CLD A;  5E15 A;  1T65 A;  4TUZ A;  5E14 A;  2IOK A;  5DI7 A;  5DID A;  1QKU A;  5AYG A;  2QZO B;  1OVL A;  1UPV A;  2QA6 A;  3UP3 A;  2YLY A;  4RWV A;  3FXV A;  4E4Q A;  3S9S A;  4OH6 A;  2Z4B A;  1FM6 D;  5EJV A;  2W8Y A;  2ATH A;  1XVP A;  2PKL A;  2HFP A;  2NXX E;  1T73 A;  3OOF A;  4QE8 A;  3B65 A;  1PQC A;  1GWQ A;  2Z4J A;  3W0G A;  3B3K A;  5EHJ A;  5DV6 A;  4A2J A;  1G5Y A;  2AX9 A;  2Q5P A;  3PBA A;  2I4P A;  3DZY D;  1UHL A;  5DXB B;  3KDT A;  4Q0A C;  3VI8 A;  2PIV A;  3CDP A;  4G1Z A;  4WHG A;  3RLL A;  1BSX A;  5CJ6 A;  5AZT A;  3RVF A;  1N46 A;  3L0E A;  2AMB A;  1R20 D;  3CDS A;  4YNK A;  5JJM B;  3K8S A;  3PCU A;  3DT3 A;  1S0Z A;  4OEA A;  1ZDU A;  4RZG A;  4Y29 A;  5GIE A;  3A9E A;  3IPQ A;  2PIX A;  4JL4 A;  4TV1 B;  5DZH A;  5HJS A;  3W0J A;  3UUD B;  4NY9 A;  2B23 A;  4XHD A;  4CI4 A;  4WHF A;  1G2N A;  1M13 A;  4IUI A;  4MG9 B;  5B41 A;  3FEJ A;  4J5X C;  4RZF A;  3D24 A;  4DK7 A;  2YLP A;  1PDU A;  4ONI A;  5SYZ A;  5DKS A;  5DWL A;  2R6W A;  4OIU A;  1I7I A;  4L96 A;  4ZJR A;  5DKB A;  1YYE A;  2Q59 A;  3NOA A;  5L7G A;  2NXX A;  2PIR A;  1Y0X X;  2GPU A;  5APJ A;  1XZX X;  2VV4 B;  3L3X A;  5DZ1 A;  5AAU A;  2PIW A;  4PP6 A;  3VRW A;  1U9E A;  3UP0 A;  2YJD A;  3B1M A;  1R1K D;  1T7M A;  2H79 A;  4OKB A;  4P6X A;  2QA8 A;  1EXX A;  4BCR A;  5LWP A;  2G5O A;  3E94 A;  4E2J A;  4JYI A;  3V9V A;  2I4Z A;  5DIG A;  2GPO A;  1T7F A;  3VTC A;  3OMM A;  3W0I A;  2PIP L;  4KZJ A;  2Q1V A;  2PIN A;  3V9T A;  2PIT A;  2GPV A;  5E0W A;  3L0L A;  1NDE A;  3Q95 A;  5DVS A;  5C4U A;  4B7W A;  2PJL A;  2H77 A;  3OKI A;  4XAO A;  2AMA A;  3R8I A;  3TKC A;  4OC7 A;  4MGC A;  2I0G A;  3V3Q A;  5DMC A;  1T7R A;  4N5G A;  4MG7 B;  3LMP A;  3IPS A;  1MZN A;  2OVH A;  1XNN A;  3W0Y A;  3LBD A;  4OEY A;  3K22 A;  1IE8 A;  1XV9 B;  2VSR A;  4JYH A;  3D57 A;  5E0X A;  1R5K A;  4PLD A;  3VRT A;  4MGA A;  2OZ7 A;  3P88 A;  4LNX A;  3UU7 A;  2G0H A;  1KKQ A;  2ZNO A;  4QJR A;  4ZNH A;  5APK A;  5G43 A;  4A4V A;  4LNW A;  5DV3 A;  4E4K A;  5DZI A;  1M2Z A;  2B50 A;  3KMZ A;  3V9Y A;  1RK3 A;  1ZAF A;  4OIL A;  5L7H A;  2AX6 A;  4CSJ A;  4RE8 A;  2J4A A;  4PF3 A;  1GWR A;  1XLS E;  3UUA B;  1HG4 A;  3VTD A;  1ZKY A;  4MDD A;  4G2H A;  3CWD A;  4IV4 A;  4JGV A;  3WMH A;  5GIC A;  5DVC A;  2QW4 A;  2Q7J A;  3GYT A;  4Q13 A;  1X78 A;  1XIU A;  2ZK0 A;  1XAP A;  4ZNS A;  3X1H A;  2HAS A;  5KRF A;  3FUG A;  3OSI A;  1FM6 A;  1Y0S A;  3X1I A;  2QGW A;  1ILG A;  3W0H A;  1DKF B;  2IOG A;  5DYB A;  3VRU A;  4N73 A;  2YAT A;  5FQT A;  4F9M A;  4ZI1 A;  5DY8 A;  4OFU A;  3FC6 B;  4UDB A;  3R8A A;  4J5W C;  3FS1 A;  4S0S A;  5H1E A;  3X31 A;  3KDU A;  1P8D A;  2I0J A;  4OJB A;  2AAX A;  2Q60 A;  2ZBS A;  1LV2 A;  1YY4 A;  2QSE A;  4MGB A;  4OJ9 A;  1XPC A;  3UUC A;  1YOW A;  3W5Q A;  4EMA A;  3HM1 A;  2YHD A;  5HYR A;  3RLJ A;  5LGA A;  1T63 A;  2FAI A;  5AWK A;  5DXM A;  3UVV B;  3B0Q A;  1T5Z A;  4LSJ A;  3VT9 A;  5I4V A;  4QL8 A;  5AK2 A;  4P6W A;  1ZUC A;  2HAM A;  2OVM A;  2HWQ A;  2HCD A;  3L3Z A;  3IPU A;  5HJP A;  1ZGY A;  3X36 A;  1R20 A;  1MVC A;  5KRM A;  3DR1 A;  3ILZ A;  3R5N A;  1YIM A;  1XLS A;  4NIE A;  2ZVT A;  3K6P A;  2ZMI A;  2ACL B;  5E7V A;  3ERD A;  4PP5 A;  2R6Y A;  3OMQ A;  4PRG A;  5HZC A;  4XUM A;  1NQ7 A;  1NQ0 A;  3HC5 A;  4QM0 A;  2ZNP A;  5KYA A;  5G45 A;  2J7X A;  4HLW A;  4JAZ A;  5DWJ A;  3FAL B;  1K4W A;  4HEE X;  2OCF A;  5FQS A;  5C4S A;  2QMV A;  2QAB A;  5G5W A;  3OOK A;  4DQM A;  2Q1H A;  4NQA B;  4OZT U;  2Q6J A;  3ADV A;  1NAV A;  3OMK A;  4OGH A;  4OH5 A;  4RZE A;  3O1D A;  1NRL A;  5KR9 A;  1X7B A;  2P7A A;  2Q3Y A;  4ZO1 X;  4UDD A;  5DIE A;  3P0U A;  5DUH A;  1R1K A;  2HVC A;  2AWH A;  2JJ3 A;  2YLO