4Q0AC

Vitamin d receptor complex with lithocholic acid
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
299
structure length
239
Chain Sequence
MLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVRRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the molecular mechanism of vitamin d receptor activation by lithocholic Acid involving a new mode of ligand recognition.
pubmed doi rcsb
molecule keywords Vitamin D3 receptor A
molecule tags Gene regulation
source organism Danio rerio
total genus 95
structure length 239
sequence length 299
ec nomenclature
pdb deposition date 2014-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4q0aC00
5DXBA 2ZLCA 3FLIA 3G8IA 1N46A 3ERDA 1NQ1A 2AX9A 3ADWA 3W5QA 2ZL9A 5C4TA 1SKXA 5DZ3A 5DZ0A 4UDDA 2YHDA 2Q60A 5ETHA 2O9IA 2P1TA 4UDAA 1S0XA 2J4AA 4PXMA 4A2JA 1NUOA 2ZASA 2Q6SA 5DLRA 3D57A 5KRMA 4OFUA 4LNWA 4IWCA 1T76A 2VV2A 3UP0A 1EXAA 3CWDA 5ACCA 5DX3A 5DTVA 4ZO1X 2Q5PA 2QA6A 3FXVA 3VRWA 3X1IA 3VJIA 5HCVA 5AAVB 2GPVA 4DMAA 3VTDA 3PO9A 4OJBA 5G46A 3OGTA 1FM6D 3DT3A 4B7WA 4IA3A 2F4BA 1G1UA 1K4WA 1T7TA 3PBAA 3OS8C 4OZRE 5FQVA 1Q4XA 4OEDA 1YYEA 3GYUA 1TXIA 4FHIA 5DXMA 1GWXA 5DY8A 1ERRA 2G44A 3ET1A 4JAZA 4QM0A 2QA8B 3CDSA 2POGA 3VI8A 3OOKA 2YLQA 5DP0A 1XP1A 3ET2A 3KDUA 4ZNVA 2Q8SA 4PPPA 1XDKA 3HVLA 3E00A 1UOMA 3B65A 2AB2A 4OGHA 5L7HA 4RWVA 3P0UA 2XYXA 2QNVA 2GPPA 5AAVA 4J5XC 4OHAA 5HJPB 3DZUA 3P8XA 3K6PA 4DM6A 5AK2A 1T7FA 2Q1VA 3VSOA 5APJA 1MVCA 2ZNOA 3H52A 4MG7A 4MG9B 1N4HA 4E2JA 5KR9A 3ZRBA 5E1CA 3UU7A 3E00D 2P1UA 3NOAA 5IZ0A 3ZR7A 4PLEA 4PP6A 1LBDA 4MG8B 5KCUA 4PLDA 5DWGA 2ZK2A 3R8IA 3CQVA 5KD9A 4OIUA 4ZO1B 2Q5SA 4CSJA 3BEJA 1FCXA 4E4KA 4K7AA 4DK7A 3D5FA 5CJ6A 5DKBA 1GWRA 2G0GA 4KZJA 4S0TA 1NAXA 1BSXA 1MZNA 2Q70A 5DZHA 3VJTA 3KBAA 4OH6A 5DRMA 5G45A 3ET3A 5DXQA 3W0AA 4POHA 3WJ5A 5JJMB 3L3XA 4PPSA 3VHUA 5DXRA 3ZRAA 5FQPA 3OMMA 5HJSA 2ABIA 1ZEOA 3G8OA 4LNXA 2XYJA 3GD2A 1HJ1A 5E0XA 3AZ3A 2ZXMA 2VSRA 3HC5A 5FQSA 5DVCA 2J7YA 4OARA 4UDBA 2ZMJA 3HZFA 1KNUA 2PIUA 2NV7A 1DKFA 2PIQA 4FN9A 3V3QA 2Z4BA 1U3QA 4IV4A 5F9BA 3W5PA 3VT6A 2HWRA 1U9EA 3B66A 2VV4B 4UDCA 3UUAA 5HZCA 3GWSX 3RVFA 4J5WC 1X7EA 1Y0XX 2Q7LA 3V9VA 1T73A 5IXKA 1ZGYA 4RFWA 2HBHA 5DUHA 4Q13A 1ILGA 3OMOA 1T7RA 1G50A 2OCFA 2ZK1A 3GZ9A 2B1ZA 3SZ1A 3HO0A 3UP3A 2NW4A 2YJAB 4MG6A 4TUZB 5DWEA 4S14A 2V7CA 3VHVA 5E14A 4IS8A 3KMZA 3RLLA 3FALB 4N5GA 1YOKA 4N73A 1PK5A 3VN2A 1RJKA 5KYJA 5C4OA 1UPWA 5ICKA 2HARA 5B41A 5DIGA 4OEZA 3OLFA 4G20A 1YINA 1X76A 3A78A 3FURA 4WHGA 3VSPA 3V3EA 1T65A 3NSPA 4ZNHA 1OSVA 3LBDA 2AMBA 1XOWA 3W5TA 3PLZA 5KRKA 4IQRA 3V9YA 1A28A 4WPFA 4PRGA 3WFGA 3OS8A 1ZDUA 2PIRA 2VV0A 2R40D 2P4YA 3OLSA 2PKLA 4JYIA 4KZIA 1I7IA 4OEAA 4MGCA 3B5RA 4PVUA 5KRCA 4ZOMA 3KMRA 4G1DA 3IA6A 5A86A 5G3JA 3VT5A 5AVIA 2B23A 1IE8A 2GP7A 4RUPA 4WVDA 3E7CA 4J5XA 2ZVTA 1RDTA 1ZH7A 2A3IA 3CS6A 3IXPA 4IVYA 3ZQTA 3CS8A 3SP9A 1S9QA 1PQCA 4HEEX 4X1FA 5DMCA 1K74A 1A52A 4OIVA 1QKMA 5JY3A 2POBA 1Y0SA 3B68A 4WQPA 2YFEA 2ZK3A 3B0QA 1R20A 5DUEA 5EGVA 5FQTA 1YUCA 2Z4JA 1G2NA 4RUJA 1MV9A 3IXPD 4G1YA 5FQRA 3F5CA 1X7RA 4MGAB 5DWJA 3RUUA 2NXXE 3FC6A 1P8DA 4MGBA 4OH5A 4Q50A 1DB1A 2XHSA 4ZNTA 1G5YA 3OSAA 3VT7A 1EXXA 3E94A 3BC5A 4IV2A 3AFRA 1R1KA 2OUZA 3ILZA 2PIOA 2HB7A 2VSTA 2I4JA 2QXMA 3IPSA 2BAWA 2AMAA 3K8SA 4NQAB 4HLWA 3B67A 1XQ3A 1R6GA 3AN3A 3AURA 5DZIA 3TKMA 2ACLB 1TFCA 1YY4A 2Q7IA 3L03A 3KFCA 4OZRU 2QXSA 2FAIA 1R5KA 1T79A 4WLBA 3W0YA 2NPAA 2HC4A 1PCGA 2IHQA 3B0WA 2AAXA 2PNUA 1NQ0A 3HODA 3MNPA 1RKGA 5GT4A 5C4UA 2HVCA 4J5WA 2Q59B 3DZYA 3WJ4A 2QGWA 1WM0X 4PP5A 4DK8A 2IOGA 3D6DA 2PIXA 4IU7A 5G42A 4OEYA 2ZNNA 2AYRA 1XLSE 1XV9B 2OVMA 3A2JA 5KRFA 1XJ7A 2YLOA 4IA7A 1M7WA 4OZTE 5KCDA 2ACLA 4TV1B 1UPVA 3IMYA 5G43A 1Z5XE 1YOWA 4K4JA 2YATA 2Q6RA 4J26A 2QA8A 2ZMIA 3DZUD 5KCTA 2QR9A 3PCUA 1VJBA 4RMEA 4YPQA 1UHLB 4ZN7A 2GPOA 1NHZA 5SYZA 3FEJA 3R29A 4KZMA 3CDPA 4M8HA 1PDUA 1T63A 2Q59A 3KYTA 2ZFXA 5DVVA 2GTKA 2QZOB 3GN8A 4Q0AC 3ERTA 5HJPA 4MGDB 4ZNUA 4OKXA 1X7BA 3OLLA 1XV9A 5B5BA 4EM9A 3CJWA 4MG9A 2B1VA 3VT9A 4IUIA 1ILHA 1U3SA 1ZKYA 3V49A 4REFA 4MG8A 4G21A 1L2JA 4PWLA 1OVLB 1X7JA 2OAXA 1XNXA 3UUDB 5DKSA 2ZLAA 3X31A 3CTBA 4G1ZA 4L96A 5DKGA 1U3RA 2NXXA 2Q1HA 1SJ0A 2P1VA 2XYWA 4YT1A 4BCRA 5AZTA 3VTCA 1I7GA 2AA6A 2AWHA 2PIWA 5APKA 2GWXA 2QZOA 3B0RA 2ZXZA 1EREA 4MGDA 4R06A 1K7LA 1YJEA 2AM9A 5EJVA 2GL8A 5JJMA 2AO6A 2VV1B 1IE9A 3FEIA 5AVLA 4L98A 3HM1A 4IVWA 4R6SA 5DXPA 1XVPB 3PRGA 2JFAB 1PQ6A 2O4JA 5DIDA 3WT7A 3VT8A 1OVLA 2Q6JA 3VTBA 3OAPA 2VV4A 2ZK4A 2OZ7A 2PIVA 1NYXA 3X36A 4O8FA 2ZNPA 4P6XA 4DQMA 5DU5A 3UVVB 5IAWA 2Q7KA 1XP6A 2ZBSA 3U9QA 2ZK5A 2ZK6A 2ZNQA 1H9UA 5DIEA 2J7XA 3T03A 1YIMA 4ZN9A 1NAVA 4QE8A 2ZKCA 1XLSA 3DCTA 5DV8A 4TUZA 3F7DA 3RY9A 1XIUA 3WT5A 5L7GA 4WHFA 3FALA 3TY0A 2W8YA 1FCZA 2LBDA 4NY9A 4QK4A 1XAPA 5M96A 1S19A 5E15A 5I4VA 1ZAFA 1XQCA 3AN4A 4PP3A 1NDEA 4ZJWA 2PITA 5DK9A 3VT3A 4RZFA 5DYBA 3CS4A 2QABA 4IWFA 3P89A 3R5NA 4RMCA 3KDTA 3X1HA 2P7AA 3WGPA 2I4ZA 4XI3A 3P88A 4NUFA 4DORA 3W0HA 2JF9A 1KV6A 5E19A 1XPCA 3DCUA 3KPZA 5LWPA 3TX7B 1NQ2A 1NQ7A 3KWYA 4NB6A 4PF3A 5KRAA 1OSHA 1SR7A 4J24A 5KROA 1GWQA 4NIEA 5E0WA 1M13A 2IOKA 3B0TA 2HASA 3OSIA 1KKQA 2EWPA 4S15A 4CI4A 2PIPL 1RDTD 2VV3A 3AZ2A 5K13A 1YA3A 3K22A 4XTAA 4JGVA 1K74D 4N8RA 4REEA 3CLDA 3G9EA 5DVSA 1I37A 1N83A 2I4PA 2XKWA 3W0JA 1S9PA 2ZY0A 1R20D 4OLMA 3EYBA 3ADSA 2FSZA 4APUA 1QKNA 5C4SA 5DWLA 3W0GA 3W0CA 1HG4A 3JZCA 3O1DA 4ONIA 4JYGA 3OZJA 1S0ZA 3FUGA 3L1BA 3OS9A 4RZGA 4ZI1A 3L0EA 2PINA 1R1KD 4XT9A 5DZ1A 1T7MA 2HCDA 4RE8A 1FM6A 2Q3YA 2QPYA 3PEQA 4MGAA 3B1MA 3W0IA 1XDKB 3Q95B 3NSQA 2PRGA 4JL4A 3VJHA 5KRJA 5GIDA 5DV6A 5DKEA 4QL8A 2QSEA 2AX6A 2GPUA 5L11A 2QMVA 3OZ0A 2QE4A 2Q61A 4ITEA 2HWQA 5AWKA 2P54A 3L3ZA 5KCCA 2HB8A 4MG7B 4OC7A 4ZNSA 2Q5GA 3JZBA 3S9SA 3B3KA 5EI1A 3UU7B 5AAUA 3ET0A 3DZYD 5EC9A 2FVJA 2OM9A 2P15A 3AUNA 3ADVA 3MNEA 2E2RA 5KRLA 3UUCA 4OZTU 3GBKA 3AX8A 2YJDA 3ADXA 3TKCA 3VHWA 3A40X 1Z5XU 4QE6A 3WTQA 4OFRA 4A4VA 5KRIA 5DXGA 1Z95A 2ATHA 2PJLA 3Q95A 2ZXNA 1M2ZA 4FGYA 4CI5A 3OMQA 5DSHA 2G5OA 4YMQA 4DM8A 3OMKA 4OILA 1RK3A 1L2IA 2R6WA 3A9EB 4DOSA 1FD0A 3AZ1A 5DV3A 3A3ZX 3H0AA 4POJA 3VJSA 4TV1A 2QGTA 2GIUA 1RKHA 4R2UA 2O4RA 3GWXA 3GYTA 4X1GA 2Q7JA 2I0JA 2AA7A 1DKFB 3M7RA 3N00A 3D90A 4K6IA 1QKUA 1UHLA 4OJ4A 3MNOA 3OKIA 5DRJA 3UUAB 3H0AD 3O1EA 2P7GA 3OMPA 1E3KA 3V4AA 3QT0A 3VRTA 3RLJA 2G0HA 3R8DA 4A4WA 3G0WA 4E4QA 2AX8A 3BQDA 3AUQA 3K23A 3R5MA 4FHHA 4MDDA 4RUOX 3RUTA 1ZDTA 5DUGA 3A9EA 2ZK0A 5HYRA 3W5RA 2H79A 4XHDA 3ADUA 