2G44A

Human estrogen receptor alpha ligand-binding domain in complex with obcp-1m-g and a glucocorticoid receptor interacting protein 1 nr box ii peptide
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
244
structure length
234
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLEAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery and characterization of novel estrogen receptor agonist ligands and development of biochips for nuclear receptor drug discovery
rcsb
molecule keywords Estrogen receptor
molecule tags Hormone/growth factor receptor
source organism Homo sapiens
total genus 83
structure length 234
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2g44A00
4MG6A 3W0YA 2P1UA 1PQ6A 4IA1A 4ZJWA 4IWCA 3B1MA 2XYWA 1XLSE 2GP7A 1P8DA 3F5CB 2REWA 1ZDTA 3MNPA 2P4YA 4XTAA 5EI1A 3HLVA 4OZTE 5DXQA 2ZXNA 5HYKA 2Z4JA 1G5YA 3ET1A 4M8HA 2QR9A 4MGDB 4MGAA 5GT4A 2Q8SA 4M8EA 2HAMA 3CLDA 1K7LA 4REEA 4DK7A 2Q7KA 3ET2A 5E15A 2GL8A 3WTQA 5DTVA 3VT6A 1U3RA 1XQ3A 1T5ZA 4MDDA 1G50A 5AAUA 5KRMA 2PIRA 2R6WA 3HC6A 1X78A 3KPZA 5B5BA 2AAXA 3UUAA 1U9EA 3V4AA 1RDTD 3R5MA 1XPCA 4PWLA 3AUQA 4K4JA 4ZI1A 5I4VA 4WHGA 2ZNQA 2QMVA 3MNOA 1X7RA 4RUOX 4G1YA 4CI5A 1XP9A 3OZ0A 1NDEA 5DXBB 3GWXA 4IV2A 4MGCA 4S14A 1I7IA 2Q59A 5ICKA 3D24A 5DU5A 4BCRA 5DI7A 2Q61A 4FHHA 4MG8B 3UU7B 3Q95B 3JZCA 2ZK4A 3W0GA 3OGTA 3OLSA 4RUPA 4TV1B 2ZVTA 5KCUA 4APUA 4B7WA 5L7EA 3L1BA 1NQ7A 1T73A 3D5FA 3OKIA 2VV1A 4OJ9A 5DIGA 2AB2A 4EM9A 1EXXA 3K8SA 5DMCA 3V9YA 4Q50A 3RY9A 5APHA 3VRVA 3X1IA 5FQRA 2QNVA 2V0VA 1NRLA 5HJPB 2ZKCA 3FC6A 4OFUA 2R40D 2ZBSA 2XYXA 3B0QA 5E1CA 3KFCA 3PCUA 3X31A 1XAPA 1TXIA 3ADVA 3D6DA 4J26A 5JI0D 5DXRA 2GPVA 2OZ7A 2ATHA 3V3EA 3TX7B 2ZASA 1YP0A 5DIDA 2QW4A 1SKXA 4RMDA 2VV3A 5KRCA 1OSVA 4QE8A 1MZNA 3OS9A 4ZNUA 1X7BA 2Q5SA 1GWXA 1T74A 2YATA 1I7GA 2PINA 5KCTA 3P88A 1NYXA 5APKA 3VSOA 2Q7LA 4LNXA 4RZFA 3AUNA 3NSPA 3PRGA 4XI3A 4XUHA 2R6YA 3UVVA 1XNXA 1Z95A 3HQ5A 3A3ZX 2QXMA 4A4WA 4A4VA 1K74D 3D57A 1Q4XA 4KZIA 2YHDA 4R06A 3UP0A 3ERTA 4Q13A 1LBDA 3SP6A 2AO6A 2I4PA 2YJAB 4ZN7A 3FS1A 3V9VA 1FM9A 4WVDA 5AVLA 3CDSA 3ADSA 2GIUA 1T7TA 2QH6A 3LBDA 1YUCA 4MGBA 1Y0XX 2JF9A 4OZTU 4REFA 5EC9A 2VSTA 3A9EB 2ZK0A 4YPQA 5IAWA 2NXXE 3OS8A 1QKMA 2HC4A 3QT0A 3TKMA 2ZNOA 5JJMB 3E7CA 4KZMA 3G8IA 1FCZA 1K4WA 2PIPL 5G45A 1R20D 1VJBA 2AX6A 4N8RA 3W0JA 4PP3A 3B65A 5AZTA 1DKFB 2B23A 3GZ9A 3HODA 5KCWA 2QA8A 1TFCA 5HZCA 3R8IA 3WFFA 1A52A 4XLDA 2B1VA 2J7YA 1XDKA 3KDTA 4NIEA 3WT7A 1X76A 3R8AA 3AZ1A 4DK8A 3VJSA 5DWEA 4MG9B 3LMPA 4OARA 5LWPA 3VT7A 3G0WA 1IE9A 2XYJA 3FALB 3OOFA 4WQPA 5AAVB 2FSZA 3AN3A 3A2HA 5DRMA 4CI4A 2BAWA 1NQ1A 2PIOA 2Q6JA 5KRJA 4ZNVA 3DCUA 1RKHA 1EXAA 1ERRA 3A40X 3O1DA 3OMMA 2PNUA 3AURA 1UHLA 4XAOA 5DUHA 2ACLB 3WGPA 1YMTA 3ZRAA 4DOSA 5C4OA 2JFAB 2ZNPA 4OHAA 2GPPA 4PPPA 2QZOB 4F9MA 1T76A 3WFGA 3E94A 2NV7A 3UUDB 3VT8A 2AA2A 1R1KD 3H52A 3K23A 4RMCA 1RKGA 2PKLA 2AXAA 5L7HA 1FD0A 2OM9A 1QKUA 5G3JA 2G5OA 4ZNHA 5GIDA 1KV6A 4NUFA 2P7AA 2P15A 1FCXA 5FQSA 1T65A 4S0SA 1XJ7A 4WLBA 3PBAA 2IHQA 4J5XA 4N5GA 4OK1A 4YNKA 3F5CA 4IVWA 1RDTA 3UUCA 3AFRA 4TUZA 5EJVA 3VT3A 4MGDA 4DQMA 3P0UA 2PIQA 3DZYA 4WHFA 2H79A 3D90A 2GPOA 5AK2A 3WMHA 5DP0A 5KR9A 5DZHA 4Q0AC 2FAIA 2NW4A 1FM6A 4JGVA 3K6PA 4IA7A 3DCTA 5DY8A 3OLFA 3W5PA 3AN4A 4ITFA 5ACCA 2NXXA 1EREA 3GYUA 4OJ4A 1I38A 3R5NA 5SYZA 2ZNNA 2PIWA 3H0AD 1UOMA 5HYRA 1PRGA 3EYBA 2QE4A 4LTWA 5KRLA 3DZYD 3W0AA 2Z4BA 3CTBA 1M7WA 1Y0SA 4EMAA 1FM6D 4XT9A 4IW8A 4ZO1X 2YFEA 1X7JA 4IV4A 5FQTA 1LV2A 3BC5A 2J14A 3IMYA 4RWVA 2W8YA 3R29A 5DWGA 1XIUA 5DWLA 2I4ZA 5ETHA 4G20A 3W0HA 5DXBA 2Q6SA 2AMAA 5KROA 3OSIA 3VT5A 3E00D 5E19A 4Y29A 2VV4A 3RVFA 4JYIA 2R40A 1E3GA 4OH6A 3MNEA 2HASA 2HB7A 1SQNA 2FVJA 3B0TA 3JZBA 4R2UA 1Z5XE 3Q95A 5DKEA 5AVIA 3VHWA 2HB8A 2ZK6A 2Q59B 4TV1A 3VJHA 1XB7A 1PQCA 5L11A 4OIVA 3V3QA 2H77A 4E4KA 5FQPA 1S0ZA 3A78A 4NB6A 3VTBA 3VI8A 4DM6A 4S0TA 2AX8A 2VV1B 3NSQA 3UP3A 1YY4A 3OMOA 3L3XA 1ZDUA 2O9IA 3HZFA 4POJA 1PDUA 4RMEA 2GWXA 4NY9A 4ONIA 4OZRU 4WPFA 2YLPA 3ADXA 3DZUD 2HWRA 1K74A 3FC6B 1HG4A 1XLSA 3WT6A 4DMAA 4RAKA 2GTKA 4ITEA 3OSAA 4MG7A 4HEEX 5GIEA 1PK5A 1QKNA 5EGVA 1N83A 4G21A 2OUZA 5AWJA 3VRUA 1NAVA 3VHUA 1PZLA 2I0GA 2POBA 2YLOA 5DSHA 2QSEA 4PPSA 5DUEA 4N73A 1T7RA 2NPAA 4OGHA 1N46A 3BQDA 5KRIA 4XHDA 1XOWA 3VRWA 4ZNTA 3IXPD 5DXPA 2ZLAA 1MV9A 1H9UA 2A3IA 5AWKA 4ZNSA 1S0XA 4X1FA 5KCDA 2QTUA 3CWDA 3VN2A 4QM0A 1R20A 5L7GA 4G2IA 4J5WA 2XHSA 3KBAA 3UVVB 5G43A 3OOKA 4ZNWA 3OS8C 5E0WA 5HJSA 1FBYA 2JJ3A 1FCYA 4POHA 2O4RA 3OLLA 1NAXA 5DXEA 2PJLA 2POGA 3ET3A 4FNEA 1QKTA 2EWPA 4ZO1B 5DX3A 4ZJRA 1NQ0A 1S9PA 1XV9A 1DB1A 4FHIA 3KYTA 5DZ0A 3W0CA 4OFRA 3G9EA 5DVCA 2J7XA 3GBKA 1XZXX 3L3ZA 5F9BA 3B0RA 1OVLA 3CQVA 1ZH7A 1U3QA 4RZGA 