A;  2AX8 A;  3G0W A;  5KCU A;  5KRK A;  2QPY A;  4UDA A;  1IE9 A;  5JJM A;  3F7D A;  3AN3 A;  2JF9 A;  3OZ0 A;  5KRJ A;  3HVL A;  1N4H A;  2B1V A;  3WFG A;  4OZT E;  4TV1 A;  5EGV A;  3R5M A;  3TKM A;  4N1Y A;  3UUD A;  3V49 A;  5KRO A;  5EC9 A;  3W5R A;  5ICK A;  4ZN7 A;  3R2A A;  4OJ4 A;  4MG9 A;  5DXB A;  3OS8 C;  3VT6 A;  3HZF A;  3VSO A;  2AO6 A;  2HBH A;  2GP7 A;  3VT8 A;  3KMG A;  2POB A;  5K13 A;  5KCF A;  1OVL B;  1X7J A;  2VV4 A;  1A28 A;  1ZH7 A;  2ZY0 A;  3AZ1 A;  3B0W A;  3CJW A;  3D90 A;  5AZV A;  1T76 A;  3CS4 A;  2P7Z A;  2A3I A;  1LBD A;  2HB8 A;  3IXP D;  4G2I A;  5DRJ A;  1S0X A;  3B66 A;  5KRL A;  2ZNN A;  3B67 A;  4CI5 A;  3HOD A;  3M7R A;  1S9P A;  5G44 A;  2QR9 A;  5DXQ A;  5AVI A;  4XUH A;  2Q5S A;  5JI0 D;  1NAX A;  4MG6 A;  3VHV A;  3OAP A;  2ABI A;  4MG7 A;  3BQD A;  4WVD A;  3VTB A;  3FUR A;  3GWX A;  4Q50 A;  1ZDT A;  3JZC A;  1XV9 A;  4PPP A;  1L2I A;  4DK8 A;  3AN4 A;  3DCT A;  5KRC A;  1K7L A;  2REW A;  3B5R A;  2VV2 A;  5KYJ A;  3A9E B;  4OKX A;  5KRH A;  2P1V A;  2VST A;  2AM9 A;  2PIU A;  1PRG A;  4J26 A;  4ZO1 B;  3ADX A;  5G3J A;  1KV6 A;  4RUJ A;  2PRG A;  4RMC A;  3P8X A;  3W0C A;  2XYJ A;  3A3Z X;  4YMQ A;  2ZXM A;  3PRG A;  1FM9 A;  1GWX A;  4IA2 A;  5G46 A;  2Q6R A;  2ZLA A;  3AUQ A;  2AA6 A;  2BJ4 B;  1Z95 A;  2Q59 B;  3F5C B;  3KMR A;  4OHA A;  1U3R A;  1XP9 A;  3DCU A;  5AAV A;  3BEJ A;  3OMO A;  1FBY A;  2ZXN A;  3OLS A;  2O9I A;  1DKF A;  4PPS A;  1FCX A;  3EYB A;  3L1B A;  3R29 A;  4R06 A;  4APU A;  4POJ A;  4ZOM A;  1G1U A;  2G0G A;  4RMD A;  2ZKC A;  1YJE A;  1SQN A;  1XDK B;  5APH A;  2AA7 A;  5JY3 A;  1OSH A;  2P15 A;  4MG8 A;  3W0A A;  1YMT A;  4RME A;  2HAR A;  2HC4 A;  1Y9R A;  4FGY A;  4A4W A;  4ZNV A;  3OKH A;  4XI3 A;  4YPQ A;  3VSP A;  2OUZ A;  2QXM A;  4OAR A;  2QE4 A;  4XTA A;  5B5B A;  3JZB A;  2GWX A;  2O4J A;  3ERT A;  4OKW A;  3DY6 A;  3KBA A;  4G1D A;  1SKX A;  3DZU D;  3SP6 A;  1MV9 A;  3ZRB A;  3CTB A;  3ADT A;  4KZI A;  5KCD A;  1U3Q A;  3OZJ A;  4DMA A;  1RJK A;  1TFC A;  3ZR7 A;  5DUE A;  2VV3 A;  5DXE A;  4PVU A;  3KYT A;  3BC5 A;  1SR7 A;  3VT7 A;  5DX3 A;  5KCT A;  2XKW A;  3ADW A;  4IVW A;  3OSA A;  1X7E A;  3G8O A;  3V4A A;  3W5P A;  2P7G A;  3ET1 A;  1VJB A;  2JFA B;  4J5X A;  5KCE A;  1FM9 D;  3WWR A;  3GD2 A;  5FQP A;  5L11 A;  1XP6 A;  4O8F A;  2VV1 B;  5KCW A;  5DWI A;  3B0R A;  3E00 D;  4MGD B;  1U3S A;  2QZO A;  4ITE A;  3WT6 A;  4DM8 A;  1T74 A;  5ETH A;  5GID A;  2AA5 A;  4ZNW A;  3OSW A;  2IHQ A;  3W5T A;  4FHH A;  4WLB A;  1PCG A;  2ZMJ A;  1DB1 A;  2ZK1 A;  1NHZ A;  1ZEO A;  1XQC A;  3IXP A;  4ZNT A;  5M96 A;  1QKT A;  2ZK4 A;  4FHI A;  4UDC A;  3CS6 A;  2J7Y A;  4IA1 A;  4IW6 A;  3ET0 A;  2AA2 A;  1N83 A;  1XNX A;  1OT7 A;  1ILH A;  2GTK A;  4IQR A;  1T79 A;  2E2R A;  3AZ2 A;  3K23 A;  3VHW A;  5ACC A;  3WFF A;  5L7E A;  1RKH A;  5EI1 A;  3A78 A;  1GS4 A;  3H0A D;  2QH6 A;  5DZ3 A;  2QNV A;  3NSP A;  2ZK3 A;  5DUG A;  4ZN9 A;  3WTQ A;  5DV8 A;  5F9B A;  3VN2 A;  2NPA A;  1WM0 X;  3VJH A;  3VT3 A;  3HC6 A;  5HJP B;  5IZ0 A;  3WT7 A;  1PQ9 A;  3GBK A;  5EIT A;  1NYX A;  1ERR A;  3QT0 A;  3VJT A;  4QK4 A;  2ZMH A;  2FSZ A;  3D6D A;  5DZ0 A;  4R2U A;  4K7A A;  5DU5 A;  5DXG A;  2OM9 A;  3SP9 A;  1T7T A;  3HLV A;  2R40 D;  3HO0 A;  5C4O A;  1SJ0 A;  4G20 A;  3N00 A;  5DLR A;  5GT4 A;  4TUZ B;  2Q7L A;  2ZK5 A;  3G9E A;  1ERE A;  2Q5G A;  2PIQ A;  3CQV A;  1YOK A;  3O1E A;  2F4B A;  1RDT D;  4PP3 A;  2P1T A;  2Q70 A;  4PWL A;  4RUO X;  3GYU A;  4IA3 A;  4OZR U;  1XVP B;  2QGT A;  2YFE A;  4PLE A;  3FEI A;  3GWS X;  4NB6 A;  2EWP A;  4J5W A;  5DVV A;  1S9Q A;  4G1Y A;  3OLL A;  3V3E A;  2V7C A;  2ZXZ A;  4OEZ A;  3A2I A;  3B68 A;  2QXS A;  4L98 