3R2AA 4M8EA 3R8AA 4OKTA 3D24A 4OKWA 4ZJRA 2BJ4B 5G44A 3SP6A 4OJ9A 4P6WA 4QJRA 1ZUCA 5AWJA 2B50A 5AZVA 4RAKA 5DI7A 5DYDA 3ADTA 4G2IA 5KCEA 5EHJA 3UUDA 4IW6A 4XAOA 2REWA 4S0SA 5DXEA 5L7EA 2YLYA 5LGAA 3VRVA 1XP9A 4OKBA 5E7VA 1NRLA 3OKHA 4G2HA 4JYHA 5HYKA 1OT7A 2JJ3A 3IPUA 4F9MA 4IA2A 3WMHA 4IA1A 1PZLA 5JI0D 5KRHA 1XB7A 3HQ5A 3L0LA 2OVHA 2AA5A 1E3GA 2VV1A 2YLPA 4XUHA 5KYAA 4Y29A 4XUMA 1PRGA 2BJ4A 5G5WA 1LV2A 1XVPA 2JFAA 2P7ZA 3WFFA 3L0JA 1FM9A 3FS1A 3OOFA 4LTWA 3V9TA 4OK1A 1I38A 3A2HA 1QKTA 5KCFA 2ZMHA 2V0VA 3HLVA 1FBYA 1PQ9A 1T5ZA 2R40A 1P93A 3KMGA 4LBDA 2QH6A 4MG5A 5DXKA 3UVVA 4EMAA 3OSWA 4ITFA 5GICA 3A2IA 2H77A 1FM9D 1Y9RA 1YP0A 3DR1A 5DXBB 3WT6A 1X78A 2HAMA 4ZNWA 1GS4A 1FCYA 2AXAA 2QW4A 4IW8A 2I0GA 5EITA 5AYGA 4YNKA 2AX7A 5KCWA 4LSJA 3VT4A 2R6YA 2AA2A 4RMDA 5GIEA 3F5CB 2J14A 5DWIA 3VRUA 1YMTA 3FC6B 3LMPA 1XZXX 3IPQA 5H1EA 4FNEA 4MGBB 5DMFA 1XNNA 4RZEA 5DX3B 4XLDA 1T74A 5DL4A 3HC6A 4N1YA 5APHA 3WWRA 1SQNA 2QTUA 2HFPA 3DY6A
chains in the Genus database with same CATH superfamily
5DXBA 2ZLCA 3FLIA 3G8IA 1N46A 3ERDA 1NQ1A 2AX9A 3ADWA 3W5QA 2ZL9A 5C4TA 1SKXA 5DZ3A 5DZ0A 4UDDA 2YHDA 2Q60A 5ETHA 2O9IA 2P1TA 4UDAA 1S0XA 2J4AA 4PXMA 4A2JA 1NUOA 2ZASA 2Q6SA 5DLRA 3D57A 5KRMA 4OFUA 4LNWA 4IWCA 1T76A 2VV2A 3UP0A 1EXAA 3CWDA 5ACCA 5DX3A 5DTVA 4ZO1X 2Q5PA 2QA6A 3FXVA 3VRWA 3X1IA 3VJIA 5HCVA 5AAVB 2GPVA 4DMAA 3VTDA 3PO9A 4OJBA 5G46A 3OGTA 1FM6D 3DT3A 4B7WA 4IA3A 2F4BA 1G1UA 1K4WA 1T7TA 3PBAA 3OS8C 4OZRE 5FQVA 1Q4XA 4OEDA 1YYEA 3GYUA 1TXIA 4FHIA 5DXMA 1GWXA 5DY8A 1ERRA 2G44A 3ET1A 4JAZA 4QM0A 2QA8B 3CDSA 2POGA 3VI8A 3OOKA 2YLQA 5DP0A 1XP1A 3ET2A 3KDUA 4ZNVA 2Q8SA 4PPPA 1XDKA 3HVLA 3E00A 1UOMA 3B65A 2AB2A 4OGHA 5L7HA 4RWVA 3P0UA 2XYXA 2QNVA 2GPPA 5AAVA 4J5XC 4OHAA 5HJPB 3DZUA 3P8XA 3K6PA 4DM6A 5AK2A 1T7FA 2Q1VA 3VSOA 5APJA 1MVCA 2ZNOA 3H52A 4MG7A 4MG9B 1N4HA 4E2JA 5KR9A 3ZRBA 5E1CA 3UU7A 3E00D 2P1UA 3NOAA 5IZ0A 3ZR7A 4PLEA 4PP6A 1LBDA 4MG8B 5KCUA 4PLDA 5DWGA 2ZK2A 3R8IA 3CQVA 5KD9A 4OIUA 4ZO1B 2Q5SA 4CSJA 3BEJA 1FCXA 4E4KA 4K7AA 4DK7A 3D5FA 5CJ6A 5DKBA 1GWRA 2G0GA 4KZJA 4S0TA 1NAXA 1BSXA 1MZNA 2Q70A 5DZHA 3VJTA 3KBAA 4OH6A 5DRMA 5G45A 3ET3A 5DXQA 3W0AA 4POHA 3WJ5A 5JJMB 3L3XA 4PPSA 3VHUA 5DXRA 3ZRAA 5FQPA 3OMMA 5HJSA 2ABIA 1ZEOA 3G8OA 4LNXA 2XYJA 3GD2A 1HJ1A 5E0XA 3AZ3A 2ZXMA 2VSRA 3HC5A 5FQSA 5DVCA 2J7YA 4OARA 4UDBA 2ZMJA 3HZFA 1KNUA 2PIUA 2NV7A 1DKFA 2PIQA 4FN9A 3V3QA 2Z4BA 1U3QA 4IV4A 5F9BA 3W5PA 3VT6A 2HWRA 1U9EA 3B66A 2VV4B 4UDCA 3UUAA 5HZCA 3GWSX 3RVFA 4J5WC 1X7EA 1Y0XX 2Q7LA 3V9VA 1T73A 5IXKA 1ZGYA 4RFWA 2HBHA 5DUHA 4Q13A 1ILGA 3OMOA 1T7RA 1G50A 2OCFA 2ZK1A 3GZ9A 2B1ZA 3SZ1A 3HO0A 3UP3A 2NW4A 2YJAB 4MG6A 4TUZB 5DWEA 4S14A 2V7CA 3VHVA 5E14A 4IS8A 3KMZA 3RLLA 3FALB 4N5GA 1YOKA 4N73A 1PK5A 3VN2A 1RJKA 5KYJA 5C4OA 1UPWA 5ICKA 2HARA 5B41A 5DIGA 4OEZA 3OLFA 4G20A 1YINA 1X76A 3A78A 3FURA 4WHGA 3VSPA 3V3EA 1T65A 3NSPA 4ZNHA 1OSVA 3LBDA 2AMBA 1XOWA 3W5TA 3PLZA 5KRKA 4IQRA 3V9YA 1A28A 4WPFA 4PRGA 3WFGA 3OS8A 1ZDUA 2PIRA 2VV0A 2R40D 2P4YA 3OLSA 2PKLA 4JYIA 4KZIA 1I7IA 4OEAA 4MGCA 3B5RA 4PVUA 5KRCA 4ZOMA 3KMRA 4G1DA 3IA6A 5A86A 5G3JA 3VT5A 5AVIA 2B23A 1IE8A 2GP7A 4RUPA 4WVDA 3E7CA 4J5XA 2ZVTA 1RDTA 1ZH7A 2A3IA 3CS6A 3IXPA 4IVYA 3ZQTA 3CS8A 3SP9A 1S9QA 1PQCA 4HEEX 4X1FA 5DMCA 1K74A 1A52A 4OIVA 1QKMA 5JY3A 2POBA 1Y0SA 3B68A 4WQPA 2YFEA 2ZK3A 3B0QA 1R20A 5DUEA 5EGVA 5FQTA 1YUCA 2Z4JA 1G2NA 4RUJA 1MV9A 3IXPD 4G1YA 5FQRA 3F5CA 1X7RA 4MGAB 5DWJA 3RUUA 2NXXE 3FC6A 1P8DA 4MGBA 4OH5A 4Q50A 1DB1A 2XHSA 4ZNTA 1G5YA 3OSAA 3VT7A 1EXXA 3E94A 3BC5A 4IV2A 3AFRA 1R1KA 2OUZA 3ILZA 2PIOA 2HB7A 2VSTA 2I4JA 2QXMA 3IPSA 2BAWA 2AMAA 3K8SA 4NQAB 4HLWA 3B67A 1XQ3A 1R6GA 3AN3A 3AURA 5DZIA 3TKMA 2ACLB 1TFCA 1YY4A 2Q7IA 3L03A 3KFCA 4OZRU 2QXSA 2FAIA 1R5KA 1T79A 4WLBA 3W0YA 2NPAA 2HC4A 1PCGA 2IHQA 3B0WA 2AAXA 2PNUA 1NQ0A 3HODA 3MNPA 1RKGA 5GT4A 5C4UA 2HVCA 4J5WA 2Q59B 3DZYA 3WJ4A 2QGWA 1WM0X 4PP5A 4DK8A 2IOGA 3D6DA 2PIXA 4IU7A 5G42A 4OEYA 2ZNNA 2AYRA 1XLSE 1XV9B 2OVMA 3A2JA 5KRFA 1XJ7A 2YLOA 4IA7A 1M7WA 4OZTE 5KCDA 2ACLA 4TV1B 1UPVA 3IMYA 5G43A 1Z5XE 1YOWA 4K4JA 2YATA 2Q6RA 4J26A 2QA8A 2ZMIA 3DZUD 5KCTA 2QR9A 3PCUA 1VJBA 4RMEA 4YPQA 1UHLB 4ZN7A 2GPOA 1NHZA 5SYZA 3FEJA 3R29A 4KZMA 3CDPA 4M8HA 1PDUA 1T63A 2Q59A 3KYTA 2ZFXA 5DVVA 2GTKA 2QZOB 3GN8A 4Q0AC 3ERTA 5HJPA 4MGDB 4ZNUA 4OKXA 1X7BA 3OLLA 1XV9A 5B5BA 4EM9A 3CJWA 4MG9A 2B1VA 3VT9A 4IUIA 1ILHA 1U3SA 1ZKYA 3V49A 4REFA 4MG8A 4G21A 1L2JA 4PWLA 1OVLB 1X7JA 2OAXA 1XNXA 3UUDB 5DKSA 2ZLAA 3X31A 3CTBA 4G1ZA 4L96A 5DKGA 1U3RA 2NXXA 2Q1HA 1SJ0A 2P1VA 2XYWA 4YT1A 4BCRA 5AZTA 3VTCA 1I7GA 2AA6A 2AWHA 2PIWA 5APKA 2GWXA 2QZOA 3B0RA 2ZXZA 1EREA 4MGDA 4R06A 1K7LA 1YJEA 2AM9A 5EJVA 2GL8A 5JJMA 2AO6A 2VV1B 1IE9A 3FEIA 5AVLA 4L98A 3HM1A 4IVWA 4R6SA 5DXPA 1XVPB 3PRGA 2JFAB 1PQ6A 2O4JA 5DIDA 3WT7A 3VT8A 1OVLA 2Q6JA 3VTBA 3OAPA 2VV4A 2ZK4A 2OZ7A 2PIVA 1NYXA 3X36A 4O8FA 2ZNPA 4P6XA 4DQMA 5DU5A 3UVVB 5IAWA 2Q7KA 1XP6A 2ZBSA 3U9QA 2ZK5A 2ZK6A 2ZNQA 1H9UA 5DIEA 2J7XA 3T03A 1YIMA 4ZN9A 1NAVA 4QE8A 2ZKCA 1XLSA 3DCTA 5DV8A 4TUZA 3F7DA 3RY9A 1XIUA 3WT5A 5L7GA 4WHFA 3FALA 3TY0A 2W8YA 1FCZA 2LBDA 4NY9A 4QK4A 1XAPA 5M96A 1S19A 5E15A 5I4VA 1ZAFA 1XQCA 3AN4A 4PP3A 1NDEA 4ZJWA 2PITA 5DK9A 3VT3A 4RZFA 5DYBA 3CS4A 2QABA 4IWFA 3P89A 3R5NA 4RMCA 3KDTA 3X1HA 2P7AA 3WGPA 2I4ZA 4XI3A 3P88A 4NUFA 4DORA 3W0HA 2JF9A 1KV6A 5E19A 1XPCA 3DCUA 3KPZA 5LWPA 3TX7B 1NQ2A 1NQ7A 3KWYA 4NB6A 4PF3A 5KRAA 1OSHA 1SR7A 4J24A 5KROA 1GWQA 4NIEA 5E0WA 1M13A 2IOKA 3B0TA 2HASA 3OSIA 1KKQA 2EWPA 4S15A 4CI4A 2PIPL 1RDTD 2VV3A 3AZ2A 5K13A 1YA3A 3K22A 4XTAA 4JGVA 1K74D 4N8RA 4REEA 3CLDA 3G9EA 5DVSA 1I37A 1N83A 2I4PA 2XKWA 3W0JA 1S9PA 2ZY0A 1R20D 4OLMA 3EYBA 3ADSA 2FSZA 4APUA 1QKNA 5C4SA 5DWLA 3W0GA 3W0CA 1HG4A 3JZCA 3O1DA 4ONIA 4JYGA 3OZJA 1S0ZA 3FUGA 3L1BA 3OS9A 4RZGA 4ZI1A 3L0EA 2PINA 1R1KD 4XT9A 5DZ1A 1T7MA 2HCDA 4RE8A 1FM6A 2Q3YA 2QPYA 3PEQA 4MGAA 3B1MA 3W0IA 1XDKB 3Q95B 3NSQA 2PRGA 4JL4A 3VJHA 5KRJA 5GIDA 5DV6A 5DKEA 4QL8A 2QSEA 2AX6A 2GPUA 5L11A 2QMVA 3OZ0A 2QE4A 2Q61A 4ITEA 2HWQA 5AWKA 2P54A 3L3ZA 5KCCA 2HB8A 4MG7B 4OC7A 4ZNSA 2Q5GA 3JZBA 3S9SA 3B3KA 5EI1A 3UU7B 5AAUA 3ET0A 3DZYD 5EC9A 2FVJA 2OM9A 2P15A 3AUNA 3ADVA 3MNEA 2E2RA 5KRLA 3UUCA 4OZTU 3GBKA 3AX8A 2YJDA 3ADXA 3TKCA 3VHWA 3A40X 1Z5XU 4QE6A 3WTQA 4OFRA 4A4VA 5KRIA 5DXGA 1Z95A 2ATHA 2PJLA 3Q95A 2ZXNA 1M2ZA 4FGYA 4CI5A 3OMQA 5DSHA 2G5OA 4YMQA 4DM8A 3OMKA 4OILA 1RK3A 1L2IA 2R6WA 3A9EB 4DOSA 1FD0A 3AZ1A 5DV3A 3A3ZX 3H0AA 4POJA 3VJSA 