3V49A 2AA6A 4PF3A 3HO0A 2QA8B 2J4AA 1M2ZA 3ZR7A 1R1KA 5K13A 4MG9A 1XDKB 5DYDA 5DZIA 5A86A 2ABIA 2AMBA 2ZK2A 4P6XA 4YMQA 5AAVA 3AZ2A 3X1HA 1XVPA 3FLIA 3OMKA 5DLRA 3NOAA 5E0XA 2GPUA 5AYGA 2I0JA 2OAXA 3PO9A 1T7FA 3CDPA 3HM1A 4RFWA 2BJ4A 3OZJA 5KCEA 4IA3A 4QK4A 4QE6A 4OLMA 5E7VA 3G8OA 1ILGA 5JY3A 2JFAA 2OVMA 4LBDA 4PP5A 1NQ2A 5CJ6A 5G5WA 2Q5GA 3V9TA 1YJEA 1ZGYA 3IPSA 5KRKA 3GYTA 1YIMA 4UDCA 3VSPA 1P93A 2QABA 1YINA 3BEJA 4J5XC 5EITA 3DR1A 4E4QA 1GS4A 1M13A 3RUTA 3ADTA 3R2AA 2AA5A 2HCDA 3ADUA 3CS6A 4IS8A 1S9QA 1WM0X 4OIUA 4OEYA 1X7EA 4JYHA 1MVCA 3WWRA 3WT5A 4K6IA 3H0AA 5DIEA 2PITA 3GWSX 1G1UA 3CJWA 4IU7A 4X1GA 4XUMA 5C4SA 3VHVA 3VJTA 1U3SA 2ZMIA 1ILHA 5G44A 4MGAB 4IUIA 1XNNA 2HFPA 2AYRA 3VTDA 1SJ0A 2Q1VA 1ZAFA 3FXVA 1PCGA 4PLDA 4TUZB 1N4HA 2F4BA 5EHJA 5KCFA 3FURA 3OKHA 3CS8A 2QA6A 5DZ3A 1T79A 4OKBA 3DT3A 5G46A 3E00A 5DWJA 1ZEOA 2LBDA 2HWQA 4RE8A 2XKWA 5DXKA 5KYJA 2Q3YA 3UUAB 5DK9A 4IWFA 4YT1A 1IE8A 5APJA 4J24A 1R5KA 4O8FA 2Q5PA 3A2JA 2ZLCA 2QXSA 4UDBA 2VSRA 5DV8A 3IPUA 1XP6A 4RUJA 4JAZA 4S15A 1E3KA 4MG8A 3UU7A 5H1EA 1ZUCA 2PIVA 3P89A 4IW6A 4IA2A 1NHZA 4OEZA 3F7DA 2HBHA 3ZRBA 2Q6RA 4IQRA 1Y9RA 3ILZA 2QPYA 5DVSA 1YYEA 3DZUA 3DY6A 2ZK5A 2I4JA 3X36A 2Q60A 4OILA 1OSHA 5KRFA 1I37A 3RLLA 2VV4B 2HVCA 1L2IA 2G0HA 4G1ZA 3U9QA 5KD9A 5KYAA 5DKSA 4QJRA 5DRJA 5DUGA 2ZY0A 2IOGA 2Q7IA 4HLWA 5DV6A 3TY0A 5HJPA 2AWHA 3L0LA 2YLYA 4ZN9A 1L2JA 1KNUA 3ERDA 4A2JA 3HC5A 3W5RA 1HJ1A 2ZXMA 3IXPA 2ZK3A 5HCVA 4MG5A 1RJKA 1NUOA 3W5TA 3VTCA 5IXKA 3KMZA 5DKGA 4RZEA 3T03A 3KMRA 4OKTA 3L0JA 5DWIA 4DORA 2ZMJA 3AZ3A 3B68A 3ET0A 1RK3A 3P8XA 2ZMHA 1YOWA 3L0EA 4L98A 2ZFXA 3B5RA 4IVYA 4LNWA 1BSXA 1ZKYA 2P1VA 3AX8A 4MG7B 4FGYA 4UDAA 2YJDA 4UDDA 5C4TA 3CS4A 2YLQA 3FUGA 2AX7A 4L96A 1G2NA 4J5WC 3L03A 3HVLA 4OC7A 5G42A 4PRGA 2O4JA 2PIXA 5FQVA 5DL4A 2P7ZA 2OVHA 3WJ4A 3GD2A 1KKQA 4N1YA 2B1ZA 5DMFA 3SP9A 4PLEA 4G2HA 4G1DA 4DM8A 2P7GA 3PEQA 2PRGA 2Q1HA 5GICA 4NQAB 2Q70A 4PVUA 1XP1A 5DV3A 1T63A 3OMQA 2E2RA 4E2JA 3A9EA 5IZ0A 3OMPA 3S9SA 1UPVA 3IPQA 3WJ5A 3M7RA 2AM9A 4MGBB 5JJMA 1YA3A 3RUUA 2PIUA 3IA6A 4JL4A 2AA7A 3PLZA 4OJBA 4OKWA 4PXMA 4OEDA 3B66A 2OCFA 1GWRA 1R6GA 1DKFA 2ZXZA 4K7AA 5C4UA 4FN9A 5DZ1A 5DX3B 3R8DA 3O1EA 5DVVA 5KRAA 4OKXA 3VT9A 1XV9B 3SZ1A 5B41A 2QGTA 3B3KA 1T7MA 3W0IA 4LSJA 2P54A 2Q7JA 5DXMA 3TKCA 1FM9D 3N00A 3ADWA 4ZOMA 3FALA 3B67A 1S19A 4OH5A 3OSWA 3FEJA 4JYGA 5DXGA 5AZVA 3KWYA 2QGWA 4R6SA 5LGAA 4KZJA 3VRTA 1PQ9A 1OVLB 5E14A 5DYBA 2VV0A 3FEIA 2ZL9A 1GWQA 1Z5XU 2ACLA 1SR7A 4OZRE 3GN8A 2QZOA 3OAPA 4OEAA 2VV2A 1UHLB 5DKBA 3VJIA 2G44A 3UUDA 1XVPB 3K22A 4PP6A 2HARA 1YOKA 1UPWA 4QL8A 3RLJA 2BJ4B 2IOKA 3ZQTA 2ZK1A 1OT7A 4P6WA 2B50A 3A2IA 2G0GA 3B0WA 3W5QA 2AX9A 1XQCA 2V7CA 4CSJA 5KCCA 5M96A 2P1TA 3VT4A 3KDUA 3KMGA 5KRHA 1A28A
chains in the Genus database with same CATH superfamily
4MG6A 3W0YA 2P1UA 1PQ6A 4IA1A 4ZJWA 4IWCA 3B1MA 2XYWA 1XLSE 2GP7A 1P8DA 3F5CB 2REWA 1ZDTA 3MNPA 2P4YA 4XTAA 5EI1A 3HLVA 4OZTE 5DXQA 2ZXNA 5HYKA 2Z4JA 1G5YA 3ET1A 4M8HA 2QR9A 4MGDB 4MGAA 5GT4A 2Q8SA 4M8EA 2HAMA 3CLDA 1K7LA 4REEA 4DK7A 2Q7KA 3ET2A 5E15A 2GL8A 3WTQA 5DTVA 3VT6A 1U3RA 1XQ3A 1T5ZA 4MDDA 1G50A 5AAUA 5KRMA 2PIRA 2R6WA 3HC6A 1X78A 3KPZA 5B5BA 2AAXA 3UUAA 1U9EA 3V4AA 1RDTD 3R5MA 1XPCA 4PWLA 3AUQA 4K4JA 4ZI1A 5I4VA 4WHGA 2ZNQA 2QMVA 3MNOA 1X7RA 4RUOX 4G1YA 4CI5A 1XP9A 3OZ0A 1NDEA 5DXBB 3GWXA 4IV2A 4MGCA 4S14A 1I7IA 2Q59A 5ICKA 3D24A 5DU5A 4BCRA 5DI7A 2Q61A 4FHHA 4MG8B 3UU7B 3Q95B 3JZCA 2ZK4A 3W0GA 3OGTA 3OLSA 4RUPA 4TV1B 2ZVTA 5KCUA 4APUA 4B7WA 5L7EA 3L1BA 1NQ7A 1T73A 3D5FA 3OKIA 2VV1A 4OJ9A 5DIGA 2AB2A 4EM9A 1EXXA 3K8SA 5DMCA 3V9YA 4Q50A 3RY9A 5APHA 3VRVA 3X1IA 5FQRA 2QNVA 2V0VA 1NRLA 5HJPB 2ZKCA 3FC6A 4OFUA 2R40D 2ZBSA 2XYXA 3B0QA 5E1CA 3KFCA 3PCUA 3X31A 1XAPA 1TXIA 3ADVA 3D6DA 4J26A 5JI0D 5DXRA 2GPVA 2OZ7A 2ATHA 3V3EA 3TX7B 2ZASA 1YP0A 5DIDA 2QW4A 1SKXA 4RMDA 2VV3A 5KRCA 1OSVA 4QE8A 1MZNA 3OS9A 4ZNUA 1X7BA 2Q5SA 1GWXA 1T74A 2YATA 1I7GA 2PINA 5KCTA 3P88A 1NYXA 5APKA 3VSOA 2Q7LA 4LNXA 4RZFA 3AUNA 3NSPA 3PRGA 4XI3A 4XUHA 2R6YA 3UVVA 1XNXA 1Z95A 3HQ5A 3A3ZX 2QXMA 4A4WA 4A4VA 1K74D 3D57A 1Q4XA 4KZIA 2YHDA 4R06A 3UP0A 3ERTA 4Q13A 1LBDA 3SP6A 2AO6A 2I4PA 2YJAB 4ZN7A 3FS1A 3V9VA 1FM9A 4WVDA 5AVLA 3CDSA 3ADSA 2GIUA 1T7TA 2QH6A 3LBDA 1YUCA 4MGBA 1Y0XX 2JF9A 4OZTU 4REFA 5EC9A 2VSTA 3A9EB 2ZK0A 4YPQA 5IAWA 2NXXE 3OS8A 1QKMA 2HC4A 3QT0A 3TKMA 2ZNOA 5JJMB 3E7CA 4KZMA 3G8IA 1FCZA 1K4WA 2PIPL 5G45A 1R20D 1VJBA 2AX6A 4N8RA 3W0JA 4PP3A 3B65A 5AZTA 1DKFB 2B23A 3GZ9A 3HODA 5KCWA 2QA8A 1TFCA 5HZCA 3R8IA 3WFFA 1A52A 4XLDA 2B1VA 2J7YA 1XDKA 3KDTA 4NIEA 3WT7A 1X76A 3R8AA 3AZ1A 4DK8A 3VJSA 5DWEA 4MG9B 3LMPA 4OARA 5LWPA 3VT7A 3G0WA 1IE9A 2XYJA 3FALB 3OOFA 4WQPA 5AAVB 2FSZA 3AN3A 3A2HA 