A;  3RUU A;  1Z5X U;  1XQ3 A;  2NW4 A;  2P54 A;  2YLQ A;  3TY0 A;  5HYK A;  3TX7 B;  4WPF A;  2XYX A;  2O4R A;  2AXA A;  5KCC A;  2HWR A;  1UHL B;  2Q7I A;  5DWG A;  3VT4 A;  3WJ5 A;  3AZ3 A;  3ADS A;  4OZR E;  5KRA A;  5DRM A;  4DOS A;  3DZU A;  4QE6 A;  2OAX A;  1FCZ A;  1X7R A;  3CS8 A;  1A52 A;  2ZLC A;  5E19 A;  3VRV A;  2ZK6 A;  3MNE A;  3RY9 A;  4S14 A;  1Z5X E;  4LBD A;  2BJ4 A;  5DL4 A;  3F5C A;  1XP1 A;  2ZAS A;  5DXR A;  5G42 A;  2AB2 A;  3ET2 A;  4ZJW A;  1X76 A;  3A2J A;  5DKE A;  4OKT A;  4YT1 A;  4DOR A;  2LBD A;  1I37 A;  4OFR A;  1PK5 A;  4PXM A;  2Q6S A;  3UUA A;  1TXI A;  4FNE A;  5HCV A;  4J24 A;  3ZRA A;  2AYR A;  4MG5 A;  3E00 A;  3OS9 A;  1XDK A;  4REE A;  3D5F A;  3VHU A;  2I4J A;  3MNP A;  4IA7 A;  4EM9 A;  1FCY A;  1Q4X A;  4N8R A;  5DYD A;  4JYG A;  1R6G A;  3H52 A;  4S15 A;  3KPZ A;  5FQV A;  3AUN A;  1YA3 A;  2VV0 A;  2Q61 A;  3IA6 A;  4POH A;  3WJ4 A;  2QA8 B;  4RUP A;  2GL8 A;  1QKM A;  5DK9 A;  3R8D A;  3AFR A;  5DP0 A;  3OGT A;  4OK1 A;  3FC6 A;  4X1F A;  5KRI A;  3VT5 A;  4DM6 A;  4RFW A;  3FLI A;  3T03 A;  5DWE A;  1YIN A;  1G50 A;  3OMP A;  3Q95 B;  2AX7 A;  5E1C A;  2XHS A;  2Q8S A;  2ZL9 A;  3UVV A;  3ZQT A;  2ZNQ A;  3ET3 A;  2GPP A;  3KWY A;  2Q7K A;  3OS8 A;  1YUC A;  3H0A A;  4OIV A;  4X1G A;  1UOM A;  1L2J A;  2JFA A;  2PNU A;  2ZK2 A;  3HQ5 A;  4K6I A;  4LTW A;  2B1Z A;  5A86 A;  2VV1 A;  3L0J A;  4MGA B;  1K74 A;  2P4Y A;  3UU7 B;  4MGD A;  2ZFX A;  5KD9 A;  4OLM A;  4KZM A;  2ACL A;  4ITF A;  5DXK A;  3L03 A;  1XOW A;  3PEQ A;  3G8I A;  4IVY A;  1EXA A;  4XT9 A;  5AVL A;  5FQR A;  3A40 X;  4IWF A;  5AAV B;  5IXK A;  1P93 A;  1S19 A;  1NUO A;  1QKN A;  4REF A;  2R40 A;  5IAW A;  2J14 A;  2GIU A;  1E3K A;  1PZL A;  3FAL A;  4IS8 A;  4RAK A;  1KNU A;  2P1U A;  3U9Q A;  4FN9 A;  3A2H A;  5DSH A;  3WT5 A;  2QTU A;  3PLZ A;  4MG8 B;  4OED A;  3VJI A;  5DTV A;  1PQ6 A;  1RDT A;  1UPW A;  1XJ7 A;  2POG A;  4NUF A;  4M8H A;  1YP0 A;  4WQP A;  3VJS A;  1I7G A;  1OSV A;  2XYW A;  3RUT A;  1HJ1 A;  3AUR A;  3DZY A;  1FD0 A;  2NV7 A;  2PIO A;  1H9U A;  3AX8 A;  2YJA B;  3P89 A;  3ADU A;  3KFC A;  3MNO A;  4ZNU A;  2BAW A;  4K4J A;  4MGB B;  5DMF A;  1NQ1 A;  3NSQ A; 
#chains in the Genus database with same CATH topology
 5C4T A;  1M7W A;  3SZ1 A;  2G44 A;  2HB7 A;  4IV2 A;  4M8E A;  1E3G A;  1NQ2 A;  5DX3 B;  4R6S A;  3E7C A;  3GZ9 A;  3IMY A;  2V0V A;  4XLD A;  5DKG A;  1I38 A;  1RKG A;  2FVJ A;  4G21 A;  4IW8 A;  5DXP A;  4IWC A;  3GN8 A;  3PO9 A;  1K74 D;  3OLF A;  5AWJ A;  1XB7 A;  3B0T A;  4IU7 A;  4S0T A;  3WGP A;  3CLD A;  5E15 A;  1T65 A;  4TUZ A;  5E14 A;  2IOK A;  5DI7 A;  5DID A;  1QKU A;  5AYG A;  2QZO B;  1OVL A;  1UPV A;  2QA6 A;  3UP3 A;  2YLY A;  4RWV A;  3FXV A;  4E4Q A;  3S9S A;  4OH6 A;  2Z4B A;  1FM6 D;  5EJV A;  2W8Y A;  2ATH A;  1XVP A;  2PKL A;  2HFP A;  2NXX E;  1T73 A;  3OOF A;  4QE8 A;  3B65 A;  1PQC A;  1GWQ A;  2Z4J A;  3W0G A;  3B3K A;  5EHJ A;  5DV6 A;  4A2J A;  1G5Y A;  2AX9 A;  2Q5P A;  3PBA A;  2I4P A;  3DZY D;  1UHL A;  5DXB B;  3KDT A;  4Q0A C;  3VI8 A;  2PIV A;  3CDP A;  4G1Z A;  4WHG A;  3RLL A;  1BSX A;  5CJ6 A;  5AZT A;  3RVF A;  1N46 A;  3L0E A;  2AMB A;  1R20 D;  3CDS A;  4YNK A;  5JJM B;  3K8S A;  3PCU A;  3DT3 A;  1S0Z A;  4OEA A;  1ZDU A;  4RZG A;  4Y29 A;  5GIE A;  3A9E A;  3IPQ A;  2PIX A;  4JL4 A;  4TV1 B;  5DZH A;  5HJS A;  3W0J A;  3UUD B;  4NY9 A;  2B23 A;  4XHD A;  4CI4 A;  4WHF A;  1G2N A;  1M13 A;  4IUI A;  4MG9 B;  5B41 A;  3FEJ A;  4J5X C;  4RZF A;  3D24 A;  4DK7 A;  2YLP A;  1PDU A;  4ONI A;  5SYZ A;  5DKS A;  5DWL A;  2R6W A;  4OIU A;  1I7I A;  4L96 A;  4ZJR A;  5DKB A;  1YYE A;  2Q59 A;  3NOA A;  5L7G A;  2NXX A;  2PIR A;  1Y0X X;  2GPU