4TV1A 2QGTA 2GIUA 1RKHA 4R2UA 2O4RA 3GWXA 3GYTA 4X1GA 2Q7JA 2I0JA 2AA7A 1DKFB 3M7RA 3N00A 3D90A 4K6IA 1QKUA 1UHLA 4OJ4A 3MNOA 3OKIA 5DRJA 3UUAB 3H0AD 3O1EA 2P7GA 3OMPA 1E3KA 3V4AA 3QT0A 3VRTA 3RLJA 2G0HA 3R8DA 4A4WA 3G0WA 4E4QA 2AX8A 3BQDA 3AUQA 3K23A 3R5MA 4FHHA 4MDDA 4RUOX 3RUTA 1ZDTA 5DUGA 3A9EA 2ZK0A 5HYRA 3W5RA 2H79A 4XHDA 3ADUA 3R2AA 4M8EA 3R8AA 4OKTA 3D24A 4OKWA 4ZJRA 2BJ4B 5G44A 3SP6A 4OJ9A 4P6WA 4QJRA 1ZUCA 5AWJA 2B50A 5AZVA 4RAKA 5DI7A 5DYDA 3ADTA 4G2IA 5KCEA 5EHJA 3UUDA 4IW6A 4XAOA 2REWA 4S0SA 5DXEA 5L7EA 2YLYA 5LGAA 3VRVA 1XP9A 4OKBA 5E7VA 1NRLA 3OKHA 4G2HA 4JYHA 5HYKA 1OT7A 2JJ3A 3IPUA 4F9MA 4IA2A 3WMHA 4IA1A 1PZLA 5JI0D 5KRHA 1XB7A 3HQ5A 3L0LA 2OVHA 2AA5A 1E3GA 2VV1A 2YLPA 4XUHA 5KYAA 4Y29A 4XUMA 1PRGA 2BJ4A 5G5WA 1LV2A 1XVPA 2JFAA 2P7ZA 3WFFA 3L0JA 1FM9A 3FS1A 3OOFA 4LTWA 3V9TA 4OK1A 1I38A 3A2HA 1QKTA 5KCFA 2ZMHA 2V0VA 3HLVA 1FBYA 1PQ9A 1T5ZA 2R40A 1P93A 3KMGA 4LBDA 2QH6A 4MG5A 5DXKA 3UVVA 4EMAA 3OSWA 4ITFA 5GICA 3A2IA 2H77A 1FM9D 1Y9RA 1YP0A 3DR1A 5DXBB 3WT6A 1X78A 2HAMA 4ZNWA 1GS4A 1FCYA 2AXAA 2QW4A 4IW8A 2I0GA 5EITA 5AYGA 4YNKA 2AX7A 5KCWA 4LSJA 3VT4A 2R6YA 2AA2A 4RMDA 5GIEA 3F5CB 2J14A 5DWIA 3VRUA 1YMTA 3FC6B 3LMPA 1XZXX 3IPQA 5H1EA 4FNEA 4MGBB 5DMFA 1XNNA 4RZEA 5DX3B 4XLDA 1T74A 5DL4A 3HC6A 4N1YA 5APHA 3WWRA 1SQNA 2QTUA 2HFPA 3DY6A
chains in the Genus database with same CATH topology
5DXBA 2ZLCA 3FLIA 3G8IA 1N46A 3ERDA 1NQ1A 2AX9A 3ADWA 3W5QA 2ZL9A 5C4TA 1SKXA 5DZ3A 5DZ0A 4UDDA 2YHDA 2Q60A 5ETHA 2O9IA 2P1TA 4UDAA 1S0XA 2J4AA 4PXMA 4A2JA 1NUOA 2ZASA 2Q6SA 5DLRA 3D57A 5KRMA 4OFUA 4LNWA 4IWCA 1T76A 2VV2A 3UP0A 1EXAA 3CWDA 5ACCA 5DX3A 5DTVA 4ZO1X 2Q5PA 2QA6A 3FXVA 3VRWA 3X1IA 3VJIA 5HCVA 5AAVB 2GPVA 4DMAA 3VTDA 3PO9A 4OJBA 5G46A 3OGTA 1FM6D 3DT3A 4B7WA 4IA3A 2F4BA 1G1UA 1K4WA 1T7TA 3PBAA 3OS8C 4OZRE 5FQVA 1Q4XA 4OEDA 1YYEA 3GYUA 1TXIA 4FHIA 5DXMA 1GWXA 5DY8A 1ERRA 2G44A 3ET1A 4JAZA 4QM0A 2QA8B 3CDSA 2POGA 3VI8A 3OOKA 2YLQA 5DP0A 1XP1A 3ET2A 3KDUA 4ZNVA 2Q8SA 4PPPA 1XDKA 3HVLA 3E00A 1UOMA 3B65A 2AB2A 4OGHA 5L7HA 4RWVA 3P0UA 2XYXA 2QNVA 2GPPA 5AAVA 4J5XC 4OHAA 5HJPB 3DZUA 3P8XA 3K6PA 4DM6A 5AK2A 1T7FA 2Q1VA 3VSOA 5APJA 1MVCA 2ZNOA 3H52A 4MG7A 4MG9B 1N4HA 4E2JA 5KR9A 3ZRBA 5E1CA 3UU7A 3E00D 2P1UA 3NOAA 5IZ0A 3ZR7A 4PLEA 4PP6A 1LBDA 4MG8B 5KCUA 4PLDA 5DWGA 2ZK2A 3R8IA 3CQVA 5KD9A 4OIUA 4ZO1B 2Q5SA 4CSJA 3BEJA 1FCXA 4E4KA 4K7AA 4DK7A 3D5FA 5CJ6A 5DKBA 1GWRA 2G0GA 4KZJA 4S0TA 1NAXA 1BSXA 1MZNA 2Q70A 5DZHA 3VJTA 3KBAA 4OH6A 5DRMA 5G45A 3ET3A 5DXQA 3W0AA 4POHA 3WJ5A 5JJMB 3L3XA 4PPSA 3VHUA 5DXRA 3ZRAA 5FQPA 3OMMA 5HJSA 2ABIA 1ZEOA 3G8OA 4LNXA 2XYJA 3GD2A 1HJ1A 5E0XA 3AZ3A 2ZXMA 2VSRA 3HC5A 5FQSA 5DVCA 2J7YA 4OARA 4UDBA 2ZMJA 3HZFA 1KNUA 2PIUA 2NV7A 1DKFA 2PIQA 4FN9A 3V3QA 2Z4BA 1U3QA 4IV4A 5F9BA 3W5PA 3VT6A 2HWRA 1U9EA 3B66A 2VV4B 4UDCA 3UUAA 5HZCA 3GWSX 3RVFA 4J5WC 1X7EA 1Y0XX 2Q7LA 3V9VA 1T73A 5IXKA 1ZGYA 4RFWA 2HBHA 5DUHA 4Q13A 1ILGA 3OMOA 1T7RA 1G50A 2OCFA 2ZK1A 3GZ9A 2B1ZA 3SZ1A 3HO0A 3UP3A 2NW4A 2YJAB 4MG6A 4TUZB 5DWEA 4S14A 2V7CA 3VHVA 5E14A 4IS8A 3KMZA 3RLLA 3FALB 4N5GA 1YOKA 4N73A 1PK5A 3VN2A 1RJKA 5KYJA 5C4OA 1UPWA 5ICKA 2HARA 5B41A 5DIGA 4OEZA 3OLFA 4G20A 1YINA 1X76A 3A78A 3FURA 4WHGA 3VSPA 3V3EA 1T65A 3NSPA 4ZNHA 1OSVA 3LBDA 2AMBA 1XOWA 3W5TA 3PLZA 5KRKA 4IQRA 3V9YA 1A28A 4WPFA 4PRGA 3WFGA 3OS8A 1ZDUA 2PIRA 2VV0A 2R40D 2P4YA 3OLSA 2PKLA 4JYIA 4KZIA 1I7IA 4OEAA 4MGCA 3B5RA 4PVUA 5KRCA 4ZOMA 3KMRA 4G1DA 3IA6A 5A86A 5G3JA 3VT5A 5AVIA 2B23A 1IE8A 2GP7A 4RUPA 4WVDA 3E7CA 4J5XA 2ZVTA 1RDTA 1ZH7A 2A3IA 3CS6A 3IXPA 4IVYA 3ZQTA 3CS8A 3SP9A 1S9QA 1PQCA 4HEEX 4X1FA 5DMCA 1K74A 1A52A 4OIVA 1QKMA 5JY3A 2POBA 1Y0SA 3B68A 4WQPA 2YFEA 2ZK3A 3B0QA 1R20A 5DUEA 5EGVA 5FQTA 1YUCA 2Z4JA 1G2NA 4RUJA 1MV9A 3IXPD 4G1YA 5FQRA 3F5CA 1X7RA 4MGAB 5DWJA 3RUUA 2NXXE 3FC6A 1P8DA 4MGBA 4OH5A 4Q50A 1DB1A 2XHSA 4ZNTA 1G5YA 3OSAA 3VT7A 1EXXA 3E94A 3BC5A 4IV2A 3AFRA 1R1KA 2OUZA 3ILZA 2PIOA 2HB7A 2VSTA 2I4JA 2QXMA 3IPSA 2BAWA 2AMAA 3K8SA 4NQAB 4HLWA 3B67A 1XQ3A 1R6GA 3AN3A 3AURA 5DZIA 3TKMA 2ACLB 1TFCA 1YY4A 2Q7IA 3L03A 3KFCA 4OZRU 2QXSA 2FAIA 1R5KA 1T79A 4WLBA 3W0YA 2NPAA 2HC4A 1PCGA 2IHQA 3B0WA 2AAXA 2PNUA 1NQ0A 3HODA 3MNPA 1RKGA 5GT4A 5C4UA 2HVCA 4J5WA 2Q59B 3DZYA 3WJ4A 2QGWA 1WM0X 4PP5A 4DK8A 2IOGA 3D6DA 2PIXA 4IU7A 5G42A 4OEYA 2ZNNA 2AYRA 1XLSE 1XV9B 2OVMA 3A2JA 5KRFA 1XJ7A 2YLOA 4IA7A 1M7WA 4OZTE 5KCDA 2ACLA 4TV1B 1UPVA 3IMYA 5G43A 1Z5XE 1YOWA 4K4JA 2YATA 2Q6RA 4J26A 2QA8A 2ZMIA 3DZUD 5KCTA 2QR9A 3PCUA 1VJBA 4RMEA 4YPQA 1UHLB 4ZN7A 2GPOA 1NHZA 5SYZA 3FEJA 3R29A 4KZMA 3CDPA 4M8HA 1PDUA 1T63A 2Q59A 3KYTA 2ZFXA 5DVVA 2GTKA 2QZOB 3GN8A 4Q0AC 3ERTA 5HJPA 4MGDB 4ZNUA 4OKXA 1X7BA 3OLLA 1XV9A 5B5BA 4EM9A 3CJWA 4MG9A 2B1VA 3VT9A 4IUIA 1ILHA 1U3SA 1ZKYA 3V49A 4REFA 4MG8A 4G21A 1L2JA 4PWLA 1OVLB 1X7JA 2OAXA 1XNXA 3UUDB 5DKSA 2ZLAA 3X31A 3CTBA 4G1ZA 4L96A 5DKGA 1U3RA 2NXXA 2Q1HA 1SJ0A 2P1VA 2XYWA 4YT1A 4BCRA 5AZTA 3VTCA 1I7GA 2AA6A 2AWHA 2PIWA 5APKA 2GWXA 2QZOA 3B0RA 2ZXZA 1EREA 4MGDA 4R06A 1K7LA 1YJEA 2AM9A 5EJVA 2GL8A 5JJMA 2AO6A 2VV1B 1IE9A 3FEIA 5AVLA 4L98A 3HM1A 4IVWA 4R6SA 5DXPA 1XVPB 3PRGA 2JFAB 1PQ6A 2O4JA 5DIDA 3WT7A 3VT8A 1OVLA 2Q6JA 3VTBA 3OAPA 2VV4A 2ZK4A 2OZ7A 2PIVA 1NYXA 3X36A 4O8FA 2ZNPA 4P6XA 4DQMA 5DU5A 3UVVB 5IAWA 2Q7KA 1XP6A 2ZBSA 3U9QA 2ZK5A 2ZK6A 2ZNQA 1H9UA 5DIEA 2J7XA 3T03A 1YIMA 4ZN9A 1NAVA 4QE8A 2ZKCA 1XLSA 3DCTA 5DV8A 4TUZA 3F7DA 3RY9A 1XIUA 3WT5A 5L7GA 4WHFA 3FALA 3TY0A 2W8YA 1FCZA 2LBDA 4NY9A 4QK4A 1XAPA 5M96A 1S19A 5E15A 5I4VA 1ZAFA 1XQCA 3AN4A 4PP3A 1NDEA 4ZJWA 2PITA 5DK9A 3VT3A 4RZFA 5DYBA 3CS4A 2QABA 4IWFA 3P89A 3R5NA 4RMCA 3KDTA 3X1HA 2P7AA 3WGPA 2I4ZA 4XI3A 3P88A 4NUFA 4DORA 3W0HA 2JF9A 1KV6A 5E19A 1XPCA 3DCUA 3KPZA 5LWPA 3TX7B 1NQ2A 1NQ7A 3KWYA 4NB6A 4PF3A 5KRAA 1OSHA 1SR7A 4J24A 5KROA 1GWQA 4NIEA 5E0WA 1M13A 2IOKA 3B0TA 2HASA 3OSIA 1KKQA 2EWPA 4S15A 4CI4A 2PIPL 1RDTD 2VV3A 3AZ2A 5K13A 1YA3A 3K22A 4XTAA 4JGVA 1K74D 4N8RA 4REEA 3CLDA 3G9EA 5DVSA 1I37A 1N83A 2I4PA 2XKWA 3W0JA 1S9PA 2ZY0A 1R20D 4OLMA 3EYBA 3ADSA 2FSZA 4APUA 1QKNA 5C4SA 5DWLA 3W0GA 3W0CA 1HG4A 3JZCA 3O1DA 4ONIA 4JYGA 3OZJA 1S0ZA 3FUGA 3L1BA 3OS9A 4RZGA 4ZI1A 3L0EA 2PINA 1R1KD 4XT9A 5DZ1A 1T7MA 2HCDA 4RE8A 1FM6A 2Q3YA 2QPYA 3PEQA 4MGAA 3B1MA 3W0IA 1XDKB 3Q95B 3NSQA 2PRGA 4JL4A 3VJHA 5KRJA 5GIDA 5DV6A 5DKEA 4QL8A 2QSEA 2AX6A 2GPUA 5L11A 2QMVA 3OZ0A 2QE4A 2Q61A 4ITEA 2HWQA 5AWKA 2P54A 3L3ZA 5KCCA 2HB8A 4MG7B 4OC7A 4ZNSA 2Q5GA 3JZBA 3S9SA 3B3KA 5EI1A 3UU7B 