5DRMA 4CI4A 2BAWA 1NQ1A 2PIOA 2Q6JA 5KRJA 4ZNVA 3DCUA 1RKHA 1EXAA 1ERRA 3A40X 3O1DA 3OMMA 2PNUA 3AURA 1UHLA 4XAOA 5DUHA 2ACLB 3WGPA 1YMTA 3ZRAA 4DOSA 5C4OA 2JFAB 2ZNPA 4OHAA 2GPPA 4PPPA 2QZOB 4F9MA 1T76A 3WFGA 3E94A 2NV7A 3UUDB 3VT8A 2AA2A 1R1KD 3H52A 3K23A 4RMCA 1RKGA 2PKLA 2AXAA 5L7HA 1FD0A 2OM9A 1QKUA 5G3JA 2G5OA 4ZNHA 5GIDA 1KV6A 4NUFA 2P7AA 2P15A 1FCXA 5FQSA 1T65A 4S0SA 1XJ7A 4WLBA 3PBAA 2IHQA 4J5XA 4N5GA 4OK1A 4YNKA 3F5CA 4IVWA 1RDTA 3UUCA 3AFRA 4TUZA 5EJVA 3VT3A 4MGDA 4DQMA 3P0UA 2PIQA 3DZYA 4WHFA 2H79A 3D90A 2GPOA 5AK2A 3WMHA 5DP0A 5KR9A 5DZHA 4Q0AC 2FAIA 2NW4A 1FM6A 4JGVA 3K6PA 4IA7A 3DCTA 5DY8A 3OLFA 3W5PA 3AN4A 4ITFA 5ACCA 2NXXA 1EREA 3GYUA 4OJ4A 1I38A 3R5NA 5SYZA 2ZNNA 2PIWA 3H0AD 1UOMA 5HYRA 1PRGA 3EYBA 2QE4A 4LTWA 5KRLA 3DZYD 3W0AA 2Z4BA 3CTBA 1M7WA 1Y0SA 4EMAA 1FM6D 4XT9A 4IW8A 4ZO1X 2YFEA 1X7JA 4IV4A 5FQTA 1LV2A 3BC5A 2J14A 3IMYA 4RWVA 2W8YA 3R29A 5DWGA 1XIUA 5DWLA 2I4ZA 5ETHA 4G20A 3W0HA 5DXBA 2Q6SA 2AMAA 5KROA 3OSIA 3VT5A 3E00D 5E19A 4Y29A 2VV4A 3RVFA 4JYIA 2R40A 1E3GA 4OH6A 3MNEA 2HASA 2HB7A 1SQNA 2FVJA 3B0TA 3JZBA 4R2UA 1Z5XE 3Q95A 5DKEA 5AVIA 3VHWA 2HB8A 2ZK6A 2Q59B 4TV1A 3VJHA 1XB7A 1PQCA 5L11A 4OIVA 3V3QA 2H77A 4E4KA 5FQPA 1S0ZA 3A78A 4NB6A 3VTBA 3VI8A 4DM6A 4S0TA 2AX8A 2VV1B 3NSQA 3UP3A 1YY4A 3OMOA 3L3XA 1ZDUA 2O9IA 3HZFA 4POJA 1PDUA 4RMEA 2GWXA 4NY9A 4ONIA 4OZRU 4WPFA 2YLPA 3ADXA 3DZUD 2HWRA 1K74A 3FC6B 1HG4A 1XLSA 3WT6A 4DMAA 4RAKA 2GTKA 4ITEA 3OSAA 4MG7A 4HEEX 5GIEA 1PK5A 1QKNA 5EGVA 1N83A 4G21A 2OUZA 5AWJA 3VRUA 1NAVA 3VHUA 1PZLA 2I0GA 2POBA 2YLOA 5DSHA 2QSEA 4PPSA 5DUEA 4N73A 1T7RA 2NPAA 4OGHA 1N46A 3BQDA 5KRIA 4XHDA 1XOWA 3VRWA 4ZNTA 3IXPD 5DXPA 2ZLAA 1MV9A 1H9UA 2A3IA 5AWKA 4ZNSA 1S0XA 4X1FA 5KCDA 2QTUA 3CWDA 3VN2A 4QM0A 1R20A 5L7GA 4G2IA 4J5WA 2XHSA 3KBAA 3UVVB 5G43A 3OOKA 4ZNWA 3OS8C 5E0WA 5HJSA 1FBYA 2JJ3A 1FCYA 4POHA 2O4RA 3OLLA 1NAXA 5DXEA 2PJLA 2POGA 3ET3A 4FNEA 1QKTA 2EWPA 4ZO1B 5DX3A 4ZJRA 1NQ0A 1S9PA 1XV9A 1DB1A 4FHIA 3KYTA 5DZ0A 3W0CA 4OFRA 3G9EA 5DVCA 2J7XA 3GBKA 1XZXX 3L3ZA 5F9BA 3B0RA 1OVLA 3CQVA 1ZH7A 1U3QA 4RZGA 3V49A 2AA6A 4PF3A 3HO0A 2QA8B 2J4AA 1M2ZA 3ZR7A 1R1KA 5K13A 4MG9A 1XDKB 5DYDA 5DZIA 5A86A 2ABIA 2AMBA 2ZK2A 4P6XA 4YMQA 5AAVA 3AZ2A 3X1HA 1XVPA 3FLIA 3OMKA 5DLRA 3NOAA 5E0XA 2GPUA 5AYGA 2I0JA 2OAXA 3PO9A 1T7FA 3CDPA 3HM1A 4RFWA 2BJ4A 3OZJA 5KCEA 4IA3A 4QK4A 4QE6A 4OLMA 5E7VA 3G8OA 1ILGA 5JY3A 2JFAA 2OVMA 4LBDA 4PP5A 1NQ2A 5CJ6A 5G5WA 2Q5GA 3V9TA 1YJEA 1ZGYA 3IPSA 5KRKA 3GYTA 1YIMA 4UDCA 3VSPA 1P93A 2QABA 1YINA 3BEJA 4J5XC 5EITA 3DR1A 4E4QA 1GS4A 1M13A 3RUTA 3ADTA 3R2AA 2AA5A 2HCDA 3ADUA 3CS6A 4IS8A 1S9QA 1WM0X 4OIUA 4OEYA 1X7EA 4JYHA 1MVCA 3WWRA 3WT5A 4K6IA 3H0AA 5DIEA 2PITA 3GWSX 1G1UA 3CJWA 4IU7A 4X1GA 4XUMA 5C4SA 3VHVA 3VJTA 1U3SA 2ZMIA 1ILHA 5G44A 4MGAB 4IUIA 1XNNA 2HFPA 2AYRA 3VTDA 1SJ0A 2Q1VA 1ZAFA 3FXVA 1PCGA 4PLDA 4TUZB 1N4HA 2F4BA 5EHJA 5KCFA 3FURA 3OKHA 3CS8A 2QA6A 5DZ3A 1T79A 4OKBA 3DT3A 5G46A 3E00A 5DWJA 1ZEOA 2LBDA 2HWQA 4RE8A 2XKWA 5DXKA 5KYJA 2Q3YA 3UUAB 5DK9A 4IWFA 4YT1A 1IE8A 5APJA 4J24A 1R5KA 4O8FA 2Q5PA 3A2JA 2ZLCA 2QXSA 4UDBA 2VSRA 5DV8A 3IPUA 1XP6A 4RUJA 4JAZA 4S15A 1E3KA 4MG8A 3UU7A 5H1EA 1ZUCA 2PIVA 3P89A 4IW6A 4IA2A 1NHZA 4OEZA 3F7DA 2HBHA 3ZRBA 2Q6RA 4IQRA 1Y9RA 3ILZA 2QPYA 5DVSA 1YYEA 3DZUA 3DY6A 2ZK5A 2I4JA 3X36A 2Q60A 4OILA 1OSHA 5KRFA 1I37A 3RLLA 2VV4B 2HVCA 1L2IA 2G0HA 4G1ZA 3U9QA 5KD9A 5KYAA 5DKSA 4QJRA 5DRJA 5DUGA 2ZY0A 2IOGA 2Q7IA 4HLWA 5DV6A 3TY0A 5HJPA 2AWHA 3L0LA 2YLYA 4ZN9A 1L2JA 1KNUA 3ERDA 4A2JA 3HC5A 3W5RA 1HJ1A 2ZXMA 3IXPA 2ZK3A 5HCVA 4MG5A 1RJKA 1NUOA 3W5TA 3VTCA 5IXKA 3KMZA 5DKGA 4RZEA 3T03A 3KMRA 4OKTA 3L0JA 5DWIA 4DORA 2ZMJA 3AZ3A 3B68A 3ET0A 1RK3A 3P8XA 2ZMHA 1YOWA 3L0EA 4L98A 2ZFXA 3B5RA 4IVYA 4LNWA 1BSXA 1ZKYA 2P1VA 3AX8A 4MG7B 4FGYA 4UDAA 2YJDA 4UDDA 5C4TA 3CS4A 2YLQA 3FUGA 2AX7A 4L96A 1G2NA 4J5WC 3L03A 3HVLA 4OC7A 5G42A 4PRGA 2O4JA 2PIXA 5FQVA 5DL4A 2P7ZA 2OVHA 3WJ4A 3GD2A 1KKQA 4N1YA 2B1ZA 5DMFA 3SP9A 4PLEA 4G2HA 4G1DA 4DM8A 2P7GA 3PEQA 2PRGA 2Q1HA 5GICA 4NQAB 2Q70A 4PVUA 1XP1A 5DV3A 1T63A 3OMQA 2E2RA 4E2JA 3A9EA 5IZ0A 3OMPA 3S9SA 1UPVA 3IPQA 3WJ5A 3M7RA 2AM9A 4MGBB 5JJMA 1YA3A 3RUUA 2PIUA 3IA6A 4JL4A 2AA7A 3PLZA 4OJBA 4OKWA 4PXMA 4OEDA 3B66A 2OCFA 1GWRA 1R6GA 1DKFA 2ZXZA 4K7AA 5C4UA 4FN9A 5DZ1A 5DX3B 3R8DA 3O1EA 5DVVA 5KRAA 4OKXA 3VT9A 1XV9B 3SZ1A 5B41A 2QGTA 3B3KA 1T7MA 3W0IA 4LSJA 2P54A 2Q7JA 5DXMA 3TKCA 1FM9D 3N00A 3ADWA 4ZOMA 3FALA 3B67A 1S19A 4OH5A 3OSWA 3FEJA 4JYGA 5DXGA 5AZVA 3KWYA 2QGWA 4R6SA 5LGAA 4KZJA 3VRTA 1PQ9A 1OVLB 5E14A 5DYBA 2VV0A 3FEIA 2ZL9A 1GWQA 1Z5XU 2ACLA 1SR7A 4OZRE 3GN8A 2QZOA 3OAPA 4OEAA 2VV2A 1UHLB 5DKBA 3VJIA 2G44A 3UUDA 1XVPB 3K22A 4PP6A 2HARA 1YOKA 1UPWA 4QL8A 3RLJA 2BJ4B 2IOKA 3ZQTA 2ZK1A 1OT7A 4P6WA 2B50A 3A2IA 2G0GA 3B0WA 3W5QA 2AX9A 1XQCA 2V7CA 4CSJA 5KCCA 5M96A 2P1TA 3VT4A 3KDUA 3KMGA 5KRHA 1A28A
chains in the Genus database with same CATH topology
4MG6A 3W0YA 2P1UA 1PQ6A 4IA1A 4ZJWA 4IWCA 3B1MA 2XYWA 1XLSE 2GP7A 1P8DA 3F5CB 2REWA 1ZDTA 3MNPA 2P4YA 4XTAA 5EI1A 3HLVA 4OZTE 5DXQA 2ZXNA 5HYKA 2Z4JA 1G5YA 3ET1A 4M8HA 2QR9A 4MGDB 4MGAA 5GT4A 2Q8SA 4M8EA 2HAMA 3CLDA 1K7LA 4REEA 4DK7A 2Q7KA 3ET2A 5E15A 2GL8A 3WTQA 5DTVA 3VT6A 1U3RA 1XQ3A 1T5ZA 4MDDA 1G50A 5AAUA 5KRMA 2PIRA 2R6WA 3HC6A 1X78A 3KPZA 5B5BA 2AAXA 3UUAA 1U9EA 3V4AA 1RDTD 3R5MA 1XPCA 4PWLA 3AUQA 4K4JA 4ZI1A 5I4VA 4WHGA 2ZNQA 2QMVA 3MNOA 1X7RA 4RUOX 4G1YA 4CI5A 1XP9A 3OZ0A 1NDEA 5DXBB 3GWXA 4IV2A 4MGCA 4S14A 1I7IA 2Q59A 5ICKA 3D24A 5DU5A 4BCRA 5DI7A 2Q61A 4FHHA 4MG8B 3UU7B 3Q95B 3JZCA 2ZK4A 3W0GA 3OGTA 3OLSA 4RUPA 4TV1B 2ZVTA 5KCUA 4APUA 4B7WA 5L7EA 3L1BA 1NQ7A 1T73A 3D5FA 3OKIA 2VV1A 4OJ9A 5DIGA 2AB2A 4EM9A 1EXXA 3K8SA 5DMCA 3V9YA 4Q50A 3RY9A 5APHA 3VRVA 3X1IA 5FQRA 2QNVA 2V0VA 1NRLA 5HJPB 2ZKCA 3FC6A 4OFUA 2R40D 2ZBSA 2XYXA 3B0QA 5E1CA 3KFCA 3PCUA 3X31A 1XAPA 1TXIA 3ADVA 3D6DA 4J26A 5JI0D 5DXRA 2GPVA 2OZ7A 2ATHA 3V3EA 3TX7B 2ZASA 1YP0A 5DIDA 2QW4A 1SKXA 4RMDA 2VV3A 5KRCA 1OSVA 4QE8A 1MZNA 3OS9A 4ZNUA 1X7BA 2Q5SA 1GWXA 1T74A 2YATA 1I7GA 2PINA 5KCTA 3P88A 1NYXA 5APKA 3VSOA 2Q7LA 4LNXA 4RZFA 3AUNA 3NSPA 3PRGA 4XI3A 4XUHA 2R6YA 3UVVA 1XNXA 1Z95A 3HQ5A 3A3ZX 2QXMA 4A4WA 4A4VA 1K74D 3D57A 1Q4XA 4KZIA 2YHDA 4R06A 3UP0A 3ERTA 4Q13A 1LBDA 3SP6A 2AO6A 2I4PA 2YJAB 4ZN7A 3FS1A 3V9VA 1FM9A 4WVDA 5AVLA 3CDSA 3ADSA 2GIUA 1T7TA 2QH6A 3LBDA 1YUCA 4MGBA 1Y0XX 2JF9A 4OZTU 4REFA 5EC9A 2VSTA 3A9EB 2ZK0A 4YPQA 5IAWA 2NXXE 3OS8A 1QKMA 2HC4A 3QT0A 3TKMA 2ZNOA 5JJMB 3E7CA 4KZMA 3G8IA 1FCZA 1K4WA 2PIPL 5G45A 1R20D 1VJBA 2AX6A 4N8RA 3W0JA 4PP3A 3B65A 5AZTA 1DKFB 2B23A 3GZ9A 3HODA 5KCWA 2QA8A 1TFCA 5HZCA 3R8IA 3WFFA 1A52A 4XLDA 2B1VA 2J7YA 1XDKA 3KDTA 4NIEA 3WT7A 1X76A 3R8AA 3AZ1A 4DK8A 3VJSA 5DWEA 4MG9B 3LMPA 4OARA 5LWPA 3VT7A 3G0WA 1IE9A 2XYJA 3FALB 3OOFA 4WQPA 5AAVB 2FSZA 3AN3A 3A2HA 5DRMA 4CI4A 2BAWA 1NQ1A 2PIOA 2Q6JA 5KRJA 4ZNVA 3DCUA 1RKHA 1EXAA 1ERRA 3A40X 3O1DA 3OMMA 2PNUA 3AURA 1UHLA 4XAOA 5DUHA 2ACLB 3WGPA 1YMTA 3ZRAA 4DOSA 5C4OA 2JFAB 2ZNPA 4OHAA 2GPPA 4PPPA 2QZOB 4F9MA 1T76A 3WFGA 3E94A 2NV7A 3UUDB 3VT8A 2AA2A 1R1KD 3H52A 3K23A 4RMCA 1RKGA 2PKLA 2AXAA 5L7HA 1FD0A 2OM9A 1QKUA 5G3JA 2G5OA 4ZNHA 5GIDA 1KV6A 4NUFA 2P7AA 2P15A 1FCXA 5FQSA 1T65A 4S0SA 1XJ7A 4WLBA 3PBAA 2IHQA 4J5XA 4N5GA 4OK1A 4YNKA 3F5CA 4IVWA 1RDTA 3UUCA 3AFRA 4TUZA 5EJVA 3VT3A 4MGDA 4DQMA 3P0UA 2PIQA 3DZYA 4WHFA 2H79A 3D90A 2GPOA 5AK2A 3WMHA 5DP0A 5KR9A 5DZHA 4Q0AC 2FAIA 2NW4A 1FM6A 4JGVA 3K6PA 4IA7A 3DCTA 5DY8A 3OLFA 3W5PA 3AN4A 4ITFA 5ACCA 2NXXA 1EREA 3GYUA 4OJ4A 1I38A 3R5NA 5SYZA 2ZNNA 2PIWA 3H0AD 1UOMA 5HYRA 1PRGA 3EYBA 2QE4A 4LTWA 5KRLA 3DZYD 3W0AA 2Z4BA 3CTBA 1M7WA 1Y0SA 4EMAA 1FM6D 4XT9A 4IW8A 4ZO1X 2YFEA 1X7JA 4IV4A 5FQTA 1LV2A 3BC5A 2J14A 3IMYA 4RWVA 2W8YA 3R29A 5DWGA 1XIUA 5DWLA 2I4ZA 5ETHA 4G20A 3W0HA 5DXBA 2Q6SA 2AMAA 5KROA 3OSIA 3VT5A 3E00D 5E19A 4Y29A 2VV4A 3RVFA 4JYIA 2R40A 1E3GA 4OH6A 3MNEA 2HASA 2HB7A 1SQNA 2FVJA 3B0TA 3JZBA 4R2UA 1Z5XE 3Q95A 5DKEA 5AVIA 3VHWA 2HB8A 2ZK6A 2Q59B 4TV1A 3VJHA 1XB7A 1PQCA 5L11A 4OIVA 3V3QA 2H77A 4E4KA 5FQPA 1S0ZA 3A78A 4NB6A 3VTBA 3VI8A 4DM6A 4S0TA 2AX8A 2VV1B 3NSQA 3UP3A 1YY4A 3OMOA 3L3XA 1ZDUA 2O9IA 3HZFA 4POJA 1PDUA 4RMEA 2GWXA 4NY9A 4ONIA 4OZRU 4WPFA 2YLPA 3ADXA 3DZUD 2HWRA 1K74A 3FC6B 1HG4A 1XLSA 3WT6A 4DMAA 4RAKA 2GTKA 4ITEA 3OSAA 4MG7A 4HEEX 5GIEA 1PK5A 1QKNA 5EGVA 1N83A 4G21A 2OUZA 5AWJA 3VRUA 1NAVA 3VHUA 1PZLA 2I0GA 2POBA 2YLOA 5DSHA 2QSEA 4PPSA 5DUEA 4N73A 1T7RA 2NPAA 4OGHA 1N46A 3BQDA 5KRIA 4XHDA 1XOWA 3VRWA 4ZNTA 3IXPD 5DXPA 2ZLAA 1MV9A 1H9UA 2A3IA 5AWKA 4ZNSA 1S0XA 4X1FA 5KCDA 2QTUA 3CWDA 3VN2A 4QM0A 1R20A 5L7GA 4G2IA 4J5WA 2XHSA 3KBAA 3UVVB 5G43A 3OOKA 4ZNWA 3OS8C 5E0WA 5HJSA 1FBYA 2JJ3A 1FCYA 4POHA 2O4RA 3OLLA 1NAXA 5DXEA 2PJLA 2POGA 3ET3A 4FNEA 1QKTA 2EWPA 4ZO1B 5DX3A 4ZJRA 1NQ0A 1S9PA 1XV9A 1DB1A 4FHIA 3KYTA 5DZ0A 3W0CA 4OFRA 3G9EA 5DVCA 2J7XA 3GBKA 1XZXX 3L3ZA 5F9BA 3B0RA 1OVLA 3CQVA 1ZH7A 1U3QA 4RZGA 3V49A 2AA6A 4PF3A 3HO0A 2QA8B 2J4AA 1M2ZA 3ZR7A 1R1KA 5K13A 4MG9A 1XDKB 5DYDA 5DZIA 5A86A 2ABIA 2AMBA 2ZK2A 4P6XA 4YMQA 5AAVA 3AZ2A 3X1HA 1XVPA 3FLIA 3OMKA 5DLRA 3NOAA 5E0XA 2GPUA 5AYGA 2I0JA 2OAXA 3PO9A 1T7FA 3CDPA 3HM1A 4RFWA 2BJ4A 3OZJA 5KCEA 4IA3A 4QK4A 4QE6A 4OLMA 5E7VA 3G8OA 1ILGA 5JY3A 2JFAA 2OVMA 4LBDA 4PP5A 1NQ2A 5CJ6A 5G5WA 2Q5GA 3V9TA 1YJEA 1ZGYA 3IPSA 5KRKA 3GYTA 1YIMA 4UDCA 3VSPA 1P93A 2QABA 1YINA 3BEJA 4J5XC 5EITA 3DR1A 4E4QA 1GS4A 1M13A 3RUTA 3ADTA 3R2AA 2AA5A 2HCDA 3ADUA 