A;  5APJ A;  1XZX X;  2VV4 B;  3L3X A;  5DZ1 A;  5AAU A;  2PIW A;  4PP6 A;  3VRW A;  1U9E A;  3UP0 A;  2YJD A;  3B1M A;  1R1K D;  1T7M A;  2H79 A;  4OKB A;  4P6X A;  2QA8 A;  1EXX A;  4BCR A;  5LWP A;  2G5O A;  3E94 A;  4E2J A;  4JYI A;  3V9V A;  2I4Z A;  5DIG A;  2GPO A;  1T7F A;  3VTC A;  3OMM A;  3W0I A;  2PIP L;  4KZJ A;  2Q1V A;  2PIN A;  3V9T A;  2PIT A;  2GPV A;  5E0W A;  3L0L A;  1NDE A;  3Q95 A;  5DVS A;  5C4U A;  4B7W A;  2PJL A;  2H77 A;  3OKI A;  4XAO A;  2AMA A;  3R8I A;  3TKC A;  4OC7 A;  4MGC A;  2I0G A;  3V3Q A;  5DMC A;  1T7R A;  4N5G A;  4MG7 B;  3LMP A;  3IPS A;  1MZN A;  2OVH A;  1XNN A;  3W0Y A;  3LBD A;  4OEY A;  3K22 A;  1IE8 A;  1XV9 B;  2VSR A;  4JYH A;  3D57 A;  5E0X A;  1R5K A;  4PLD A;  3VRT A;  4MGA A;  2OZ7 A;  3P88 A;  4LNX A;  3UU7 A;  2G0H A;  1KKQ A;  2ZNO A;  4QJR A;  4ZNH A;  5APK A;  5G43 A;  4A4V A;  4LNW A;  5DV3 A;  4E4K A;  5DZI A;  1M2Z A;  2B50 A;  3KMZ A;  3V9Y A;  1RK3 A;  1ZAF A;  4OIL A;  5L7H A;  2AX6 A;  4CSJ A;  4RE8 A;  2J4A A;  4PF3 A;  1GWR A;  1XLS E;  3UUA B;  1HG4 A;  3VTD A;  1ZKY A;  4MDD A;  4G2H A;  3CWD A;  4IV4 A;  4JGV A;  3WMH A;  5GIC A;  5DVC A;  2QW4 A;  2Q7J A;  3GYT A;  4Q13 A;  1X78 A;  1XIU A;  2ZK0 A;  1XAP A;  4ZNS A;  3X1H A;  2HAS A;  5KRF A;  3FUG A;  3OSI A;  1FM6 A;  1Y0S A;  3X1I A;  2QGW A;  1ILG A;  3W0H A;  1DKF B;  2IOG A;  5DYB A;  3VRU A;  4N73 A;  2YAT A;  5FQT A;  4F9M A;  4ZI1 A;  5DY8 A;  4OFU A;  3FC6 B;  4UDB A;  3R8A A;  4J5W C;  3FS1 A;  4S0S A;  5H1E A;  3X31 A;  3KDU A;  1P8D A;  2I0J A;  4OJB A;  2AAX A;  2Q60 A;  2ZBS A;  1LV2 A;  1YY4 A;  2QSE A;  4MGB A;  4OJ9 A;  1XPC A;  3UUC A;  1YOW A;  3W5Q A;  4EMA A;  3HM1 A;  2YHD A;  5HYR A;  3RLJ A;  5LGA A;  1T63 A;  2FAI A;  5AWK A;  5DXM A;  3UVV B;  3B0Q A;  1T5Z A;  4LSJ A;  3VT9 A;  5I4V A;  4QL8 A;  5AK2 A;  4P6W A;  1ZUC A;  2HAM A;  2OVM A;  2HWQ A;  2HCD A;  3L3Z A;  3IPU A;  5HJP A;  1ZGY A;  3X36 A;  1R20 A;  1MVC A;  5KRM A;  3DR1 A;  3ILZ A;  3R5N A;  1YIM A;  1XLS A;  4NIE A;  2ZVT A;  3K6P A;  2ZMI A;  2ACL B;  5E7V A;  3ERD A;  4PP5 A;  2R6Y A;  3OMQ A;  4PRG A;  5HZC A;  4XUM A;  1NQ7 A;  1NQ0 A;  3HC5 A;  4QM0 A;  2ZNP A;  5KYA A;  5G45 A;  2J7X A;  4HLW A;  4JAZ A;  5DWJ A;  3FAL B;  1K4W A;  4HEE X;  2OCF A;  5FQS A;  5C4S A;  2QMV A;  2QAB A;  5G5W A;  3OOK A;  4DQM A;  2Q1H A;  4NQA B;  4OZT U;  2Q6J A;  3ADV A;  1NAV A;  3OMK A;  4OGH A;  4OH5 A;  4RZE A;  3O1D A;  1NRL A;  5KR9 A;  1X7B A;  2P7A A;  2Q3Y A;  4ZO1 X;  4UDD A;  5DIE A;  3P0U A;  5DUH A;  1R1K A;  2HVC A;  2AWH A;  2JJ3 A;  2YLO A;  2AX8 A;  3G0W A;  5KCU A;  5KRK A;  2QPY A;  4UDA A;  1IE9 A;  5JJM A;  3F7D A;  3AN3 A;  2JF9 A;  3OZ0 A;  5KRJ A;  3HVL A;  1N4H A;  2B1V A;  3WFG A;  4OZT E;  4TV1 A;  5EGV A;  3R5M A;  3TKM A;  4N1Y A;  3UUD A;  3V49 A;  5KRO A;  5EC9 A;  3W5R A;  5ICK A;  4ZN7 A;  3R2A A;  4OJ4 A;  4MG9 A;  5DXB A;  3OS8 C;  3VT6 A;  3HZF A;  3VSO A;  2AO6 A;  2HBH A;  2GP7 A;  3VT8 A;  3KMG A;  2POB A;  5K13 A;  5KCF A;  1OVL B;  1X7J A;  2VV4 A;  1A28 A;  1ZH7 A;  2ZY0 A;  3AZ1 A;  3B0W A;  3CJW A;  3D90 A;  5AZV A;  1T76 A;  3CS4 A;  2P7Z A;  2A3I A;  1LBD A;  2HB8 A;  3IXP D;  4G2I A;  5DRJ A;  1S0X A;  3B66 A;  5KRL A;  2ZNN A;  3B67 A;  4CI5 A;  3HOD A;  3M7R A;  1S9P A;  5G44 A;  2QR9 A;  5DXQ A;  5AVI A;  4XUH A;  2Q5S A;  5JI0 D;  1NAX A;  4MG6 A;  3VHV A;  3OAP A;  2ABI A;  4MG7 A;  3BQD A;  4WVD A;  3VTB A;  3FUR A;  3GWX A;  4Q50 A;  1ZDT A;  3JZC A;  1XV9 A;  4PPP A;  1L2I A;  4DK8 A;  3AN4 A;  3DCT A;  5KRC A;  1K7L A;  2REW A;  3B5R A;  2VV2 A;  5KYJ A;  3A9E B;  4OKX A;  5KRH A;  2P1V A;  2VST A;  2AM9 A;  2PIU A;  1PRG A;  4J26 A;  4ZO1 B;  3ADX A;  5G3J A;  1KV6 A;  