5AAUA 3ET0A 3DZYD 5EC9A 2FVJA 2OM9A 2P15A 3AUNA 3ADVA 3MNEA 2E2RA 5KRLA 3UUCA 4OZTU 3GBKA 3AX8A 2YJDA 3ADXA 3TKCA 3VHWA 3A40X 1Z5XU 4QE6A 3WTQA 4OFRA 4A4VA 5KRIA 5DXGA 1Z95A 2ATHA 2PJLA 3Q95A 2ZXNA 1M2ZA 4FGYA 4CI5A 3OMQA 5DSHA 2G5OA 4YMQA 4DM8A 3OMKA 4OILA 1RK3A 1L2IA 2R6WA 3A9EB 4DOSA 1FD0A 3AZ1A 5DV3A 3A3ZX 3H0AA 4POJA 3VJSA 4TV1A 2QGTA 2GIUA 1RKHA 4R2UA 2O4RA 3GWXA 3GYTA 4X1GA 2Q7JA 2I0JA 2AA7A 1DKFB 3M7RA 3N00A 3D90A 4K6IA 1QKUA 1UHLA 4OJ4A 3MNOA 3OKIA 5DRJA 3UUAB 3H0AD 3O1EA 2P7GA 3OMPA 1E3KA 3V4AA 3QT0A 3VRTA 3RLJA 2G0HA 3R8DA 4A4WA 3G0WA 4E4QA 2AX8A 3BQDA 3AUQA 3K23A 3R5MA 4FHHA 4MDDA 4RUOX 3RUTA 1ZDTA 5DUGA 3A9EA 2ZK0A 5HYRA 3W5RA 2H79A 4XHDA 3ADUA 3R2AA 4M8EA 3R8AA 4OKTA 3D24A 4OKWA 4ZJRA 2BJ4B 5G44A 3SP6A 4OJ9A 4P6WA 4QJRA 1ZUCA 5AWJA 2B50A 5AZVA 4RAKA 5DI7A 5DYDA 3ADTA 4G2IA 5KCEA 5EHJA 3UUDA 4IW6A 4XAOA 2REWA 4S0SA 5DXEA 5L7EA 2YLYA 5LGAA 3VRVA 1XP9A 4OKBA 5E7VA 1NRLA 3OKHA 4G2HA 4JYHA 5HYKA 1OT7A 2JJ3A 3IPUA 4F9MA 4IA2A 3WMHA 4IA1A 1PZLA 5JI0D 5KRHA 1XB7A 3HQ5A 3L0LA 2OVHA 2AA5A 1E3GA 2VV1A 2YLPA 4XUHA 5KYAA 4Y29A 4XUMA 1PRGA 2BJ4A 5G5WA 1LV2A 1XVPA 2JFAA 2P7ZA 3WFFA 3L0JA 1FM9A 3FS1A 3OOFA 4LTWA 3V9TA 4OK1A 1I38A 3A2HA 1QKTA 5KCFA 2ZMHA 2V0VA 3HLVA 1FBYA 1PQ9A 1T5ZA 2R40A 1P93A 3KMGA 4LBDA 2QH6A 4MG5A 5DXKA 3UVVA 4EMAA 3OSWA 4ITFA 5GICA 3A2IA 2H77A 1FM9D 1Y9RA 1YP0A 3DR1A 5DXBB 3WT6A 1X78A 2HAMA 4ZNWA 1GS4A 1FCYA 2AXAA 2QW4A 4IW8A 2I0GA 5EITA 5AYGA 4YNKA 2AX7A 5KCWA 4LSJA 3VT4A 2R6YA 2AA2A 4RMDA 5GIEA 3F5CB 2J14A 5DWIA 3VRUA 1YMTA 3FC6B 3LMPA 1XZXX 3IPQA 5H1EA 4FNEA 4MGBB 5DMFA 1XNNA 4RZEA 5DX3B 4XLDA 1T74A 5DL4A 3HC6A 4N1YA 5APHA 3WWRA 1SQNA 2QTUA 2HFPA 3DY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DXB A;  2ZLC A;  3FLI A;  3G8I A;  1N46 A;  3ERD A;  1NQ1 A;  2AX9 A;  3ADW A;  3W5Q A;  2ZL9 A;  5C4T A;  1SKX A;  5DZ3 A;  5DZ0 A;  4UDD A;  2YHD A;  2Q60 A;  5ETH A;  2O9I A;  2P1T A;  4UDA A;  1S0X A;  2J4A A;  4PXM A;  4A2J A;  1NUO A;  2ZAS A;  2Q6S A;  5DLR A;  3D57 A;  5KRM A;  4OFU A;  4LNW A;  4IWC A;  1T76 A;  2VV2 A;  3UP0 A;  1EXA A;  3CWD A;  5ACC A;  5DX3 A;  5DTV A;  4ZO1 X;  2Q5P A;  2QA6 A;  3FXV A;  3VRW A;  3X1I A;  3VJI A;  5HCV A;  5AAV B;  2GPV A;  4DMA A;  3VTD A;  3PO9 A;  4OJB A;  5G46 A;  3OGT A;  1FM6 D;  3DT3 A;  4B7W A;  4IA3 A;  2F4B A;  1G1U A;  1K4W A;  1T7T A;  3PBA A;  3OS8 C;  4OZR E;  5FQV A;  1Q4X A;  4OED A;  1YYE A;  3GYU A;  1TXI A;  4FHI A;  5DXM A;  1GWX A;  5DY8 A;  1ERR A;  2G44 A;  3ET1 A;  4JAZ A;  4QM0 A;  2QA8 B;  3CDS A;  2POG A;  3VI8 A;  3OOK A;  2YLQ A;  5DP0 A;  1XP1 A;  3ET2 A;  3KDU A;  4ZNV A;  2Q8S A;  4PPP A;  1XDK A;  3HVL A;  3E00 A;  1UOM A;  3B65 A;  2AB2 A;  4OGH A;  5L7H A;  4RWV A;  3P0U A;  2XYX A;  2QNV A;  2GPP A;  5AAV A;  4J5X C;  4OHA A;  5HJP B;  3DZU A;  3P8X A;  3K6P A;  4DM6 A;  5AK2 A;  1T7F A;  2Q1V A;  3VSO A;  5APJ A;  1MVC A;  2ZNO A;  3H52 A;  4MG7 A;  4MG9 B;  1N4H A;  4E2J A;  5KR9 A;  3ZRB A;  5E1C A;  3UU7 A;  3E00 D;  2P1U A;  3NOA A;  5IZ0 A;  3ZR7 A;  4PLE A;  4PP6 A;  1LBD A;  4MG8 B;  5KCU A;  4PLD A;  5DWG A;  2ZK2 A;  3R8I A;  3CQV A;  5KD9 A;  4OIU A;  4ZO1 B;  2Q5S A;  4CSJ A;  3BEJ A;  1FCX A;  4E4K A;  4K7A A;  4DK7 A;  3D5F A;  5CJ6 A;  5DKB A;  1GWR A;  2G0G A;  4KZJ A;  4S0T A;  1NAX A;  1BSX A;  1MZN A;  2Q70 A;  5DZH A;  3VJT A;  3KBA A;  4OH6 A;  5DRM A;  5G45 A;  3ET3 A;  5DXQ A;  3W0A A;  4POH A;  3WJ5 A;  5JJM B;  3L3X A;  4PPS A;  3VHU A;  5DXR A;  3ZRA A;  5FQP A;  3OMM A;  5HJS A;  2ABI A;  1ZEO A;  3G8O A;  4LNX A;  2XYJ A;  3GD2 A;  1HJ1 A;  5E0X A;  3AZ3 A;  2ZXM A;  2VSR A;  3HC5 A;  5FQS A;  5DVC A;  2J7Y A;  4OAR A;  4UDB A;  2ZMJ A;  3HZF A;  1KNU A;  2PIU A;  2NV7 A;  1DKF A;  2PIQ A;  4FN9 A;  3V3Q A;  2Z4B A;  1U3Q A;  4IV4 A;  5F9B A;  3W5P A;  3VT6 A;  2HWR A;  1U9E A;  3B66 A;  2VV4 B;  4UDC A;  3UUA A;  5HZC A;  3GWS X;  3RVF A;  4J5W C;  1X7E A;  1Y0X X;  2Q7L A;  3V9V A;  1T73 A;  5IXK A;  1ZGY A;  4RFW A;  2HBH A;  5DUH A;  4Q13 A;  1ILG A;  3OMO A;  1T7R A;  1G50 A;  2OCF A;  2ZK1 A;  3GZ9 A;  2B1Z A;  3SZ1 A;  3HO0 A;  3UP3 A;  2NW4 A;  2YJA B;  4MG6 A;  4TUZ B;  5DWE A;  4S14 A;  2V7C A;  3VHV A;  5E14 A;  4IS8 A;  3KMZ A;  3RLL A;  3FAL B;  4N5G A;  1YOK A;  4N73 A;  1PK5 A;  3VN2 A;  1RJK A;  5KYJ A;  5C4O A;  1UPW A;  5ICK A;  2HAR A;  5B41 A;  5DIG A;  4OEZ A;  3OLF A;  4G20 A;  1YIN A;  1X76 A;  3A78 A;  3FUR A;  4WHG A;  3VSP A;  3V3E A;  1T65 A;  3NSP A;  4ZNH A;  1OSV A;  3LBD A;  2AMB A;  1XOW A;  3W5T A;  3PLZ A;  5KRK A;  4IQR A;  3V9Y A;  1A28 A;  4WPF A;  4PRG A;  3WFG A;  3OS8 A;  1ZDU A;  2PIR A;  2VV0 A;  2R40 D;  2P4Y A;  3OLS A;  2PKL A;  4JYI A;  4KZI A;  1I7I A;  4OEA A;  4MGC A;  3B5R A;  4PVU A;  5KRC A;  4ZOM A;  3KMR A;  4G1D A;  3IA6 A;  5A86 A;  5G3J A;  3VT5 A;  5AVI A;  2B23 A;  1IE8 A;  2GP7 A;  4RUP A;  4WVD A;  3E7C A;  4J5X A;  2ZVT A;  1RDT A;  1ZH7 A;  2A3I A;  3CS6 A;  3IXP A;  4IVY A;  3ZQT A;  3CS8 A;  3SP9 A;  1S9Q A;  1PQC A;  4HEE X;  4X1F A;  5DMC A;  1K74 A;  1A52 A;  4OIV A;  1QKM A;  5JY3 A;  2POB A;  1Y0S A;  3B68 A;  4WQP A;  2YFE A;  2ZK3 A;  3B0Q A;  1R20 A;  5DUE A;  5EGV A;  5FQT A;  1YUC A;  2Z4J A;  1G2N A;  4RUJ A;  1MV9 A;  3IXP D;  4G1Y A;  5FQR A;  3F5C A;  1X7R A;  4MGA B;  5DWJ A;  3RUU A;  2NXX E;  3FC6 A;  1P8D A;  4MGB A;  4OH5 A;  4Q50 A;  1DB1 A;  2XHS A;  4ZNT A;  1G5Y A;  3OSA A;  3VT7 A;  1EXX A;  3E94 A;  3BC5 A;  4IV2 A;  3AFR A;  1R1K A;  2OUZ A;  3ILZ A;  2PIO A;  2HB7 A;  2VST A;  2I4J A;  2QXM A;  3IPS A;  2BAW A;  2AMA A;  3K8S A;  4NQA B;  4HLW A;  3B67 A;  1XQ3 A;  1R6G A;  3AN3 A;  3AUR A;  5DZI A;  3TKM A;  2ACL B;  1TFC A;  1YY4 A;  2Q7I A;  3L03 A;  3KFC A;  4OZR U;  2QXS A;  2FAI A;  1R5K A;  1T79 A;  4WLB A;  3W0Y A;  2NPA A;  2HC4 A;  1PCG A;  2IHQ A;  3B0W A;  2AAX A;  2PNU A;  1NQ0 A;  3HOD A;  3MNP A;  1RKG A;  5GT4 A;  5C4U A;  2HVC A;  4J5W A;  2Q59 B;  3DZY A;  3WJ4 A;  2QGW A;  1WM0 X;  4PP5 A;  4DK8 A;  2IOG A;  3D6D A;  2PIX A;  4IU7 A;  5G42 A;  4OEY A;  2ZNN A;  2AYR A;  1XLS E;  1XV9 B;  2OVM A;  3A2J A;  5KRF A;  1XJ7 A;  2YLO A;  4IA7 A;  1M7W A;  4OZT E;  5KCD A;  2ACL A;  4TV1 B;  1UPV A;  3IMY A;  5G43 A;  1Z5X E;  1YOW A;  4K4J A;  2YAT A;  2Q6R A;  4J26 A;  2QA8 A;  2ZMI A;  3DZU D;  5KCT A;  2QR9 A;  3PCU A;  1VJB A;  4RME A;  4YPQ A;  1UHL B;  4ZN7 A;  2GPO A;  1NHZ A;  5SYZ A;  3FEJ A;  3R29 A;  4KZM A;  3CDP A;  4M8H A;  1PDU A;  1T63 A;  2Q59 A;  3KYT A;  2ZFX A;  5DVV A;  2GTK A;  2QZO B;  3GN8 A;  4Q0A C;  3ERT A;  5HJP A;  4MGD B;  4ZNU A;  4OKX A;  1X7B A;  3OLL A;  1XV9 A;  5B5B A;  4EM9 A;  3CJW A;  4MG9 A;  2B1V A;  3VT9 A;  4IUI A;  1ILH A;  1U3S A;  1ZKY A;  3V49 A;  4REF A;  4MG8 A;  4G21 A;  1L2J A;  4PWL A;  1OVL B;  1X7J A;  2OAX A;  1XNX A;  3UUD B;  5DKS A;  2ZLA A;  3X31 A;  3CTB A;  4G1Z A;  4L96 A;  5DKG A;  1U3R A;  2NXX A;  2Q1H A;  1SJ0 A;  2P1V A;  2XYW A;  4YT1 A;  4BCR A;  5AZT A;  3VTC A;  1I7G A;  2AA6 A;  2AWH A;  2PIW A;  5APK A;  2GWX A;  2QZO A;  3B0R A;  2ZXZ A;  1ERE A;  4MGD A;  4R06 A;  1K7L A;  1YJE A;  2AM9 A;  5EJV A;  2GL8 A;  5JJM A;  2AO6 A;  2VV1 B;  1IE9 A;  3FEI A;  5AVL A;  4L98 A;  3HM1 A;  4IVW A;  4R6S A;  5DXP A;  1XVP B;  3PRG A;  2JFA B;  1PQ6 A;  2O4J A;  5DID A;  3WT7 A;  3VT8 A;  1OVL A;  2Q6J A;  3VTB A;  3OAP A;  2VV4 A;  2ZK4 A;  2OZ7 A;  2PIV A;  1NYX A;  3X36 A;  4O8F A;  2ZNP A;  4P6X A;  4DQM A;  5DU5 A;  3UVV B;  5IAW A;  2Q7K A;  1XP6 A;  2ZBS A;  3U9Q A;  2ZK5 A;  2ZK6 A;  2ZNQ A;  1H9U A;  5DIE A;  2J7X A;  3T03 A;  1YIM A;  4ZN9 A;  1NAV A;  4QE8 A;  2ZKC A;  1XLS A;  3DCT A;  5DV8 A;  4TUZ A;  3F7D A;  3RY9 A;  1XIU A;  3WT5 A;  5L7G A;  4WHF A;  3FAL A;  3TY0 A;  2W8Y A;  1FCZ A;  2LBD A;  4NY9 A;  4QK4 A;  1XAP A;  5M96 A;  1S19 A;  5E15 A;  5I4V A;  1ZAF A;  1XQC A;  3AN4 A;  4PP3 A;  1NDE A;  4ZJW A;  2PIT A;  5DK9 A;  3VT3 A;  4RZF A;  5DYB A;  3CS4 A;  2QAB A;  4IWF A;  3P89 A;  3R5N A;  4RMC A;  3KDT A;  3X1H A;  2P7A A;  3WGP A;  2I4Z A;  4XI3 A;  3P88 A;  4NUF A;  4DOR A;  3W0H A;  2JF9 A;  1KV6 A;  5E19 A;  1XPC A;  3DCU A;  3KPZ A;  5LWP A;  3TX7 B;  1NQ2 A;  1NQ7 A;  3KWY A;  4NB6 A;  4PF3 A;  5KRA A;  1OSH A;  1SR7 A;  4J24 A;  5KRO A;  1GWQ A;  4NIE A;  5E0W A;  1M13 A;  2IOK A;  3B0T A;  2HAS A;  3OSI A;  1KKQ A;  2EWP A;  4S15 A;  4CI4 A;  2PIP L;  1RDT D;  2VV3 A;  3AZ2 A;  5K13 A;  1YA3 A;  3K22 A;  4XTA A;  4JGV A;  1K74 D;  4N8R A;  4REE A;  3CLD A;  3G9E A;  5DVS A;  1I37 A;  1N83 A;  2I4P A;  2XKW A;  3W0J A;  1S9P A;  2ZY0 A;  1R20 D;  4OLM A;  3EYB A;  3ADS A;  2FSZ A;  4APU A;  1QKN A;  5C4S A;  5DWL A;  3W0G A;  3W0C A;  1HG4 A;  3JZC A;  3O1D A;  4ONI A;  4JYG A;  3OZJ A;  1S0Z A;  3FUG A;  3L1B A;  3OS9 A;  4RZG A;  4ZI1 A;  3L0E A;  2PIN A;  1R1K D;  4XT9 A;  5DZ1 A;  1T7M A;  2HCD A;  4RE8 A;  1FM6 A;  2Q3Y A;  2QPY A;  3PEQ A;  4MGA A;  3B1M A;  3W0I A;  1XDK B;  3Q95 B;  3NSQ A;  2PRG A;  4JL4 A;  3VJH A;  5KRJ A;  5GID A;  5DV6 A;  5DKE A;  4QL8 A;  2QSE A;  2AX6 A;  2GPU A;  5L11 A;  2QMV A;  3OZ0 A;  2QE4 A;  2Q61 A;  4ITE A;  2HWQ A;  5AWK A;  2P54 A;  3L3Z A;  5KCC A;  2HB8 A;  4MG7 B;  4OC7 A;  4ZNS A;  2Q5G A;  3JZB A;  3S9S A;  3B3K A;  5EI1 A;  3UU7 B;  5AAU A;  3ET0 A;  3DZY D;  5EC9 A;  2FVJ A;  2OM9 A;  2P15 A;  3AUN A;  3ADV A;  3MNE A;  2E2R A;  5KRL A;  3UUC A;  4OZT U;  3GBK A;  3AX8 A;  2YJD A;  3ADX A;  3TKC A;  3VHW A;  3A40 X;  1Z5X U;  4QE6 A;  3WTQ A;  4OFR A;  4A4V A;  5KRI A;  5DXG A;  1Z95 A;  2ATH A;  2PJL A;  3Q95 A;  2ZXN A;  1M2Z A;  4FGY A;  4CI5 A;  3OMQ A;  5DSH A;  2G5O A;  4YMQ A;  4DM8 A;  3OMK A;  4OIL A;  1RK3 A;  1L2I A;  2R6W A;  3A9E B;  4DOS A;  1FD0 A;  3AZ1 A;  5DV3 A;  3A3Z X;  3H0A A;  4POJ A;  3VJS A;  4TV1 A;  2QGT A;  2GIU A;  1RKH A;  4R2U A;  2O4R A;  3GWX A;  3GYT A;  4X1G A;  2Q7J A;  2I0J A;  2AA7 A;  1DKF B;  3M7R A;  3N00 A;  3D90 A;  4K6I A;  1QKU A;  1UHL A;  4OJ4 A;  3MNO A;  3OKI A;  5DRJ A;  3UUA B;  3H0A D;  3O1E A;  2P7G A;  3OMP A;  1E3K A;  3V4A A;  3QT0 A;  3VRT A;  3RLJ A;  2G0H A;  3R8D A;  4A4W A;  3G0W A;  4E4Q A;  2AX8 A;  3BQD A;  3AUQ A;  3K23 A;  3R5M A;  4FHH A;  4MDD A;  4RUO X;  3RUT A;  1ZDT A;  5DUG A;  3A9E A;  2ZK0 A;  5HYR A;  3W5R A;  2H79 A;  4XHD A;  3ADU A;  3R2A A;  4M8E A;  3R8A A;  4OKT A;  3D24 A;  4OKW A;  4ZJR A;  2BJ4 B;  5G44 A;  3SP6 A;  4OJ9 A;  4P6W A;  4QJR A;  1ZUC A;  5AWJ A;  2B50 A;  5AZV A;  4RAK A;  5DI7 A;  5DYD A;  3ADT A;  4G2I A;  5KCE A;  5EHJ A;  3UUD A;  4IW6 A;  4XAO A;  2REW A;  4S0S A;  5DXE A;  5L7E A;  2YLY A;  5LGA A;  3VRV A;  1XP9 A;  4OKB A;  5E7V A;  1NRL A;  3OKH A;  4G2H A;  4JYH A;  5HYK A;  1OT7 A;  2JJ3 A;  3IPU A;  4F9M A;  4IA2 A;  3WMH A;  4IA1 A;  1PZL A;  5JI0 D;  5KRH A;  1XB7 A;  3HQ5 A;  3L0L A;  2OVH A;  2AA5 A;  1E3G A;  2VV1 A;  2YLP A;  4XUH A;  5KYA A;  4Y29 A;  4XUM A;  1PRG A;  2BJ4 A;  5G5W A;  1LV2 A;  1XVP A;  2JFA A;  2P7Z A;  3WFF A;  3L0J A;  1FM9 A;  3FS1 A;  3OOF A;  4LTW A;  3V9T A;  4OK1 A;  1I38 A;  3A2H A;  1QKT A;  5KCF A;  2ZMH A;  2V0V A;  3HLV A;  1FBY A;  1PQ9 A;  1T5Z A;  2R40 A;  1P93 A;  3KMG A;  4LBD A;  2QH6 A;  4MG5 A;  5DXK A;  3UVV A;  4EMA A;  3OSW A;  4ITF A;  5GIC A;  3A2I A;  2H77 A;  1FM9 D;  1Y9R A;  1YP0 A;  3DR1 A;  5DXB B;  3WT6 A;  1X78 A;  2HAM A;  4ZNW A;  1GS4 A;  1FCY A;  2AXA A;  2QW4 A;  4IW8 A;  2I0G A;  5EIT A;  5AYG A;  4YNK A;  2AX7 A;  5KCW A;  4LSJ A;  3VT4 A;  2R6Y A;  2AA2 A;  4RMD A;  5GIE A;  3F5C B;  2J14 A;  5DWI A;  3VRU A;  1YMT A;  3FC6 B;  3LMP A;  1XZX X;  3IPQ A;  5H1E A;  4FNE A;  4MGB B;  5DMF A;  1XNN A;  4RZE A;  5DX3 B;  4XLD A;  1T74 A;  5DL4 A;  3HC6 A;  4N1Y A;  5APH A;  3WWR A;  1SQN A;  2QTU A;  2HFP A;  3DY6 A; 
#chains in the Genus database with same CATH topology
 5DXB A;  2ZLC A;  3FLI A;  3G8I A;  1N46 A;  3ERD A;  1NQ1 A;  2AX9 A;  3ADW A;  3W5Q A;  2ZL9 A;  5C4T A;  1SKX A;  5DZ3 A;  5DZ0 A;  4UDD A;  2YHD A;  2Q60 A;  5ETH A;  2O9I A;  2P1T A;  4UDA A;  1S0X A;  2J4A A;  4PXM A;  4A2J A;  1NUO A;  2ZAS A;  2Q6S A;  5DLR A;  3D57 A;  5KRM A;  4OFU A;  4LNW A;  4IWC A;  1T76 A;  2VV2 A;  3UP0 A;  1EXA A;  3CWD A;  5ACC A;  5DX3 A;  5DTV A;  4ZO1 X;  2Q5P A;  2QA6 A;  3FXV A;  3VRW A;  3X1I A;  3VJI A;  5HCV A;  5AAV B;  2GPV A;  4DMA A;  3VTD A;  3PO9 A;  4OJB A;  5G46 A;  3OGT A;  1FM6 D;  3DT3 A;  4B7W A;  4IA3 A;  2F4B A;  1G1U A;  1K4W A;  1T7T A;  3PBA A;  3OS8 C;  4OZR E;  5FQV A;  1Q4X A;  4OED A;  1YYE A;  3GYU A;  1TXI A;  4FHI A;  5DXM A;  1GWX A;  5DY8 A;  1ERR A;  2G44 A;  3ET1 A;  4JAZ A;  4QM0 A;  2QA8 B;  3CDS A;  2POG A;  3VI8 A;  3OOK A;  2YLQ A;  5DP0 A;  1XP1 A;  3ET2 A;  3KDU A;  4ZNV A;  2Q8S A;  4PPP A;  1XDK A;  3HVL A;  3E00 A;  1UOM A;  3B65 A;  2AB2 A;  4OGH A;  