3CS6A 4IS8A 1S9QA 1WM0X 4OIUA 4OEYA 1X7EA 4JYHA 1MVCA 3WWRA 3WT5A 4K6IA 3H0AA 5DIEA 2PITA 3GWSX 1G1UA 3CJWA 4IU7A 4X1GA 4XUMA 5C4SA 3VHVA 3VJTA 1U3SA 2ZMIA 1ILHA 5G44A 4MGAB 4IUIA 1XNNA 2HFPA 2AYRA 3VTDA 1SJ0A 2Q1VA 1ZAFA 3FXVA 1PCGA 4PLDA 4TUZB 1N4HA 2F4BA 5EHJA 5KCFA 3FURA 3OKHA 3CS8A 2QA6A 5DZ3A 1T79A 4OKBA 3DT3A 5G46A 3E00A 5DWJA 1ZEOA 2LBDA 2HWQA 4RE8A 2XKWA 5DXKA 5KYJA 2Q3YA 3UUAB 5DK9A 4IWFA 4YT1A 1IE8A 5APJA 4J24A 1R5KA 4O8FA 2Q5PA 3A2JA 2ZLCA 2QXSA 4UDBA 2VSRA 5DV8A 3IPUA 1XP6A 4RUJA 4JAZA 4S15A 1E3KA 4MG8A 3UU7A 5H1EA 1ZUCA 2PIVA 3P89A 4IW6A 4IA2A 1NHZA 4OEZA 3F7DA 2HBHA 3ZRBA 2Q6RA 4IQRA 1Y9RA 3ILZA 2QPYA 5DVSA 1YYEA 3DZUA 3DY6A 2ZK5A 2I4JA 3X36A 2Q60A 4OILA 1OSHA 5KRFA 1I37A 3RLLA 2VV4B 2HVCA 1L2IA 2G0HA 4G1ZA 3U9QA 5KD9A 5KYAA 5DKSA 4QJRA 5DRJA 5DUGA 2ZY0A 2IOGA 2Q7IA 4HLWA 5DV6A 3TY0A 5HJPA 2AWHA 3L0LA 2YLYA 4ZN9A 1L2JA 1KNUA 3ERDA 4A2JA 3HC5A 3W5RA 1HJ1A 2ZXMA 3IXPA 2ZK3A 5HCVA 4MG5A 1RJKA 1NUOA 3W5TA 3VTCA 5IXKA 3KMZA 5DKGA 4RZEA 3T03A 3KMRA 4OKTA 3L0JA 5DWIA 4DORA 2ZMJA 3AZ3A 3B68A 3ET0A 1RK3A 3P8XA 2ZMHA 1YOWA 3L0EA 4L98A 2ZFXA 3B5RA 4IVYA 4LNWA 1BSXA 1ZKYA 2P1VA 3AX8A 4MG7B 4FGYA 4UDAA 2YJDA 4UDDA 5C4TA 3CS4A 2YLQA 3FUGA 2AX7A 4L96A 1G2NA 4J5WC 3L03A 3HVLA 4OC7A 5G42A 4PRGA 2O4JA 2PIXA 5FQVA 5DL4A 2P7ZA 2OVHA 3WJ4A 3GD2A 1KKQA 4N1YA 2B1ZA 5DMFA 3SP9A 4PLEA 4G2HA 4G1DA 4DM8A 2P7GA 3PEQA 2PRGA 2Q1HA 5GICA 4NQAB 2Q70A 4PVUA 1XP1A 5DV3A 1T63A 3OMQA 2E2RA 4E2JA 3A9EA 5IZ0A 3OMPA 3S9SA 1UPVA 3IPQA 3WJ5A 3M7RA 2AM9A 4MGBB 5JJMA 1YA3A 3RUUA 2PIUA 3IA6A 4JL4A 2AA7A 3PLZA 4OJBA 4OKWA 4PXMA 4OEDA 3B66A 2OCFA 1GWRA 1R6GA 1DKFA 2ZXZA 4K7AA 5C4UA 4FN9A 5DZ1A 5DX3B 3R8DA 3O1EA 5DVVA 5KRAA 4OKXA 3VT9A 1XV9B 3SZ1A 5B41A 2QGTA 3B3KA 1T7MA 3W0IA 4LSJA 2P54A 2Q7JA 5DXMA 3TKCA 1FM9D 3N00A 3ADWA 4ZOMA 3FALA 3B67A 1S19A 4OH5A 3OSWA 3FEJA 4JYGA 5DXGA 5AZVA 3KWYA 2QGWA 4R6SA 5LGAA 4KZJA 3VRTA 1PQ9A 1OVLB 5E14A 5DYBA 2VV0A 3FEIA 2ZL9A 1GWQA 1Z5XU 2ACLA 1SR7A 4OZRE 3GN8A 2QZOA 3OAPA 4OEAA 2VV2A 1UHLB 5DKBA 3VJIA 2G44A 3UUDA 1XVPB 3K22A 4PP6A 2HARA 1YOKA 1UPWA 4QL8A 3RLJA 2BJ4B 2IOKA 3ZQTA 2ZK1A 1OT7A 4P6WA 2B50A 3A2IA 2G0GA 3B0WA 3W5QA 2AX9A 1XQCA 2V7CA 4CSJA 5KCCA 5M96A 2P1TA 3VT4A 3KDUA 3KMGA 5KRHA 1A28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MG6 A;  3W0Y A;  2P1U A;  1PQ6 A;  4IA1 A;  4ZJW A;  4IWC A;  3B1M A;  2XYW A;  1XLS E;  2GP7 A;  1P8D A;  3F5C B;  2REW A;  1ZDT A;  3MNP A;  2P4Y A;  4XTA A;  5EI1 A;  3HLV A;  4OZT E;  5DXQ A;  2ZXN A;  5HYK A;  2Z4J A;  1G5Y A;  3ET1 A;  4M8H A;  2QR9 A;  4MGD B;  4MGA A;  5GT4 A;  2Q8S A;  4M8E A;  2HAM A;  3CLD A;  1K7L A;  4REE A;  4DK7 A;  2Q7K A;  3ET2 A;  5E15 A;  2GL8 A;  3WTQ A;  5DTV A;  3VT6 A;  1U3R A;  1XQ3 A;  1T5Z A;  4MDD A;  1G50 A;  5AAU A;  5KRM A;  2PIR A;  2R6W A;  3HC6 A;  1X78 A;  3KPZ A;  5B5B A;  2AAX A;  3UUA A;  1U9E A;  3V4A A;  1RDT D;  3R5M A;  1XPC A;  4PWL A;  3AUQ A;  4K4J A;  4ZI1 A;  5I4V A;  4WHG A;  2ZNQ A;  2QMV A;  3MNO A;  1X7R A;  4RUO X;  4G1Y A;  4CI5 A;  1XP9 A;  3OZ0 A;  1NDE A;  5DXB B;  3GWX A;  4IV2 A;  4MGC A;  4S14 A;  1I7I A;  2Q59 A;  5ICK A;  3D24 A;  5DU5 A;  4BCR A;  5DI7 A;  2Q61 A;  4FHH A;  4MG8 B;  3UU7 B;  3Q95 B;  3JZC A;  2ZK4 A;  3W0G A;  3OGT A;  3OLS A;  4RUP A;  4TV1 B;  2ZVT A;  5KCU A;  4APU A;  4B7W A;  5L7E A;  3L1B A;  1NQ7 A;  1T73 A;  3D5F A;  3OKI A;  2VV1 A;  4OJ9 A;  5DIG A;  2AB2 A;  4EM9 A;  1EXX A;  3K8S A;  5DMC A;  3V9Y A;  4Q50 A;  3RY9 A;  5APH A;  3VRV A;  3X1I A;  5FQR A;  2QNV A;  2V0V A;  1NRL A;  5HJP B;  2ZKC A;  3FC6 A;  4OFU A;  2R40 D;  2ZBS A;  2XYX A;  3B0Q A;  5E1C A;  3KFC A;  3PCU A;  3X31 A;  1XAP A;  1TXI A;  3ADV A;  3D6D A;  4J26 A;  5JI0 D;  5DXR A;  2GPV A;  2OZ7 A;  2ATH A;  3V3E A;  3TX7 B;  2ZAS A;  1YP0 A;  5DID A;  2QW4 A;  1SKX A;  4RMD A;  2VV3 A;  5KRC A;  1OSV A;  4QE8 A;  1MZN A;  3OS9 A;  4ZNU A;  1X7B A;  2Q5S A;  1GWX A;  1T74 A;  2YAT A;  1I7G A;  2PIN A;  5KCT A;  3P88 A;  1NYX A;  5APK A;  3VSO A;  2Q7L A;  4LNX A;  4RZF A;  3AUN A;  3NSP A;  3PRG A;  4XI3 A;  4XUH A;  2R6Y A;  3UVV A;  1XNX A;  1Z95 A;  3HQ5 A;  3A3Z X;  2QXM A;  4A4W A;  4A4V A;  1K74 D;  3D57 A;  1Q4X A;  4KZI A;  2YHD A;  4R06 A;  3UP0 A;  3ERT A;  4Q13 A;  1LBD A;  3SP6 A;  2AO6 A;  2I4P A;  2YJA B;  4ZN7 A;  3FS1 A;  3V9V A;  1FM9 A;  4WVD A;  5AVL A;  3CDS A;  3ADS A;  2GIU A;  1T7T A;  2QH6 A;  3LBD A;  1YUC A;  4MGB A;  1Y0X X;  2JF9 A;  4OZT U;  4REF A;  5EC9 A;  2VST A;  3A9E B;  2ZK0 A;  4YPQ A;  5IAW A;  2NXX E;  3OS8 A;  1QKM A;  2HC4 A;  3QT0 A;  3TKM A;  2ZNO A;  5JJM B;  3E7C A;  4KZM A;  3G8I A;  1FCZ A;  1K4W A;  2PIP L;  5G45 A;  1R20 D;  1VJB A;  