4RUJ A;  2PRG A;  4RMC A;  3P8X A;  3W0C A;  2XYJ A;  3A3Z X;  4YMQ A;  2ZXM A;  3PRG A;  1FM9 A;  1GWX A;  4IA2 A;  5G46 A;  2Q6R A;  2ZLA A;  3AUQ A;  2AA6 A;  2BJ4 B;  1Z95 A;  2Q59 B;  3F5C B;  3KMR A;  4OHA A;  1U3R A;  1XP9 A;  3DCU A;  5AAV A;  3BEJ A;  3OMO A;  1FBY A;  2ZXN A;  3OLS A;  2O9I A;  1DKF A;  4PPS A;  1FCX A;  3EYB A;  3L1B A;  3R29 A;  4R06 A;  4APU A;  4POJ A;  4ZOM A;  1G1U A;  2G0G A;  4RMD A;  2ZKC A;  1YJE A;  1SQN A;  1XDK B;  5APH A;  2AA7 A;  5JY3 A;  1OSH A;  2P15 A;  4MG8 A;  3W0A A;  1YMT A;  4RME A;  2HAR A;  2HC4 A;  1Y9R A;  4FGY A;  4A4W A;  4ZNV A;  3OKH A;  4XI3 A;  4YPQ A;  3VSP A;  2OUZ A;  2QXM A;  4OAR A;  2QE4 A;  4XTA A;  5B5B A;  3JZB A;  2GWX A;  2O4J A;  3ERT A;  4OKW A;  3DY6 A;  3KBA A;  4G1D A;  1SKX A;  3DZU D;  3SP6 A;  1MV9 A;  3ZRB A;  3CTB A;  3ADT A;  4KZI A;  5KCD A;  1U3Q A;  3OZJ A;  4DMA A;  1RJK A;  1TFC A;  3ZR7 A;  5DUE A;  2VV3 A;  5DXE A;  4PVU A;  3KYT A;  3BC5 A;  1SR7 A;  3VT7 A;  5DX3 A;  5KCT A;  2XKW A;  3ADW A;  4IVW A;  3OSA A;  1X7E A;  3G8O A;  3V4A A;  3W5P A;  2P7G A;  3ET1 A;  1VJB A;  2JFA B;  4J5X A;  5KCE A;  1FM9 D;  3WWR A;  3GD2 A;  5FQP A;  5L11 A;  1XP6 A;  4O8F A;  2VV1 B;  5KCW A;  5DWI A;  3B0R A;  3E00 D;  4MGD B;  1U3S A;  2QZO A;  4ITE A;  3WT6 A;  4DM8 A;  1T74 A;  5ETH A;  5GID A;  2AA5 A;  4ZNW A;  3OSW A;  2IHQ A;  3W5T A;  4FHH A;  4WLB A;  1PCG A;  2ZMJ A;  1DB1 A;  2ZK1 A;  1NHZ A;  1ZEO A;  1XQC A;  3IXP A;  4ZNT A;  5M96 A;  1QKT A;  2ZK4 A;  4FHI A;  4UDC A;  3CS6 A;  2J7Y A;  4IA1 A;  4IW6 A;  3ET0 A;  2AA2 A;  1N83 A;  1XNX A;  1OT7 A;  1ILH A;  2GTK A;  4IQR A;  1T79 A;  2E2R A;  3AZ2 A;  3K23 A;  3VHW A;  5ACC A;  3WFF A;  5L7E A;  1RKH A;  5EI1 A;  3A78 A;  1GS4 A;  3H0A D;  2QH6 A;  5DZ3 A;  2QNV A;  3NSP A;  2ZK3 A;  5DUG A;  4ZN9 A;  3WTQ A;  5DV8 A;  5F9B A;  3VN2 A;  2NPA A;  1WM0 X;  3VJH A;  3VT3 A;  3HC6 A;  5HJP B;  5IZ0 A;  3WT7 A;  1PQ9 A;  3GBK A;  5EIT A;  1NYX A;  1ERR A;  3QT0 A;  3VJT A;  4QK4 A;  2ZMH A;  2FSZ A;  3D6D A;  5DZ0 A;  4R2U A;  4K7A A;  5DU5 A;  5DXG A;  2OM9 A;  3SP9 A;  1T7T A;  3HLV A;  2R40 D;  3HO0 A;  5C4O A;  1SJ0 A;  4G20 A;  3N00 A;  5DLR A;  5GT4 A;  4TUZ B;  2Q7L A;  2ZK5 A;  3G9E A;  1ERE A;  2Q5G A;  2PIQ A;  3CQV A;  1YOK A;  3O1E A;  2F4B A;  1RDT D;  4PP3 A;  2P1T A;  2Q70 A;  4PWL A;  4RUO X;  3GYU A;  4IA3 A;  4OZR U;  1XVP B;  2QGT A;  2YFE A;  4PLE A;  3FEI A;  3GWS X;  4NB6 A;  2EWP A;  4J5W A;  5DVV A;  1S9Q A;  4G1Y A;  3OLL A;  3V3E A;  2V7C A;  2ZXZ A;  4OEZ A;  3A2I A;  3B68 A;  2QXS A;  4L98 A;  3RUU A;  1Z5X U;  1XQ3 A;  2NW4 A;  2P54 A;  2YLQ A;  3TY0 A;  5HYK A;  3TX7 B;  4WPF A;  2XYX A;  2O4R A;  2AXA A;  5KCC A;  2HWR A;  1UHL B;  2Q7I A;  5DWG A;  3VT4 A;  3WJ5 A;  3AZ3 A;  3ADS A;  4OZR E;  5KRA A;  5DRM A;  4DOS A;  3DZU A;  4QE6 A;  2OAX A;  1FCZ A;  1X7R A;  3CS8 A;  1A52 A;  2ZLC A;  5E19 A;  3VRV A;  2ZK6 A;  3MNE A;  3RY9 A;  4S14 A;  1Z5X E;  4LBD A;  2BJ4 A;  5DL4 A;  3F5C A;  1XP1 A;  2ZAS A;  5DXR A;  5G42 A;  2AB2 A;  3ET2 A;  4ZJW A;  1X76 A;  3A2J A;  5DKE A;  4OKT A;  4YT1 A;  4DOR A;  2LBD A;  1I37 A;  4OFR A;  1PK5 A;  4PXM A;  2Q6S A;  3UUA A;  1TXI A;  4FNE A;  5HCV A;  4J24 A;  3ZRA A;  2AYR A;  4MG5 A;  3E00 A;  3OS9 A;  1XDK A;  4REE A;  3D5F A;  3VHU A;  2I4J A;  3MNP A;  4IA7 A;  4EM9 A;  1FCY A;  1Q4X A;  4N8R A;  5DYD A;  4JYG A;  1R6G A;  3H52 A;  4S15 A;  3KPZ A;  5FQV A;  3AUN A;  1YA3 A;  2VV0 A;  2Q61 A;  3IA6 A;  4POH A;  3WJ4 A;  2QA8 B;  4RUP A;  2GL8 A;  1QKM A;  5DK9 A;  3R8D A;  3AFR A;  5DP0 A;  3OGT A;  4OK1 A;  3FC6 A;  4X1F A;  5KRI A;  3VT5 A;  4DM6 A;  4RFW A;  3FLI A;  3T03 A;  5DWE A;  1YIN A;  1G50 A;  3OMP A;  