5L7H A;  4RWV A;  3P0U A;  2XYX A;  2QNV A;  2GPP A;  5AAV A;  4J5X C;  4OHA A;  5HJP B;  3DZU A;  3P8X A;  3K6P A;  4DM6 A;  5AK2 A;  1T7F A;  2Q1V A;  3VSO A;  5APJ A;  1MVC A;  2ZNO A;  3H52 A;  4MG7 A;  4MG9 B;  1N4H A;  4E2J A;  5KR9 A;  3ZRB A;  5E1C A;  3UU7 A;  3E00 D;  2P1U A;  3NOA A;  5IZ0 A;  3ZR7 A;  4PLE A;  4PP6 A;  1LBD A;  4MG8 B;  5KCU A;  4PLD A;  5DWG A;  2ZK2 A;  3R8I A;  3CQV A;  5KD9 A;  4OIU A;  4ZO1 B;  2Q5S A;  4CSJ A;  3BEJ A;  1FCX A;  4E4K A;  4K7A A;  4DK7 A;  3D5F A;  5CJ6 A;  5DKB A;  1GWR A;  2G0G A;  4KZJ A;  4S0T A;  1NAX A;  1BSX A;  1MZN A;  2Q70 A;  5DZH A;  3VJT A;  3KBA A;  4OH6 A;  5DRM A;  5G45 A;  3ET3 A;  5DXQ A;  3W0A A;  4POH A;  3WJ5 A;  5JJM B;  3L3X A;  4PPS A;  3VHU A;  5DXR A;  3ZRA A;  5FQP A;  3OMM A;  5HJS A;  2ABI A;  1ZEO A;  3G8O A;  4LNX A;  2XYJ A;  3GD2 A;  1HJ1 A;  5E0X A;  3AZ3 A;  2ZXM A;  2VSR A;  3HC5 A;  5FQS A;  5DVC A;  2J7Y A;  4OAR A;  4UDB A;  2ZMJ A;  3HZF A;  1KNU A;  2PIU A;  2NV7 A;  1DKF A;  2PIQ A;  4FN9 A;  3V3Q A;  2Z4B A;  1U3Q A;  4IV4 A;  5F9B A;  3W5P A;  3VT6 A;  2HWR A;  1U9E A;  3B66 A;  2VV4 B;  4UDC A;  3UUA A;  5HZC A;  3GWS X;  3RVF A;  4J5W C;  1X7E A;  1Y0X X;  2Q7L A;  3V9V A;  1T73 A;  5IXK A;  1ZGY A;  4RFW A;  2HBH A;  5DUH A;  4Q13 A;  1ILG A;  3OMO A;  1T7R A;  1G50 A;  2OCF A;  2ZK1 A;  3GZ9 A;  2B1Z A;  3SZ1 A;  3HO0 A;  3UP3 A;  2NW4 A;  2YJA B;  4MG6 A;  4TUZ B;  5DWE A;  4S14 A;  2V7C A;  3VHV A;  5E14 A;  4IS8 A;  3KMZ A;  3RLL A;  3FAL B;  4N5G A;  1YOK A;  4N73 A;  1PK5 A;  3VN2 A;  1RJK A;  5KYJ A;  5C4O A;  1UPW A;  5ICK A;  2HAR A;  5B41 A;  5DIG A;  4OEZ A;  3OLF A;  4G20 A;  1YIN A;  1X76 A;  3A78 A;  3FUR A;  4WHG A;  3VSP A;  3V3E A;  1T65 A;  3NSP A;  4ZNH A;  1OSV A;  3LBD A;  2AMB A;  1XOW A;  3W5T A;  3PLZ A;  5KRK A;  4IQR A;  3V9Y A;  1A28 A;  4WPF A;  4PRG A;  3WFG A;  3OS8 A;  1ZDU A;  2PIR A;  2VV0 A;  2R40 D;  2P4Y A;  3OLS A;  2PKL A;  4JYI A;  4KZI A;  1I7I A;  4OEA A;  4MGC A;  3B5R A;  4PVU A;  5KRC A;  4ZOM A;  3KMR A;  4G1D A;  3IA6 A;  5A86 A;  5G3J A;  3VT5 A;  5AVI A;  2B23 A;  1IE8 A;  2GP7 A;  4RUP A;  4WVD A;  3E7C A;  4J5X A;  2ZVT A;  1RDT A;  1ZH7 A;  2A3I A;  3CS6 A;  3IXP A;  4IVY A;  3ZQT A;  3CS8 A;  3SP9 A;  1S9Q A;  1PQC A;  4HEE X;  4X1F A;  5DMC A;  1K74 A;  1A52 A;  4OIV A;  1QKM A;  5JY3 A;  2POB A;  1Y0S A;  3B68 A;  4WQP A;  2YFE A;  2ZK3 A;  3B0Q A;  1R20 A;  5DUE A;  5EGV A;  5FQT A;  1YUC A;  2Z4J A;  1G2N A;  4RUJ A;  1MV9 A;  3IXP D;  4G1Y A;  5FQR A;  3F5C A;  1X7R A;  4MGA B;  5DWJ A;  3RUU A;  2NXX E;  3FC6 A;  1P8D A;  4MGB A;  4OH5 A;  4Q50 A;  1DB1 A;  2XHS A;  4ZNT A;  1G5Y A;  3OSA A;  3VT7 A;  1EXX A;  3E94 A;  3BC5 A;  4IV2 A;  3AFR A;  1R1K A;  2OUZ A;  3ILZ A;  2PIO A;  2HB7 A;  2VST A;  2I4J A;  2QXM A;  3IPS A;  2BAW A;  2AMA A;  3K8S A;  4NQA B;  4HLW A;  3B67 A;  1XQ3 A;  1R6G A;  3AN3 A;  3AUR A;  5DZI A;  3TKM A;  2ACL B;  1TFC A;  1YY4 A;  2Q7I A;  3L03 A;  3KFC A;  4OZR U;  2QXS A;  2FAI A;  1R5K A;  1T79 A;  4WLB A;  3W0Y A;  2NPA A;  2HC4 A;  1PCG A;  2IHQ A;  3B0W A;  2AAX A;  2PNU A;  1NQ0 A;  3HOD A;  3MNP A;  1RKG A;  5GT4 A;  5C4U A;  2HVC A;  4J5W A;  2Q59 B;  3DZY A;  3WJ4 A;  2QGW A;  1WM0 X;  4PP5 A;  4DK8 A;  2IOG A;  3D6D A;  2PIX A;  4IU7 A;  5G42 A;  4OEY A;  2ZNN A;  2AYR A;  1XLS E;  1XV9 B;  2OVM A;  3A2J A;  5KRF A;  1XJ7 A;  2YLO A;  4IA7 A;  1M7W A;  4OZT E;  5KCD A;  2ACL A;  4TV1 B;  1UPV A;  3IMY A;  5G43 A;  1Z5X E;  1YOW A;  4K4J A;  2YAT A;  2Q6R A;  4J26 A;  2QA8 A;  2ZMI A;  3DZU D;  5KCT A;  2QR9 A;  3PCU A;  1VJB A;  4RME A;  4YPQ A;  1UHL B;  4ZN7 A;  2GPO A;  1NHZ A;  5SYZ A;  3FEJ A;  3R29 A;  4KZM A;  3CDP A;  4M8H A;  1PDU A;  1T63 A;  2Q59 A;  3KYT A;  2ZFX A;  5DVV A;  2GTK A;  2QZO B;  3GN8 A;  4Q0A C;  3ERT A;  5HJP A;  4MGD B;  4ZNU A;  4OKX A;  1X7B A;  3OLL A;  1XV9 A;  5B5B A;  4EM9 A;  3CJW A;  4MG9 A;  2B1V A;  3VT9 A;  4IUI A;  1ILH A;  1U3S A;  1ZKY A;  3V49 A;  4REF A;  4MG8 A;  4G21 A;  1L2J A;  4PWL A;  1OVL B;  1X7J A;  2OAX A;  1XNX A;  3UUD B;  5DKS A;  2ZLA A;  3X31 A;  3CTB A;  4G1Z A;  4L96 A;  5DKG A;  1U3R A;  2NXX A;  2Q1H A;  1SJ0 A;  2P1V A;  2XYW A;  4YT1 A;  4BCR A;  5AZT A;  3VTC A;  1I7G A;  2AA6 A;  2AWH A;  2PIW A;  5APK A;  2GWX A;  2QZO A;  3B0R A;  2ZXZ A;  1ERE A;  4MGD A;  4R06 A;  1K7L A;  1YJE A;  2AM9 A;  5EJV A;  2GL8 A;  5JJM A;  2AO6 A;  2VV1 B;  1IE9 A;  3FEI A;  5AVL A;  4L98 A;  3HM1 A;  4IVW A;  4R6S A;  5DXP A;  1XVP B;  3PRG A;  2JFA B;  1PQ6 A;  2O4J A;  5DID A;  3WT7 A;  3VT8 A;  1OVL A;  2Q6J A;  3VTB A;  3OAP A;  2VV4 A;  2ZK4 A;  2OZ7 A;  2PIV A;  1NYX A;  3X36 A;  4O8F A;  2ZNP A;  4P6X A;  4DQM A;  5DU5 A;  3UVV B;  5IAW A;  2Q7K A;  1XP6 A;  2ZBS A;  3U9Q A;  2ZK5 A;  2ZK6 A;  2ZNQ A;  1H9U A;  5DIE A;  2J7X A;  3T03 A;  1YIM A;  4ZN9 A;  1NAV A;  4QE8 A;  2ZKC A;  1XLS A;  3DCT A;  5DV8 A;  4TUZ A;  3F7D A;  3RY9 A;  1XIU A;  3WT5 A;  5L7G A;  4WHF A;  3FAL A;  3TY0 A;  2W8Y A;  1FCZ A;  2LBD A;  4NY9 A;  4QK4 A;  1XAP A;  5M96 A;  1S19 A;  5E15 A;  5I4V A;  1ZAF A;  1XQC A;  3AN4 A;  4PP3 A;  1NDE A;  4ZJW A;  2PIT A;  5DK9 A;  3VT3 A;  4RZF A;  5DYB A;  3CS4 A;  2QAB A;  4IWF A;  3P89 A;  3R5N A;  4RMC A;  3KDT A;  3X1H A;  2P7A A;  3WGP A;  2I4Z A;  4XI3 A;  3P88 A;  4NUF A;  4DOR A;  3W0H A;  2JF9 A;  1KV6 A;  5E19 A;  1XPC A;  3DCU A;  3KPZ A;  5LWP A;  3TX7 B;  1NQ2 A;  1NQ7 A;  3KWY A;  4NB6 A;  4PF3 A;  5KRA A;  1OSH A;  1SR7 A;  4J24 A;  5KRO A;  1GWQ A;  4NIE A;  5E0W A;  1M13 A;  2IOK A;  3B0T A;  2HAS A;  3OSI A;  1KKQ A;  2EWP A;  4S15 A;  4CI4 A;  2PIP L;  1RDT D;  2VV3 A;  3AZ2 A;  5K13 A;  1YA3 A;  3K22 A;  4XTA A;  4JGV A;  1K74 D;  4N8R A;  4REE A;  3CLD A;  3G9E A;  5DVS A;  1I37 A;  1N83 A;  2I4P A;  2XKW A;  3W0J A;  1S9P A;  2ZY0 A;  1R20 D;  4OLM A;  3EYB A;  3ADS A;  2FSZ A;  4APU A;  1QKN A;  5C4S A;  5DWL A;  3W0G A;  3W0C A;  1HG4 A;  3JZC A;  3O1D A;  4ONI A;  4JYG A;  3OZJ A;  1S0Z A;  3FUG A;  3L1B A;  3OS9 A;  4RZG A;  4ZI1 A;  3L0E A;  2PIN A;  1R1K D;  4XT9 A;  5DZ1 A;  1T7M A;  2HCD A;  4RE8 A;  1FM6 A;  2Q3Y A;  2QPY A;  3PEQ A;  4MGA A;  3B1M A;  3W0I A;  1XDK B;  3Q95 B;  3NSQ A;  2PRG A;  4JL4 A;  3VJH A;  5KRJ A;  5GID A;  5DV6 A;  5DKE A;  4QL8 A;  2QSE A;  2AX6 A;  2GPU A;  5L11 A;  2QMV A;  3OZ0 A;  2QE4 A;  2Q61 A;  