2AX6 A;  4N8R A;  3W0J A;  4PP3 A;  3B65 A;  5AZT A;  1DKF B;  2B23 A;  3GZ9 A;  3HOD A;  5KCW A;  2QA8 A;  1TFC A;  5HZC A;  3R8I A;  3WFF A;  1A52 A;  4XLD A;  2B1V A;  2J7Y A;  1XDK A;  3KDT A;  4NIE A;  3WT7 A;  1X76 A;  3R8A A;  3AZ1 A;  4DK8 A;  3VJS A;  5DWE A;  4MG9 B;  3LMP A;  4OAR A;  5LWP A;  3VT7 A;  3G0W A;  1IE9 A;  2XYJ A;  3FAL B;  3OOF A;  4WQP A;  5AAV B;  2FSZ A;  3AN3 A;  3A2H A;  5DRM A;  4CI4 A;  2BAW A;  1NQ1 A;  2PIO A;  2Q6J A;  5KRJ A;  4ZNV A;  3DCU A;  1RKH A;  1EXA A;  1ERR A;  3A40 X;  3O1D A;  3OMM A;  2PNU A;  3AUR A;  1UHL A;  4XAO A;  5DUH A;  2ACL B;  3WGP A;  1YMT A;  3ZRA A;  4DOS A;  5C4O A;  2JFA B;  2ZNP A;  4OHA A;  2GPP A;  4PPP A;  2QZO B;  4F9M A;  1T76 A;  3WFG A;  3E94 A;  2NV7 A;  3UUD B;  3VT8 A;  2AA2 A;  1R1K D;  3H52 A;  3K23 A;  4RMC A;  1RKG A;  2PKL A;  2AXA A;  5L7H A;  1FD0 A;  2OM9 A;  1QKU A;  5G3J A;  2G5O A;  4ZNH A;  5GID A;  1KV6 A;  4NUF A;  2P7A A;  2P15 A;  1FCX A;  5FQS A;  1T65 A;  4S0S A;  1XJ7 A;  4WLB A;  3PBA A;  2IHQ A;  4J5X A;  4N5G A;  4OK1 A;  4YNK A;  3F5C A;  4IVW A;  1RDT A;  3UUC A;  3AFR A;  4TUZ A;  5EJV A;  3VT3 A;  4MGD A;  4DQM A;  3P0U A;  2PIQ A;  3DZY A;  4WHF A;  2H79 A;  3D90 A;  2GPO A;  5AK2 A;  3WMH A;  5DP0 A;  5KR9 A;  5DZH A;  4Q0A C;  2FAI A;  2NW4 A;  1FM6 A;  4JGV A;  3K6P A;  4IA7 A;  3DCT A;  5DY8 A;  3OLF A;  3W5P A;  3AN4 A;  4ITF A;  5ACC A;  2NXX A;  1ERE A;  3GYU A;  4OJ4 A;  1I38 A;  3R5N A;  5SYZ A;  2ZNN A;  2PIW A;  3H0A D;  1UOM A;  5HYR A;  1PRG A;  3EYB A;  2QE4 A;  4LTW A;  5KRL A;  3DZY D;  3W0A A;  2Z4B A;  3CTB A;  1M7W A;  1Y0S A;  4EMA A;  1FM6 D;  4XT9 A;  4IW8 A;  4ZO1 X;  2YFE A;  1X7J A;  4IV4 A;  5FQT A;  1LV2 A;  3BC5 A;  2J14 A;  3IMY A;  4RWV A;  2W8Y A;  3R29 A;  5DWG A;  1XIU A;  5DWL A;  2I4Z A;  5ETH A;  4G20 A;  3W0H A;  5DXB A;  2Q6S A;  2AMA A;  5KRO A;  3OSI A;  3VT5 A;  3E00 D;  5E19 A;  4Y29 A;  2VV4 A;  3RVF A;  4JYI A;  2R40 A;  1E3G A;  4OH6 A;  3MNE A;  2HAS A;  2HB7 A;  1SQN A;  2FVJ A;  3B0T A;  3JZB A;  4R2U A;  1Z5X E;  3Q95 A;  5DKE A;  5AVI A;  3VHW A;  2HB8 A;  2ZK6 A;  2Q59 B;  4TV1 A;  3VJH A;  1XB7 A;  1PQC A;  5L11 A;  4OIV A;  3V3Q A;  2H77 A;  4E4K A;  5FQP A;  1S0Z A;  3A78 A;  4NB6 A;  3VTB A;  3VI8 A;  4DM6 A;  4S0T A;  2AX8 A;  2VV1 B;  3NSQ A;  3UP3 A;  1YY4 A;  3OMO A;  3L3X A;  1ZDU A;  2O9I A;  3HZF A;  4POJ A;  1PDU A;  4RME A;  2GWX A;  4NY9 A;  4ONI A;  4OZR U;  4WPF A;  2YLP A;  3ADX A;  3DZU D;  2HWR A;  1K74 A;  3FC6 B;  1HG4 A;  1XLS A;  3WT6 A;  4DMA A;  4RAK A;  2GTK A;  4ITE A;  3OSA A;  4MG7 A;  4HEE X;  5GIE A;  1PK5 A;  1QKN A;  5EGV A;  1N83 A;  4G21 A;  2OUZ A;  5AWJ A;  3VRU A;  1NAV A;  3VHU A;  1PZL A;  2I0G A;  2POB A;  2YLO A;  5DSH A;  2QSE A;  4PPS A;  5DUE A;  4N73 A;  1T7R A;  2NPA A;  4OGH A;  1N46 A;  3BQD A;  5KRI A;  4XHD A;  1XOW A;  3VRW A;  4ZNT A;  3IXP D;  5DXP A;  2ZLA A;  1MV9 A;  1H9U A;  2A3I A;  5AWK A;  4ZNS A;  1S0X A;  4X1F A;  5KCD A;  2QTU A;  3CWD A;  3VN2 A;  4QM0 A;  1R20 A;  5L7G A;  4G2I A;  4J5W A;  2XHS A;  3KBA A;  3UVV B;  5G43 A;  3OOK A;  4ZNW A;  3OS8 C;  5E0W A;  5HJS A;  1FBY A;  2JJ3 A;  1FCY A;  4POH A;  2O4R A;  3OLL A;  1NAX A;  5DXE A;  2PJL A;  2POG A;  3ET3 A;  4FNE A;  1QKT A;  2EWP A;  4ZO1 B;  5DX3 A;  4ZJR A;  1NQ0 A;  1S9P A;  1XV9 A;  1DB1 A;  4FHI A;  3KYT A;  5DZ0 A;  3W0C A;  4OFR A;  3G9E A;  5DVC A;  2J7X A;  3GBK A;  1XZX X;  3L3Z A;  5F9B A;  3B0R A;  1OVL A;  3CQV A;  1ZH7 A;  1U3Q A;  4RZG A;  3V49 A;  2AA6 A;  4PF3 A;  3HO0 A;  2QA8 B;  2J4A A;  1M2Z A;  3ZR7 A;  1R1K A;  5K13 A;  4MG9 A;  1XDK B;  5DYD A;  5DZI A;  5A86 A;  2ABI A;  2AMB A;  2ZK2 A;  4P6X A;  4YMQ A;  5AAV A;  3AZ2 A;  3X1H A;  1XVP A;  3FLI A;  3OMK A;  5DLR A;  3NOA A;  5E0X A;  2GPU A;  5AYG A;  2I0J A;  2OAX A;  3PO9 A;  1T7F A;  3CDP A;  3HM1 A;  4RFW A;  2BJ4 A;  3OZJ A;  5KCE A;  4IA3 A;  4QK4 A;  4QE6 A;  4OLM A;  5E7V A;  3G8O A;  1ILG A;  5JY3 A;  2JFA A;  2OVM A;  4LBD A;  4PP5 A;  1NQ2 A;  5CJ6 A;  5G5W A;  2Q5G A;  3V9T A;  1YJE A;  1ZGY A;  3IPS A;  5KRK A;  3GYT A;  1YIM A;  4UDC A;  3VSP A;  1P93 A;  2QAB A;  1YIN A;  3BEJ A;  4J5X C;  5EIT A;  3DR1 A;  4E4Q A;  1GS4 A;  1M13 A;  3RUT A;  3ADT A;  3R2A A;  2AA5 A;  2HCD A;  3ADU A;  3CS6 A;  4IS8 A;  1S9Q A;  1WM0 X;  4OIU A;  4OEY A;  1X7E A;  4JYH A;  1MVC A;  3WWR A;  3WT5 A;  4K6I A;  3H0A A;  5DIE A;  2PIT A;  3GWS X;  1G1U A;  3CJW A;  4IU7 A;  4X1G A;  4XUM A;  5C4S A;  3VHV A;  3VJT A;  1U3S A;  2ZMI A;  1ILH A;  5G44 A;  4MGA B;  4IUI A;  1XNN A;  2HFP A;  2AYR A;  3VTD A;  1SJ0 A;  2Q1V A;  1ZAF A;  3FXV A;  1PCG A;  