3Q95 B;  2AX7 A;  5E1C A;  2XHS A;  2Q8S A;  2ZL9 A;  3UVV A;  3ZQT A;  2ZNQ A;  3ET3 A;  2GPP A;  3KWY A;  2Q7K A;  3OS8 A;  1YUC A;  3H0A A;  4OIV A;  4X1G A;  1UOM A;  1L2J A;  2JFA A;  2PNU A;  2ZK2 A;  3HQ5 A;  4K6I A;  4LTW A;  2B1Z A;  5A86 A;  2VV1 A;  3L0J A;  4MGA B;  1K74 A;  2P4Y A;  3UU7 B;  4MGD A;  2ZFX A;  5KD9 A;  4OLM A;  4KZM A;  2ACL A;  4ITF A;  5DXK A;  3L03 A;  1XOW A;  3PEQ A;  3G8I A;  4IVY A;  1EXA A;  4XT9 A;  5AVL A;  5FQR A;  3A40 X;  4IWF A;  5AAV B;  5IXK A;  1P93 A;  1S19 A;  1NUO A;  1QKN A;  4REF A;  2R40 A;  5IAW A;  2J14 A;  2GIU A;  1E3K A;  1PZL A;  3FAL A;  4IS8 A;  4RAK A;  1KNU A;  2P1U A;  3U9Q A;  4FN9 A;  3A2H A;  5DSH A;  3WT5 A;  2QTU A;  3PLZ A;  4MG8 B;  4OED A;  3VJI A;  5DTV A;  1PQ6 A;  1RDT A;  1UPW A;  1XJ7 A;  2POG A;  4NUF A;  4M8H A;  1YP0 A;  4WQP A;  3VJS A;  1I7G A;  1OSV A;  2XYW A;  3RUT A;  1HJ1 A;  3AUR A;  3DZY A;  1FD0 A;  2NV7 A;  2PIO A;  1H9U A;  3AX8 A;  2YJA B;  3P89 A;  3ADU A;  3KFC A;  3MNO A;  4ZNU A;  2BAW A;  4K4J A;  4MGB B;  5DMF A;  1NQ1 A;  3NSQ A; 
#chains in the Genus database with same CATH homology
 5C4T A;  1M7W A;  3SZ1 A;  2G44 A;  2HB7 A;  4IV2 A;  4M8E A;  1E3G A;  1NQ2 A;  5DX3 B;  4R6S A;  3E7C A;  3GZ9 A;  3IMY A;  2V0V A;  4XLD A;  5DKG A;  1I38 A;  1RKG A;  2FVJ A;  4G21 A;  4IW8 A;  5DXP A;  4IWC A;  3GN8 A;  3PO9 A;  1K74 D;  3OLF A;  5AWJ A;  1XB7 A;  3B0T A;  4IU7 A;  4S0T A;  3WGP A;  3CLD A;  5E15 A;  1T65 A;  4TUZ A;  5E14 A;  2IOK A;  5DI7 A;  5DID A;  1QKU A;  5AYG A;  2QZO B;  1OVL A;  1UPV A;  2QA6 A;  3UP3 A;  2YLY A;  4RWV A;  3FXV A;  4E4Q A;  3S9S A;  4OH6 A;  2Z4B A;  1FM6 D;  5EJV A;  2W8Y A;  2ATH A;  1XVP A;  2PKL A;  2HFP A;  2NXX E;  1T73 A;  3OOF A;  4QE8 A;  3B65 A;  1PQC A;  1GWQ A;  2Z4J A;  3W0G A;  3B3K A;  5EHJ A;  5DV6 A;  4A2J A;  1G5Y A;  2AX9 A;  2Q5P A;  3PBA A;  2I4P A;  3DZY D;  1UHL A;  5DXB B;  3KDT A;  4Q0A C;  3VI8 A;  2PIV A;  3CDP A;  4G1Z A;  4WHG A;  3RLL A;  1BSX A;  5CJ6 A;  5AZT A;  3RVF A;  1N46 A;  3L0E A;  2AMB A;  1R20 D;  3CDS A;  4YNK A;  5JJM B;  3K8S A;  3PCU A;  3DT3 A;  1S0Z A;  4OEA A;  1ZDU A;  4RZG A;  4Y29 A;  5GIE A;  3A9E A;  3IPQ A;  2PIX A;  4JL4 A;  4TV1 B;  5DZH A;  5HJS A;  3W0J A;  3UUD B;  4NY9 A;  2B23 A;  4XHD A;  4CI4 A;  4WHF A;  1G2N A;  1M13 A;  4IUI A;  4MG9 B;  5B41 A;  3FEJ A;  4J5X C;  4RZF A;  3D24 A;  4DK7 A;  2YLP A;  1PDU A;  4ONI A;  5SYZ A;  5DKS A;  5DWL A;  2R6W A;  4OIU A;  1I7I A;  4L96 A;  4ZJR A;  5DKB A;  1YYE A;  2Q59 A;  3NOA A;  5L7G A;  2NXX A;  2PIR A;  1Y0X X;  2GPU A;  5APJ A;  1XZX X;  2VV4 B;  3L3X A;  5DZ1 A;  5AAU A;  2PIW A;  4PP6 A;  3VRW A;  1U9E A;  3UP0 A;  2YJD A;  3B1M A;  1R1K D;  1T7M A;  2H79 A;  4OKB A;  4P6X A;  2QA8 A;  1EXX A;  4BCR A;  5LWP A;  2G5O A;  3E94 A;  4E2J A;  4JYI A;  3V9V A;  2I4Z A;  5DIG A;  2GPO A;  1T7F A;  3VTC A;  3OMM A;  3W0I A;  2PIP L;  4KZJ A;  2Q1V A;  2PIN A;  3V9T A;  2PIT A;  2GPV A;  5E0W A;  3L0L A;  1NDE A;  3Q95 A;  5DVS A;  5C4U A;  4B7W A;  2PJL A;  2H77 A;  3OKI A;  4XAO A;  2AMA A;  3R8I A;  3TKC A;  4OC7 A;  4MGC A;  2I0G A;  3V3Q A;  5DMC A;  1T7R A;  4N5G A;  4MG7 B;  3LMP A;  3IPS A;  1MZN A;  2OVH A;  1XNN A;  3W0Y A;  3LBD A;  4OEY A;  3K22 A;  1IE8 A;  1XV9 B;  2VSR A;  4JYH A;  3D57 A;  5E0X A;  1R5K A;  4PLD A;  3VRT A;  4MGA A;  2OZ7 A;  3P88 A;  4LNX A;  3UU7 A;  2G0H A;  1KKQ A;  2ZNO A;  4QJR A;  4ZNH A;  5APK A;  5G43 A;  4A4V A;  4LNW A;  5DV3 A;  4E4K A;  5DZI A;  1M2Z A;  2B50 A;  3KMZ A;  3V9Y A;  1RK3 A;  1ZAF A;  4OIL A;  5L7H A;  2AX6 A;  4CSJ A;  4RE8 A;  2J4A A;  4PF3 A;  1GWR A;  1XLS E;  3UUA B;  1HG4 A;  3VTD A;  1ZKY A;  4MDD A;  4G2H A;  3CWD A;  4IV4 A;  