4ITE A;  2HWQ A;  5AWK A;  2P54 A;  3L3Z A;  5KCC A;  2HB8 A;  4MG7 B;  4OC7 A;  4ZNS A;  2Q5G A;  3JZB A;  3S9S A;  3B3K A;  5EI1 A;  3UU7 B;  5AAU A;  3ET0 A;  3DZY D;  5EC9 A;  2FVJ A;  2OM9 A;  2P15 A;  3AUN A;  3ADV A;  3MNE A;  2E2R A;  5KRL A;  3UUC A;  4OZT U;  3GBK A;  3AX8 A;  2YJD A;  3ADX A;  3TKC A;  3VHW A;  3A40 X;  1Z5X U;  4QE6 A;  3WTQ A;  4OFR A;  4A4V A;  5KRI A;  5DXG A;  1Z95 A;  2ATH A;  2PJL A;  3Q95 A;  2ZXN A;  1M2Z A;  4FGY A;  4CI5 A;  3OMQ A;  5DSH A;  2G5O A;  4YMQ A;  4DM8 A;  3OMK A;  4OIL A;  1RK3 A;  1L2I A;  2R6W A;  3A9E B;  4DOS A;  1FD0 A;  3AZ1 A;  5DV3 A;  3A3Z X;  3H0A A;  4POJ A;  3VJS A;  4TV1 A;  2QGT A;  2GIU A;  1RKH A;  4R2U A;  2O4R A;  3GWX A;  3GYT A;  4X1G A;  2Q7J A;  2I0J A;  2AA7 A;  1DKF B;  3M7R A;  3N00 A;  3D90 A;  4K6I A;  1QKU A;  1UHL A;  4OJ4 A;  3MNO A;  3OKI A;  5DRJ A;  3UUA B;  3H0A D;  3O1E A;  2P7G A;  3OMP A;  1E3K A;  3V4A A;  3QT0 A;  3VRT A;  3RLJ A;  2G0H A;  3R8D A;  4A4W A;  3G0W A;  4E4Q A;  2AX8 A;  3BQD A;  3AUQ A;  3K23 A;  3R5M A;  4FHH A;  4MDD A;  4RUO X;  3RUT A;  1ZDT A;  5DUG A;  3A9E A;  2ZK0 A;  5HYR A;  3W5R A;  2H79 A;  4XHD A;  3ADU A;  3R2A A;  4M8E A;  3R8A A;  4OKT A;  3D24 A;  4OKW A;  4ZJR A;  2BJ4 B;  5G44 A;  3SP6 A;  4OJ9 A;  4P6W A;  4QJR A;  1ZUC A;  5AWJ A;  2B50 A;  5AZV A;  4RAK A;  5DI7 A;  5DYD A;  3ADT A;  4G2I A;  5KCE A;  5EHJ A;  3UUD A;  4IW6 A;  4XAO A;  2REW A;  4S0S A;  5DXE A;  5L7E A;  2YLY A;  5LGA A;  3VRV A;  1XP9 A;  4OKB A;  5E7V A;  1NRL A;  3OKH A;  4G2H A;  4JYH A;  5HYK A;  1OT7 A;  2JJ3 A;  3IPU A;  4F9M A;  4IA2 A;  3WMH A;  4IA1 A;  1PZL A;  5JI0 D;  5KRH A;  1XB7 A;  3HQ5 A;  3L0L A;  2OVH A;  2AA5 A;  1E3G A;  2VV1 A;  2YLP A;  4XUH A;  5KYA A;  4Y29 A;  4XUM A;  1PRG A;  2BJ4 A;  5G5W A;  1LV2 A;  1XVP A;  2JFA A;  2P7Z A;  3WFF A;  3L0J A;  1FM9 A;  3FS1 A;  3OOF A;  4LTW A;  3V9T A;  4OK1 A;  1I38 A;  3A2H A;  1QKT A;  5KCF A;  2ZMH A;  2V0V A;  3HLV A;  1FBY A;  1PQ9 A;  1T5Z A;  2R40 A;  1P93 A;  3KMG A;  4LBD A;  2QH6 A;  4MG5 A;  5DXK A;  3UVV A;  4EMA A;  3OSW A;  4ITF A;  5GIC A;  3A2I A;  2H77 A;  1FM9 D;  1Y9R A;  1YP0 A;  3DR1 A;  5DXB B;  3WT6 A;  1X78 A;  2HAM A;  4ZNW A;  1GS4 A;  1FCY A;  2AXA A;  2QW4 A;  4IW8 A;  2I0G A;  5EIT A;  5AYG A;  4YNK A;  2AX7 A;  5KCW A;  4LSJ A;  3VT4 A;  2R6Y A;  2AA2 A;  4RMD A;  5GIE A;  3F5C B;  2J14 A;  5DWI A;  3VRU A;  1YMT A;  3FC6 B;  3LMP A;  1XZX X;  3IPQ A;  5H1E A;  4FNE A;  4MGB B;  5DMF A;  1XNN A;  4RZE A;  5DX3 B;  4XLD A;  1T74 A;  5DL4 A;  3HC6 A;  4N1Y A;  5APH A;  3WWR A;  1SQN A;  2QTU A;  2HFP A;  3DY6 A; 
#chains in the Genus database with same CATH homology
 5DXB A;  2ZLC A;  3FLI A;  3G8I A;  1N46 A;  3ERD A;  1NQ1 A;  2AX9 A;  3ADW A;  3W5Q A;  2ZL9 A;  5C4T A;  1SKX A;  5DZ3 A;  5DZ0 A;  4UDD A;  2YHD A;  2Q60 A;  5ETH A;  2O9I A;  2P1T A;  4UDA A;  1S0X A;  2J4A A;  4PXM A;  4A2J A;  1NUO A;  2ZAS A;  2Q6S A;  5DLR A;  3D57 A;  5KRM A;  4OFU A;  4LNW A;  4IWC A;  1T76 A;  2VV2 A;  3UP0 A;  1EXA A;  3CWD A;  5ACC A;  5DX3 A;  5DTV A;  4ZO1 X;  2Q5P A;  2QA6 A;  3FXV A;  3VRW A;  3X1I A;  3VJI A;  5HCV A;  5AAV B;  2GPV A;  4DMA A;  3VTD A;  3PO9 A;  4OJB A;  5G46 A;  3OGT A;  1FM6 D;  3DT3 A;  4B7W A;  4IA3 A;  2F4B A;  1G1U A;  1K4W A;  1T7T A;  3PBA A;  3OS8 C;  4OZR E;  5FQV A;  1Q4X A;  4OED A;  1YYE A;  3GYU A;  1TXI A;  4FHI A;  5DXM A;  1GWX A;  5DY8 A;  1ERR A;  2G44 A;  3ET1 A;  4JAZ A;  4QM0 A;  2QA8 B;  3CDS A;  2POG A;  3VI8 A;  3OOK A;  2YLQ A;  5DP0 A;  1XP1 A;  3ET2 A;  3KDU A;  4ZNV A;  2Q8S A;  4PPP A;  1XDK A;  3HVL A;  3E00 A;  1UOM A;  3B65 A;  2AB2 A;  4OGH A;  5L7H A;  4RWV A;  3P0U A;  2XYX A;  2QNV A;  2GPP A;  5AAV A;  4J5X C;  4OHA A;  5HJP B;  3DZU A;  3P8X A;  3K6P A;  4DM6 A;  5AK2 A;  1T7F A;  2Q1V A;  3VSO A;  5APJ A;  1MVC A;  2ZNO A;  3H52 A;  4MG7 A;  4MG9 B;  1N4H A;  4E2J A;  5KR9 A;  3ZRB A;  5E1C A;  3UU7 A;  3E00 D;  2P1U A;  3NOA A;  5IZ0 A;  3ZR7 A;  4PLE A;  4PP6 A;  1LBD A;  4MG8 B;  5KCU A;  4PLD A;  5DWG A;  2ZK2 A;  3R8I A;  3CQV A;  5KD9 A;  4OIU A;  4ZO1 B;  2Q5S A;  4CSJ A;  3BEJ A;  1FCX A;  4E4K A;  4K7A A;  4DK7 A;  3D5F A;  5CJ6 A;  5DKB A;  1GWR A;  2G0G A;  4KZJ A;  4S0T A;  1NAX A;  1BSX A;  1MZN A;  2Q70 A;  5DZH A;  3VJT A;  3KBA A;  4OH6 A;  5DRM A;  5G45 A;  3ET3 A;  5DXQ A;  3W0A A;  4POH A;  3WJ5 A;  5JJM B;  3L3X A;  4PPS A;  3VHU A;  5DXR A;  3ZRA A;  5FQP A;  3OMM A;  5HJS A;  2ABI A;  1ZEO A;  3G8O A;  4LNX A;  2XYJ A;  3GD2 A;  1HJ1 A;  5E0X A;  3AZ3 A;  2ZXM A;  2VSR A;  3HC5 A;  5FQS A;  5DVC A;  2J7Y A;  4OAR A;  4UDB A;  2ZMJ A;  3HZF A;  1KNU A;  2PIU A;  2NV7 A;  1DKF A;  2PIQ A;  4FN9 A;  3V3Q A;  2Z4B A;  1U3Q A;  4IV4 A;  5F9B A;  3W5P A;  3VT6 A;  2HWR A;  1U9E A;  3B66 A;  2VV4 B;  4UDC A;  3UUA A;  5HZC A;  3GWS X;  3RVF A;  4J5W C;  1X7E A;  1Y0X X;  2Q7L A;  3V9V A;  1T73 A;  5IXK A;  1ZGY A;  4RFW A;  2HBH A;  5DUH A;  4Q13 A;  1ILG A;  3OMO A;  1T7R A;  1G50 A;  2OCF A;  2ZK1 A;  3GZ9 A;  2B1Z A;  3SZ1 A;  3HO0 A;  3UP3 A;  2NW4 A;  2YJA B;  4MG6 A;  4TUZ B;  5DWE A;  4S14 A;  2V7C A;  3VHV A;  5E14 A;  4IS8 A;  3KMZ A;  3RLL A;  3FAL B;  4N5G A;  1YOK A;  4N73 A;  1PK5 A;  3VN2 A;  1RJK A;  5KYJ A;  5C4O A;  1UPW A;  5ICK A;  2HAR A;  5B41 A;  5DIG A;  4OEZ A;  3OLF A;  4G20 A;  1YIN A;  1X76 A;  3A78 A;  3FUR A;  4WHG A;  3VSP A;  3V3E A;  1T65 A;  3NSP A;  4ZNH A;  1OSV A;  3LBD A;  2AMB A;  1XOW A;  3W5T A;  3PLZ A;  5KRK A;  4IQR A;  3V9Y A;  1A28 A;  4WPF A;  4PRG A;  3WFG A;  3OS8 A;  1ZDU A;  2PIR A;  2VV0 A;  2R40 D;  2P4Y A;  3OLS A;  2PKL A;  4JYI A;  4KZI A;  1I7I A;  4OEA A;  4MGC A;  3B5R A;  4PVU A;  5KRC A;  4ZOM A;  3KMR A;  4G1D A;  3IA6 A;  5A86 A;  5G3J A;  3VT5 A;  5AVI A;  2B23 A;  1IE8 A;  2GP7 A;  4RUP A;  4WVD A;  3E7C A;  4J5X A;  2ZVT A;  1RDT A;  1ZH7 A;  2A3I A;  3CS6 A;  3IXP A;  4IVY A;  3ZQT A;  3CS8 A;  3SP9 A;  1S9Q A;  1PQC A;  4HEE X;  4X1F A;  5DMC A;  1K74 A;  1A52 A;  4OIV A;  1QKM A;  5JY3 A;  2POB A;  1Y0S A;  3B68 A;  4WQP A;  2YFE A;  2ZK3 A;  3B0Q A;  1R20 A;  5DUE A;  5EGV A;  5FQT A;  1YUC A;  2Z4J A;  1G2N A;  4RUJ A;  1MV9 A;  3IXP D;  4G1Y A;  5FQR A;  3F5C A;  1X7R A;  4MGA B;  5DWJ A;  3RUU A;  2NXX E;  3FC6 A;  1P8D A;  4MGB A;  4OH5 A;  4Q50 A;  1DB1 A;  2XHS A;  4ZNT A;  1G5Y A;  3OSA A;  3VT7 