4PLD A;  4TUZ B;  1N4H A;  2F4B A;  5EHJ A;  5KCF A;  3FUR A;  3OKH A;  3CS8 A;  2QA6 A;  5DZ3 A;  1T79 A;  4OKB A;  3DT3 A;  5G46 A;  3E00 A;  5DWJ A;  1ZEO A;  2LBD A;  2HWQ A;  4RE8 A;  2XKW A;  5DXK A;  5KYJ A;  2Q3Y A;  3UUA B;  5DK9 A;  4IWF A;  4YT1 A;  1IE8 A;  5APJ A;  4J24 A;  1R5K A;  4O8F A;  2Q5P A;  3A2J A;  2ZLC A;  2QXS A;  4UDB A;  2VSR A;  5DV8 A;  3IPU A;  1XP6 A;  4RUJ A;  4JAZ A;  4S15 A;  1E3K A;  4MG8 A;  3UU7 A;  5H1E A;  1ZUC A;  2PIV A;  3P89 A;  4IW6 A;  4IA2 A;  1NHZ A;  4OEZ A;  3F7D A;  2HBH A;  3ZRB A;  2Q6R A;  4IQR A;  1Y9R A;  3ILZ A;  2QPY A;  5DVS A;  1YYE A;  3DZU A;  3DY6 A;  2ZK5 A;  2I4J A;  3X36 A;  2Q60 A;  4OIL A;  1OSH A;  5KRF A;  1I37 A;  3RLL A;  2VV4 B;  2HVC A;  1L2I A;  2G0H A;  4G1Z A;  3U9Q A;  5KD9 A;  5KYA A;  5DKS A;  4QJR A;  5DRJ A;  5DUG A;  2ZY0 A;  2IOG A;  2Q7I A;  4HLW A;  5DV6 A;  3TY0 A;  5HJP A;  2AWH A;  3L0L A;  2YLY A;  4ZN9 A;  1L2J A;  1KNU A;  3ERD A;  4A2J A;  3HC5 A;  3W5R A;  1HJ1 A;  2ZXM A;  3IXP A;  2ZK3 A;  5HCV A;  4MG5 A;  1RJK A;  1NUO A;  3W5T A;  3VTC A;  5IXK A;  3KMZ A;  5DKG A;  4RZE A;  3T03 A;  3KMR A;  4OKT A;  3L0J A;  5DWI A;  4DOR A;  2ZMJ A;  3AZ3 A;  3B68 A;  3ET0 A;  1RK3 A;  3P8X A;  2ZMH A;  1YOW A;  3L0E A;  4L98 A;  2ZFX A;  3B5R A;  4IVY A;  4LNW A;  1BSX A;  1ZKY A;  2P1V A;  3AX8 A;  4MG7 B;  4FGY A;  4UDA A;  2YJD A;  4UDD A;  5C4T A;  3CS4 A;  2YLQ A;  3FUG A;  2AX7 A;  4L96 A;  1G2N A;  4J5W C;  3L03 A;  3HVL A;  4OC7 A;  5G42 A;  4PRG A;  2O4J A;  2PIX A;  5FQV A;  5DL4 A;  2P7Z A;  2OVH A;  3WJ4 A;  3GD2 A;  1KKQ A;  4N1Y A;  2B1Z A;  5DMF A;  3SP9 A;  4PLE A;  4G2H A;  4G1D A;  4DM8 A;  2P7G A;  3PEQ A;  2PRG A;  2Q1H A;  5GIC A;  4NQA B;  2Q70 A;  4PVU A;  1XP1 A;  5DV3 A;  1T63 A;  3OMQ A;  2E2R A;  4E2J A;  3A9E A;  5IZ0 A;  3OMP A;  3S9S A;  1UPV A;  3IPQ A;  3WJ5 A;  3M7R A;  2AM9 A;  4MGB B;  5JJM A;  1YA3 A;  3RUU A;  2PIU A;  3IA6 A;  4JL4 A;  2AA7 A;  3PLZ A;  4OJB A;  4OKW A;  4PXM A;  4OED A;  3B66 A;  2OCF A;  1GWR A;  1R6G A;  1DKF A;  2ZXZ A;  4K7A A;  5C4U A;  4FN9 A;  5DZ1 A;  5DX3 B;  3R8D A;  3O1E A;  5DVV A;  5KRA A;  4OKX A;  3VT9 A;  1XV9 B;  3SZ1 A;  5B41 A;  2QGT A;  3B3K A;  1T7M A;  3W0I A;  4LSJ A;  2P54 A;  2Q7J A;  5DXM A;  3TKC A;  1FM9 D;  3N00 A;  3ADW A;  4ZOM A;  3FAL A;  3B67 A;  1S19 A;  4OH5 A;  3OSW A;  3FEJ A;  4JYG A;  5DXG A;  5AZV A;  3KWY A;  2QGW A;  4R6S A;  5LGA A;  4KZJ A;  3VRT A;  1PQ9 A;  1OVL B;  5E14 A;  5DYB A;  2VV0 A;  3FEI A;  2ZL9 A;  1GWQ A;  1Z5X U;  2ACL A;  1SR7 A;  4OZR E;  3GN8 A;  2QZO A;  3OAP A;  4OEA A;  2VV2 A;  1UHL B;  5DKB A;  3VJI A;  2G44 A;  3UUD A;  1XVP B;  3K22 A;  4PP6 A;  2HAR A;  1YOK A;  1UPW A;  4QL8 A;  3RLJ A;  2BJ4 B;  2IOK A;  3ZQT A;  2ZK1 A;  1OT7 A;  4P6W A;  2B50 A;  3A2I A;  2G0G A;  3B0W A;  3W5Q A;  2AX9 A;  1XQC A;  2V7C A;  4CSJ A;  5KCC A;  5M96 A;  2P1T A;  3VT4 A;  3KDU A;  3KMG A;  5KRH A;  1A28 A; 
#chains in the Genus database with same CATH topology
 4MG6 A;  3W0Y A;  2P1U A;  1PQ6 A;  4IA1 A;  4ZJW A;  4IWC A;  3B1M A;  2XYW A;  1XLS E;  2GP7 A;  1P8D A;  3F5C B;  2REW A;  1ZDT A;  3MNP A;  2P4Y A;  4XTA A;  5EI1 A;  3HLV A;  4OZT E;  5DXQ A;  2ZXN A;  5HYK A;  2Z4J A;  1G5Y A;  3ET1 A;  4M8H A;  2QR9 A;  4MGD B;  4MGA A;  5GT4 A;  2Q8S A;  4M8E A;  2HAM A;  3CLD A;  1K7L A;  4REE A;  4DK7 A;  2Q7K A;  3ET2 A;  5E15 A;  2GL8 A;  3WTQ A;  5DTV A;  3VT6 A;  1U3R A;  1XQ3 A;  1T5Z A;  4MDD A;  1G50 A;  5AAU A;  5KRM A;  2PIR A;  2R6W A;  3HC6 A;  1X78 A;  3KPZ A;  5B5B A;  2AAX A;  3UUA A;  1U9E A;  3V4A A;  1RDT D;  3R5M A;  1XPC A;  4PWL A;  3AUQ A;  4K4J A;  4ZI1 A;  5I4V A;  4WHG A;  2ZNQ A;  2QMV A;  3MNO A;  1X7R A;  4RUO X;  4G1Y A;  4CI5 A;  1XP9 A;  3OZ0 A;  1NDE A;  5DXB B;  3GWX A;  4IV2 A;  4MGC A;  4S14 A;  1I7I A;  2Q59 A;  5ICK A;  3D24 A;  5DU5 A;  4BCR A;  5DI7 A;  2Q61 A;  4FHH A;  4MG8 B;  3UU7 B;  3Q95 B;  3JZC A;  2ZK4 A;  3W0G A;  3OGT A;  3OLS A;  4RUP A;  4TV1 B;  2ZVT A;  5KCU A;  4APU A;  4B7W A;  5L7E A;  3L1B A;  1NQ7 A;  1T73 A;  3D5F A;  3OKI A;  2VV1 A;  4OJ9 A;  5DIG A;  2AB2 A;  4EM9 A;  1EXX A;  3K8S A;  5DMC A;  3V9Y A;  4Q50 A;  3RY9 A;  5APH A;  3VRV A;  3X1I A;  5FQR A;  2QNV A;  2V0V A;  1NRL A;  5HJP B;  2ZKC A;  3FC6 A;  4OFU A;  2R40 D;  2ZBS A;  2XYX A;  3B0Q A;  5E1C A;  3KFC A;  3PCU A;  3X31 A;  1XAP A;  1TXI A;  3ADV A;  3D6D A;  4J26 A;  5JI0 D;  5DXR A;  2GPV A;  2OZ7 A;  2ATH A;  3V3E A;  3TX7 B;  2ZAS A;  1YP0 A;  5DID A;  2QW4 A;  1SKX A;  4RMD A;  2VV3 A;  5KRC A;  1OSV A;  4QE8 A;  1MZN A;  3OS9 A;  4ZNU A;  1X7B A;  2Q5S A;  1GWX A;  1T74 