4JGV A;  3WMH A;  5GIC A;  5DVC A;  2QW4 A;  2Q7J A;  3GYT A;  4Q13 A;  1X78 A;  1XIU A;  2ZK0 A;  1XAP A;  4ZNS A;  3X1H A;  2HAS A;  5KRF A;  3FUG A;  3OSI A;  1FM6 A;  1Y0S A;  3X1I A;  2QGW A;  1ILG A;  3W0H A;  1DKF B;  2IOG A;  5DYB A;  3VRU A;  4N73 A;  2YAT A;  5FQT A;  4F9M A;  4ZI1 A;  5DY8 A;  4OFU A;  3FC6 B;  4UDB A;  3R8A A;  4J5W C;  3FS1 A;  4S0S A;  5H1E A;  3X31 A;  3KDU A;  1P8D A;  2I0J A;  4OJB A;  2AAX A;  2Q60 A;  2ZBS A;  1LV2 A;  1YY4 A;  2QSE A;  4MGB A;  4OJ9 A;  1XPC A;  3UUC A;  1YOW A;  3W5Q A;  4EMA A;  3HM1 A;  2YHD A;  5HYR A;  3RLJ A;  5LGA A;  1T63 A;  2FAI A;  5AWK A;  5DXM A;  3UVV B;  3B0Q A;  1T5Z A;  4LSJ A;  3VT9 A;  5I4V A;  4QL8 A;  5AK2 A;  4P6W A;  1ZUC A;  2HAM A;  2OVM A;  2HWQ A;  2HCD A;  3L3Z A;  3IPU A;  5HJP A;  1ZGY A;  3X36 A;  1R20 A;  1MVC A;  5KRM A;  3DR1 A;  3ILZ A;  3R5N A;  1YIM A;  1XLS A;  4NIE A;  2ZVT A;  3K6P A;  2ZMI A;  2ACL B;  5E7V A;  3ERD A;  4PP5 A;  2R6Y A;  3OMQ A;  4PRG A;  5HZC A;  4XUM A;  1NQ7 A;  1NQ0 A;  3HC5 A;  4QM0 A;  2ZNP A;  5KYA A;  5G45 A;  2J7X A;  4HLW A;  4JAZ A;  5DWJ A;  3FAL B;  1K4W A;  4HEE X;  2OCF A;  5FQS A;  5C4S A;  2QMV A;  2QAB A;  5G5W A;  3OOK A;  4DQM A;  2Q1H A;  4NQA B;  4OZT U;  2Q6J A;  3ADV A;  1NAV A;  3OMK A;  4OGH A;  4OH5 A;  4RZE A;  3O1D A;  1NRL A;  5KR9 A;  1X7B A;  2P7A A;  2Q3Y A;  4ZO1 X;  4UDD A;  5DIE A;  3P0U A;  5DUH A;  1R1K A;  2HVC A;  2AWH A;  2JJ3 A;  2YLO A;  2AX8 A;  3G0W A;  5KCU A;  5KRK A;  2QPY A;  4UDA A;  1IE9 A;  5JJM A;  3F7D A;  3AN3 A;  2JF9 A;  3OZ0 A;  5KRJ A;  3HVL A;  1N4H A;  2B1V A;  3WFG A;  4OZT E;  4TV1 A;  5EGV A;  3R5M A;  3TKM A;  4N1Y A;  3UUD A;  3V49 A;  5KRO A;  5EC9 A;  3W5R A;  5ICK A;  4ZN7 A;  3R2A A;  4OJ4 A;  4MG9 A;  5DXB A;  3OS8 C;  3VT6 A;  3HZF A;  3VSO A;  2AO6 A;  2HBH A;  2GP7 A;  3VT8 A;  3KMG A;  2POB A;  5K13 A;  5KCF A;  1OVL B;  1X7J A;  2VV4 A;  1A28 A;  1ZH7 A;  2ZY0 A;  3AZ1 A;  3B0W A;  3CJW A;  3D90 A;  5AZV A;  1T76 A;  3CS4 A;  2P7Z A;  2A3I A;  1LBD A;  2HB8 A;  3IXP D;  4G2I A;  5DRJ A;  1S0X A;  3B66 A;  5KRL A;  2ZNN A;  3B67 A;  4CI5 A;  3HOD A;  3M7R A;  1S9P A;  5G44 A;  2QR9 A;  5DXQ A;  5AVI A;  4XUH A;  2Q5S A;  5JI0 D;  1NAX A;  4MG6 A;  3VHV A;  3OAP A;  2ABI A;  4MG7 A;  3BQD A;  4WVD A;  3VTB A;  3FUR A;  3GWX A;  4Q50 A;  1ZDT A;  3JZC A;  1XV9 A;  4PPP A;  1L2I A;  4DK8 A;  3AN4 A;  3DCT A;  5KRC A;  1K7L A;  2REW A;  3B5R A;  2VV2 A;  5KYJ A;  3A9E B;  4OKX A;  5KRH A;  2P1V A;  2VST A;  2AM9 A;  2PIU A;  1PRG A;  4J26 A;  4ZO1 B;  3ADX A;  5G3J A;  1KV6 A;  4RUJ A;  2PRG A;  4RMC A;  3P8X A;  3W0C A;  2XYJ A;  3A3Z X;  4YMQ A;  2ZXM A;  3PRG A;  1FM9 A;  1GWX A;  4IA2 A;  5G46 A;  2Q6R A;  2ZLA A;  3AUQ A;  2AA6 A;  2BJ4 B;  1Z95 A;  2Q59 B;  3F5C B;  3KMR A;  4OHA A;  1U3R A;  1XP9 A;  3DCU A;  5AAV A;  3BEJ A;  3OMO A;  1FBY A;  2ZXN A;  3OLS A;  2O9I A;  1DKF A;  4PPS A;  1FCX A;  3EYB A;  3L1B A;  3R29 A;  4R06 A;  4APU A;  4POJ A;  4ZOM A;  1G1U A;  2G0G A;  4RMD A;  2ZKC A;  1YJE A;  1SQN A;  1XDK B;  5APH A;  2AA7 A;  5JY3 A;  1OSH A;  2P15 A;  4MG8 A;  3W0A A;  1YMT A;  4RME A;  2HAR A;  2HC4 A;  1Y9R A;  4FGY A;  4A4W A;  4ZNV A;  3OKH A;  4XI3 A;  4YPQ A;  3VSP A;  2OUZ A;  2QXM A;  4OAR A;  2QE4 A;  4XTA A;  5B5B A;  3JZB A;  2GWX A;  2O4J A;  3ERT A;  4OKW A;  3DY6 A;  3KBA A;  4G1D A;  1SKX A;  3DZU D;  3SP6 A;  1MV9 A;  3ZRB A;  3CTB A;  3ADT A;  4KZI A;  5KCD A;  1U3Q A;  3OZJ A;  4DMA A;  1RJK A;  1TFC A;  3ZR7 A;  5DUE A;  2VV3 A;  5DXE A;  4PVU A;  3KYT A;  3BC5 A;  1SR7 A;  3VT7 A;  5DX3 A;  5KCT A;  2XKW A;  3ADW A;  4IVW A;  3OSA A;  1X7E A;  3G8O A;  3V4A A;  3W5P A;  2P7G A;  3ET1 A;  1VJB A;  2JFA B;  4J5X