A;  1EXX A;  3E94 A;  3BC5 A;  4IV2 A;  3AFR A;  1R1K A;  2OUZ A;  3ILZ A;  2PIO A;  2HB7 A;  2VST A;  2I4J A;  2QXM A;  3IPS A;  2BAW A;  2AMA A;  3K8S A;  4NQA B;  4HLW A;  3B67 A;  1XQ3 A;  1R6G A;  3AN3 A;  3AUR A;  5DZI A;  3TKM A;  2ACL B;  1TFC A;  1YY4 A;  2Q7I A;  3L03 A;  3KFC A;  4OZR U;  2QXS A;  2FAI A;  1R5K A;  1T79 A;  4WLB A;  3W0Y A;  2NPA A;  2HC4 A;  1PCG A;  2IHQ A;  3B0W A;  2AAX A;  2PNU A;  1NQ0 A;  3HOD A;  3MNP A;  1RKG A;  5GT4 A;  5C4U A;  2HVC A;  4J5W A;  2Q59 B;  3DZY A;  3WJ4 A;  2QGW A;  1WM0 X;  4PP5 A;  4DK8 A;  2IOG A;  3D6D A;  2PIX A;  4IU7 A;  5G42 A;  4OEY A;  2ZNN A;  2AYR A;  1XLS E;  1XV9 B;  2OVM A;  3A2J A;  5KRF A;  1XJ7 A;  2YLO A;  4IA7 A;  1M7W A;  4OZT E;  5KCD A;  2ACL A;  4TV1 B;  1UPV A;  3IMY A;  5G43 A;  1Z5X E;  1YOW A;  4K4J A;  2YAT A;  2Q6R A;  4J26 A;  2QA8 A;  2ZMI A;  3DZU D;  5KCT A;  2QR9 A;  3PCU A;  1VJB A;  4RME A;  4YPQ A;  1UHL B;  4ZN7 A;  2GPO A;  1NHZ A;  5SYZ A;  3FEJ A;  3R29 A;  4KZM A;  3CDP A;  4M8H A;  1PDU A;  1T63 A;  2Q59 A;  3KYT A;  2ZFX A;  5DVV A;  2GTK A;  2QZO B;  3GN8 A;  4Q0A C;  3ERT A;  5HJP A;  4MGD B;  4ZNU A;  4OKX A;  1X7B A;  3OLL A;  1XV9 A;  5B5B A;  4EM9 A;  3CJW A;  4MG9 A;  2B1V A;  3VT9 A;  4IUI A;  1ILH A;  1U3S A;  1ZKY A;  3V49 A;  4REF A;  4MG8 A;  4G21 A;  1L2J A;  4PWL A;  1OVL B;  1X7J A;  2OAX A;  1XNX A;  3UUD B;  5DKS A;  2ZLA A;  3X31 A;  3CTB A;  4G1Z A;  4L96 A;  5DKG A;  1U3R A;  2NXX A;  2Q1H A;  1SJ0 A;  2P1V A;  2XYW A;  4YT1 A;  4BCR A;  5AZT A;  3VTC A;  1I7G A;  2AA6 A;  2AWH A;  2PIW A;  5APK A;  2GWX A;  2QZO A;  3B0R A;  2ZXZ A;  1ERE A;  4MGD A;  4R06 A;  1K7L A;  1YJE A;  2AM9 A;  5EJV A;  2GL8 A;  5JJM A;  2AO6 A;  2VV1 B;  1IE9 A;  3FEI A;  5AVL A;  4L98 A;  3HM1 A;  4IVW A;  4R6S A;  5DXP A;  1XVP B;  3PRG A;  2JFA B;  1PQ6 A;  2O4J A;  5DID A;  3WT7 A;  3VT8 A;  1OVL A;  2Q6J A;  3VTB A;  3OAP A;  2VV4 A;  2ZK4 A;  2OZ7 A;  2PIV A;  1NYX A;  3X36 A;  4O8F A;  2ZNP A;  4P6X A;  4DQM A;  5DU5 A;  3UVV B;  5IAW A;  2Q7K A;  1XP6 A;  2ZBS A;  3U9Q A;  2ZK5 A;  2ZK6 A;  2ZNQ A;  1H9U A;  5DIE A;  2J7X A;  3T03 A;  1YIM A;  4ZN9 A;  1NAV A;  4QE8 A;  2ZKC A;  1XLS A;  3DCT A;  5DV8 A;  4TUZ A;  3F7D A;  3RY9 A;  1XIU A;  3WT5 A;  5L7G A;  4WHF A;  3FAL A;  3TY0 A;  2W8Y A;  1FCZ A;  2LBD A;  4NY9 A;  4QK4 A;  1XAP A;  5M96 A;  1S19 A;  5E15 A;  5I4V A;  1ZAF A;  1XQC A;  3AN4 A;  4PP3 A;  1NDE A;  4ZJW A;  2PIT A;  5DK9 A;  3VT3 A;  4RZF A;  5DYB A;  3CS4 A;  2QAB A;  4IWF A;  3P89 A;  3R5N A;  4RMC A;  3KDT A;  3X1H A;  2P7A A;  3WGP A;  2I4Z A;  4XI3 A;  3P88 A;  4NUF A;  4DOR A;  3W0H A;  2JF9 A;  1KV6 A;  5E19 A;  1XPC A;  3DCU A;  3KPZ A;  5LWP A;  3TX7 B;  1NQ2 A;  1NQ7 A;  3KWY A;  4NB6 A;  4PF3 A;  5KRA A;  1OSH A;  1SR7 A;  4J24 A;  5KRO A;  1GWQ A;  4NIE A;  5E0W A;  1M13 A;  2IOK A;  3B0T A;  2HAS A;  3OSI A;  1KKQ A;  2EWP A;  4S15 A;  4CI4 A;  2PIP L;  1RDT D;  2VV3 A;  3AZ2 A;  5K13 A;  1YA3 A;  3K22 A;  4XTA A;  4JGV A;  1K74 D;  4N8R A;  4REE A;  3CLD A;  3G9E A;  5DVS A;  1I37 A;  1N83 A;  2I4P A;  2XKW A;  3W0J A;  1S9P A;  2ZY0 A;  1R20 D;  4OLM A;  3EYB A;  3ADS A;  2FSZ A;  4APU A;  1QKN A;  5C4S A;  5DWL A;  3W0G A;  3W0C A;  1HG4 A;  3JZC A;  3O1D A;  4ONI A;  4JYG A;  3OZJ A;  1S0Z A;  3FUG A;  3L1B A;  3OS9 A;  4RZG A;  4ZI1 A;  3L0E A;  2PIN A;  1R1K D;  4XT9 A;  5DZ1 A;  1T7M A;  2HCD A;  4RE8 A;  1FM6 A;  2Q3Y A;  2QPY A;  3PEQ A;  4MGA A;  3B1M A;  3W0I A;  1XDK B;  3Q95 B;  3NSQ A;  2PRG A;  4JL4 A;  3VJH A;  5KRJ A;  5GID A;  5DV6 A;  5DKE A;  4QL8 A;  2QSE A;  2AX6 A;  2GPU A;  5L11 A;  2QMV A;  3OZ0 A;  2QE4 A;  2Q61 A;  4ITE A;  2HWQ A;  5AWK A;  2P54 A;  3L3Z A;  5KCC A;  2HB8 A;  4MG7 B;  4OC7 A;  4ZNS A;  2Q5G A;  3JZB A;  3S9S A;  3B3K A;  5EI1 A;  3UU7 B;  5AAU A;  3ET0 A;  3DZY D;  5EC9 A;  2FVJ A;  2OM9 A;  2P15 A;  3AUN A;  3ADV A;  3MNE A;  2E2R A;  5KRL A;  3UUC A;  4OZT U;  3GBK A;  3AX8 A;  2YJD A;  3ADX A;  3TKC A;  3VHW A;  3A40 X;  1Z5X U;  4QE6 A;  3WTQ A;  4OFR A;  4A4V A;  5KRI A;  5DXG A;  1Z95 A;  2ATH A;  2PJL A;  3Q95 A;  2ZXN A;  1M2Z A;  4FGY A;  4CI5 A;  3OMQ A;  5DSH A;  2G5O A;  4YMQ A;  4DM8 A;  3OMK A;  4OIL A;  1RK3 A;  1L2I A;  2R6W A;  3A9E B;  4DOS A;  1FD0 A;  3AZ1 A;  5DV3 A;  3A3Z X;  3H0A A;  4POJ A;  3VJS A;  4TV1 A;  2QGT A;  2GIU A;  1RKH A;  4R2U A;  2O4R A;  3GWX A;  3GYT A;  4X1G A;  2Q7J A;  2I0J A;  2AA7 A;  1DKF B;  3M7R A;  3N00 A;  3D90 A;  4K6I A;  1QKU A;  1UHL A;  4OJ4 A;  3MNO A;  3OKI A;  5DRJ A;  3UUA B;  3H0A D;  3O1E A;  2P7G A;  3OMP A;  1E3K A;  3V4A A;  3QT0 A;  3VRT A;  3RLJ A;  2G0H A;  3R8D A;  4A4W A;  3G0W A;  4E4Q A;  2AX8 A;  3BQD A;  3AUQ A;  3K23 A;  3R5M A;  4FHH A;  4MDD A;  4RUO X;  3RUT A;  1ZDT A;  5DUG A;  3A9E A;  2ZK0 A;  5HYR A;  3W5R A;  2H79 A;  4XHD A;  3ADU A;  3R2A A;  4M8E A;  3R8A A;  4OKT A;  3D24 A;  4OKW A;  4ZJR A;  2BJ4 B;  5G44 A;  3SP6 A;  4OJ9 A;  4P6W A;  4QJR A;  1ZUC A;  5AWJ A;  2B50 A;  5AZV A;  4RAK A;  5DI7 A;  5DYD A;  3ADT A;  4G2I A;  5KCE A;  5EHJ A;  3UUD A;  4IW6 A;  4XAO A;  2REW A;  4S0S A;  5DXE A;  5L7E A;  2YLY A;  5LGA A;  3VRV A;  1XP9 A;  4OKB A;  5E7V A;  1NRL A;  3OKH A;  4G2H A;  4JYH A;  5HYK A;  1OT7 A;  2JJ3 A;  3IPU A;  4F9M A;  4IA2 A;  3WMH A;  4IA1 A;  1PZL A;  5JI0 D;  5KRH A;  1XB7 A;  3HQ5 A;  3L0L A;  2OVH A;  2AA5 A;  1E3G A;  2VV1 A;  2YLP A;  4XUH A;  5KYA A;  4Y29 A;  4XUM A;  1PRG A;  2BJ4 A;  5G5W A;  1LV2 A;  1XVP A;  2JFA A;  2P7Z A;  3WFF A;  3L0J A;  1FM9 A;  3FS1 A;  3OOF A;  4LTW A;  3V9T A;  4OK1 A;  1I38 A;  3A2H A;  1QKT A;  5KCF A;  2ZMH A;  2V0V A;  3HLV A;  1FBY A;  1PQ9 A;  1T5Z A;  2R40 A;  1P93 A;  3KMG A;  4LBD A;  2QH6 A;  4MG5 A;  5DXK A;  3UVV A;  4EMA A;  3OSW A;  4ITF A;  5GIC A;  3A2I A;  2H77 A;  1FM9 D;  1Y9R A;  1YP0 A;  3DR1 A;  5DXB B;  3WT6 A;  1X78 A;  2HAM A;  4ZNW A;  1GS4 A;  1FCY A;  2AXA A;  2QW4 A;  4IW8 A;  2I0G A;  5EIT A;  5AYG A;  4YNK A;  2AX7 A;  5KCW A;  4LSJ A;  3VT4 A;  2R6Y A;  2AA2 A;  4RMD A;  5GIE A;  3F5C B;  2J14 A;  5DWI A;  3VRU A;  1YMT A;  3FC6 B;  3LMP A;  1XZX X;  3IPQ A;  5H1E A;  4FNE A;  4MGB B;  5DMF A;  1XNN A;  4RZE A;  5DX3 B;  4XLD A;  1T74 A;  5DL4 A;  3HC6 A;  4N1Y A;  5APH A;  3WWR A;  1SQN A;  2QTU A;  2HFP A;  3DY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...