A;  5KCE A;  1FM9 D;  3WWR A;  3GD2 A;  5FQP A;  5L11 A;  1XP6 A;  4O8F A;  2VV1 B;  5KCW A;  5DWI A;  3B0R A;  3E00 D;  4MGD B;  1U3S A;  2QZO A;  4ITE A;  3WT6 A;  4DM8 A;  1T74 A;  5ETH A;  5GID A;  2AA5 A;  4ZNW A;  3OSW A;  2IHQ A;  3W5T A;  4FHH A;  4WLB A;  1PCG A;  2ZMJ A;  1DB1 A;  2ZK1 A;  1NHZ A;  1ZEO A;  1XQC A;  3IXP A;  4ZNT A;  5M96 A;  1QKT A;  2ZK4 A;  4FHI A;  4UDC A;  3CS6 A;  2J7Y A;  4IA1 A;  4IW6 A;  3ET0 A;  2AA2 A;  1N83 A;  1XNX A;  1OT7 A;  1ILH A;  2GTK A;  4IQR A;  1T79 A;  2E2R A;  3AZ2 A;  3K23 A;  3VHW A;  5ACC A;  3WFF A;  5L7E A;  1RKH A;  5EI1 A;  3A78 A;  1GS4 A;  3H0A D;  2QH6 A;  5DZ3 A;  2QNV A;  3NSP A;  2ZK3 A;  5DUG A;  4ZN9 A;  3WTQ A;  5DV8 A;  5F9B A;  3VN2 A;  2NPA A;  1WM0 X;  3VJH A;  3VT3 A;  3HC6 A;  5HJP B;  5IZ0 A;  3WT7 A;  1PQ9 A;  3GBK A;  5EIT A;  1NYX A;  1ERR A;  3QT0 A;  3VJT A;  4QK4 A;  2ZMH A;  2FSZ A;  3D6D A;  5DZ0 A;  4R2U A;  4K7A A;  5DU5 A;  5DXG A;  2OM9 A;  3SP9 A;  1T7T A;  3HLV A;  2R40 D;  3HO0 A;  5C4O A;  1SJ0 A;  4G20 A;  3N00 A;  5DLR A;  5GT4 A;  4TUZ B;  2Q7L A;  2ZK5 A;  3G9E A;  1ERE A;  2Q5G A;  2PIQ A;  3CQV A;  1YOK A;  3O1E A;  2F4B A;  1RDT D;  4PP3 A;  2P1T A;  2Q70 A;  4PWL A;  4RUO X;  3GYU A;  4IA3 A;  4OZR U;  1XVP B;  2QGT A;  2YFE A;  4PLE A;  3FEI A;  3GWS X;  4NB6 A;  2EWP A;  4J5W A;  5DVV A;  1S9Q A;  4G1Y A;  3OLL A;  3V3E A;  2V7C A;  2ZXZ A;  4OEZ A;  3A2I A;  3B68 A;  2QXS A;  4L98 A;  3RUU A;  1Z5X U;  1XQ3 A;  2NW4 A;  2P54 A;  2YLQ A;  3TY0 A;  5HYK A;  3TX7 B;  4WPF A;  2XYX A;  2O4R A;  2AXA A;  5KCC A;  2HWR A;  1UHL B;  2Q7I A;  5DWG A;  3VT4 A;  3WJ5 A;  3AZ3 A;  3ADS A;  4OZR E;  5KRA A;  5DRM A;  4DOS A;  3DZU A;  4QE6 A;  2OAX A;  1FCZ A;  1X7R A;  3CS8 A;  1A52 A;  2ZLC A;  5E19 A;  3VRV A;  2ZK6 A;  3MNE A;  3RY9 A;  4S14 A;  1Z5X E;  4LBD A;  2BJ4 A;  5DL4 A;  3F5C A;  1XP1 A;  2ZAS A;  5DXR A;  5G42 A;  2AB2 A;  3ET2 A;  4ZJW A;  1X76 A;  3A2J A;  5DKE A;  4OKT A;  4YT1 A;  4DOR A;  2LBD A;  1I37 A;  4OFR A;  1PK5 A;  4PXM A;  2Q6S A;  3UUA A;  1TXI A;  4FNE A;  5HCV A;  4J24 A;  3ZRA A;  2AYR A;  4MG5 A;  3E00 A;  3OS9 A;  1XDK A;  4REE A;  3D5F A;  3VHU A;  2I4J A;  3MNP A;  4IA7 A;  4EM9 A;  1FCY A;  1Q4X A;  4N8R A;  5DYD A;  4JYG A;  1R6G A;  3H52 A;  4S15 A;  3KPZ A;  5FQV A;  3AUN A;  1YA3 A;  2VV0 A;  2Q61 A;  3IA6 A;  4POH A;  3WJ4 A;  2QA8 B;  4RUP A;  2GL8 A;  1QKM A;  5DK9 A;  3R8D A;  3AFR A;  5DP0 A;  3OGT A;  4OK1 A;  3FC6 A;  4X1F A;  5KRI A;  3VT5 A;  4DM6 A;  4RFW A;  3FLI A;  3T03 A;  5DWE A;  1YIN A;  1G50 A;  3OMP A;  3Q95 B;  2AX7 A;  5E1C A;  2XHS A;  2Q8S A;  2ZL9 A;  3UVV A;  3ZQT A;  2ZNQ A;  3ET3 A;  2GPP A;  3KWY A;  2Q7K A;  3OS8 A;  1YUC A;  3H0A A;  4OIV A;  4X1G A;  1UOM A;  1L2J A;  2JFA A;  2PNU A;  2ZK2 A;  3HQ5 A;  4K6I A;  4LTW A;  2B1Z A;  5A86 A;  2VV1 A;  3L0J A;  4MGA B;  1K74 A;  2P4Y A;  3UU7 B;  4MGD A;  2ZFX A;  5KD9 A;  4OLM A;  4KZM A;  2ACL A;  4ITF A;  5DXK A;  3L03 A;  1XOW A;  3PEQ A;  3G8I A;  4IVY A;  1EXA A;  4XT9 A;  5AVL A;  5FQR A;  3A40 X;  4IWF A;  5AAV B;  5IXK A;  1P93 A;  1S19 A;  1NUO A;  1QKN A;  4REF A;  2R40 A;  5IAW A;  2J14 A;  2GIU A;  1E3K A;  1PZL A;  3FAL A;  4IS8 A;  4RAK A;  1KNU A;  2P1U A;  3U9Q A;  4FN9 A;  3A2H A;  5DSH A;  3WT5 A;  2QTU A;  3PLZ A;  4MG8 B;  4OED A;  3VJI A;  5DTV A;  1PQ6 A;  1RDT A;  1UPW A;  1XJ7 A;  2POG A;  4NUF A;  4M8H A;  1YP0 A;  4WQP A;  3VJS A;  1I7G A;  1OSV A;  2XYW A;  3RUT A;  1HJ1 A;  3AUR A;  3DZY A;  1FD0 A;  2NV7 A;  2PIO A;  1H9U A;  3AX8 A;  2YJA B;  3P89 A;  3ADU A;  3KFC A;  3MNO A;  4ZNU A;  2BAW A;  4K4J A;  4MGB B;  5DMF A;  1NQ1 A;  3NSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...