A;  2YAT A;  1I7G A;  2PIN A;  5KCT A;  3P88 A;  1NYX A;  5APK A;  3VSO A;  2Q7L A;  4LNX A;  4RZF A;  3AUN A;  3NSP A;  3PRG A;  4XI3 A;  4XUH A;  2R6Y A;  3UVV A;  1XNX A;  1Z95 A;  3HQ5 A;  3A3Z X;  2QXM A;  4A4W A;  4A4V A;  1K74 D;  3D57 A;  1Q4X A;  4KZI A;  2YHD A;  4R06 A;  3UP0 A;  3ERT A;  4Q13 A;  1LBD A;  3SP6 A;  2AO6 A;  2I4P A;  2YJA B;  4ZN7 A;  3FS1 A;  3V9V A;  1FM9 A;  4WVD A;  5AVL A;  3CDS A;  3ADS A;  2GIU A;  1T7T A;  2QH6 A;  3LBD A;  1YUC A;  4MGB A;  1Y0X X;  2JF9 A;  4OZT U;  4REF A;  5EC9 A;  2VST A;  3A9E B;  2ZK0 A;  4YPQ A;  5IAW A;  2NXX E;  3OS8 A;  1QKM A;  2HC4 A;  3QT0 A;  3TKM A;  2ZNO A;  5JJM B;  3E7C A;  4KZM A;  3G8I A;  1FCZ A;  1K4W A;  2PIP L;  5G45 A;  1R20 D;  1VJB A;  2AX6 A;  4N8R A;  3W0J A;  4PP3 A;  3B65 A;  5AZT A;  1DKF B;  2B23 A;  3GZ9 A;  3HOD A;  5KCW A;  2QA8 A;  1TFC A;  5HZC A;  3R8I A;  3WFF A;  1A52 A;  4XLD A;  2B1V A;  2J7Y A;  1XDK A;  3KDT A;  4NIE A;  3WT7 A;  1X76 A;  3R8A A;  3AZ1 A;  4DK8 A;  3VJS A;  5DWE A;  4MG9 B;  3LMP A;  4OAR A;  5LWP A;  3VT7 A;  3G0W A;  1IE9 A;  2XYJ A;  3FAL B;  3OOF A;  4WQP A;  5AAV B;  2FSZ A;  3AN3 A;  3A2H A;  5DRM A;  4CI4 A;  2BAW A;  1NQ1 A;  2PIO A;  2Q6J A;  5KRJ A;  4ZNV A;  3DCU A;  1RKH A;  1EXA A;  1ERR A;  3A40 X;  3O1D A;  3OMM A;  2PNU A;  3AUR A;  1UHL A;  4XAO A;  5DUH A;  2ACL B;  3WGP A;  1YMT A;  3ZRA A;  4DOS A;  5C4O A;  2JFA B;  2ZNP A;  4OHA A;  2GPP A;  4PPP A;  2QZO B;  4F9M A;  1T76 A;  3WFG A;  3E94 A;  2NV7 A;  3UUD B;  3VT8 A;  2AA2 A;  1R1K D;  3H52 A;  3K23 A;  4RMC A;  1RKG A;  2PKL A;  2AXA A;  5L7H A;  1FD0 A;  2OM9 A;  1QKU A;  5G3J A;  2G5O A;  4ZNH A;  5GID A;  1KV6 A;  4NUF A;  2P7A A;  2P15 A;  1FCX A;  5FQS A;  1T65 A;  4S0S A;  1XJ7 A;  4WLB A;  3PBA A;  2IHQ A;  4J5X A;  4N5G A;  4OK1 A;  4YNK A;  3F5C A;  4IVW A;  1RDT A;  3UUC A;  3AFR A;  4TUZ A;  5EJV A;  3VT3 A;  4MGD A;  4DQM A;  3P0U A;  2PIQ A;  3DZY A;  4WHF A;  2H79 A;  3D90 A;  2GPO A;  5AK2 A;  3WMH A;  5DP0 A;  5KR9 A;  5DZH A;  4Q0A C;  2FAI A;  2NW4 A;  1FM6 A;  4JGV A;  3K6P A;  4IA7 A;  3DCT A;  5DY8 A;  3OLF A;  3W5P A;  3AN4 A;  4ITF A;  5ACC A;  2NXX A;  1ERE A;  3GYU A;  4OJ4 A;  1I38 A;  3R5N A;  5SYZ A;  2ZNN A;  2PIW A;  3H0A D;  1UOM A;  5HYR A;  1PRG A;  3EYB A;  2QE4 A;  4LTW A;  5KRL A;  3DZY D;  3W0A A;  2Z4B A;  3CTB A;  1M7W A;  1Y0S A;  4EMA A;  1FM6 D;  4XT9 A;  4IW8 A;  4ZO1 X;  2YFE A;  1X7J A;  4IV4 A;  5FQT A;  1LV2 A;  3BC5 A;  2J14 A;  3IMY A;  4RWV A;  2W8Y A;  3R29 A;  5DWG A;  1XIU A;  5DWL A;  2I4Z A;  5ETH A;  4G20 A;  3W0H A;  5DXB A;  2Q6S A;  2AMA A;  5KRO A;  3OSI A;  3VT5 A;  3E00 D;  5E19 A;  4Y29 A;  2VV4 A;  3RVF A;  4JYI A;  2R40 A;  1E3G A;  4OH6 A;  3MNE A;  2HAS A;  2HB7 A;  1SQN A;  2FVJ A;  3B0T A;  3JZB A;  4R2U A;  1Z5X E;  3Q95 A;  5DKE A;  5AVI A;  3VHW A;  2HB8 A;  2ZK6 A;  2Q59 B;  4TV1 A;  3VJH A;  1XB7 A;  1PQC A;  5L11 A;  4OIV A;  3V3Q A;  2H77 A;  4E4K A;  5FQP A;  1S0Z A;  3A78 A;  4NB6 A;  3VTB A;  3VI8 A;  4DM6 A;  4S0T A;  2AX8 A;  2VV1 B;  3NSQ A;  3UP3 A;  1YY4 A;  3OMO A;  3L3X A;  1ZDU A;  2O9I A;  3HZF A;  4POJ A;  1PDU A;  4RME A;  2GWX A;  4NY9 A;  4ONI A;  4OZR U;  4WPF A;  2YLP A;  3ADX A;  3DZU D;  2HWR A;  1K74 A;  3FC6 B;  1HG4 A;  1XLS A;  3WT6 A;  4DMA A;  4RAK A;  2GTK A;  4ITE A;  3OSA A;  4MG7 A;  4HEE X;  5GIE A;  1PK5 A;  1QKN A;  5EGV A;  1N83 A;  4G21 A;  2OUZ A;  5AWJ A;  3VRU A;  1NAV A;  3VHU A;  1PZL A;  2I0G A;  2POB A;  2YLO A;  5DSH A;  2QSE A;  4PPS A;  5DUE A;  4N73 A;  1T7R A;  2NPA A;  4OGH A;  1N46 A;  3BQD A;  5KRI A;  4XHD A;  1XOW A;  3VRW A;  4ZNT A;  3IXP D;  5DXP A;  2ZLA A;  1MV9 A;  1H9U A;  2A3I A;  5AWK A;  4ZNS A;  1S0X A;  4X1F A;  5KCD A;  2QTU A;  3CWD A;  3VN2 A;  4QM0 A;  1R20 A;  5L7G A;  4G2I A;  4J5W A;  2XHS A;  3KBA A;  3UVV B;  5G43 A;  3OOK A;  4ZNW A;  3OS8 C;  5E0W A;  5HJS A;  1FBY A;  2JJ3 A;  1FCY A;  4POH A;  2O4R A;  3OLL A;  1NAX A;  5DXE A;  2PJL A;  2POG A;  3ET3 A;  4FNE A;  1QKT A;  2EWP A;  4ZO1 B;  5DX3 A;  4ZJR A;  1NQ0 A;  1S9P A;  1XV9 A;  1DB1 A;  4FHI A;  3KYT A;  5DZ0 A;  3W0C A;  4OFR A;  3G9E A;  5DVC A;  2J7X A;  3GBK A;  1XZX X;  3L3Z A;  5F9B A;  3B0R A;  1OVL A;  3CQV A;  1ZH7 A;  1U3Q A;  4RZG A;  3V49 A;  2AA6 A;  4PF3 A;  3HO0 A;  2QA8 B;  2J4A A;  1M2Z A;  3ZR7 A;  1R1K A;  5K13 A;  4MG9 A;  1XDK B;  5DYD A;  5DZI A;  5A86 A;  2ABI A;  2AMB A;  2ZK2 A;  4P6X A;  4YMQ A;  5AAV A;  3AZ2 A;  3X1H A;  1XVP A;  3FLI A;  3OMK A;  5DLR A;  3NOA A;  5E0X A;  2GPU A;  5AYG A;  2I0J A;  2OAX A;  3PO9 A;  1T7F A;  3CDP A;  3HM1 A;  4RFW A;  2BJ4 A;  3OZJ A;  5KCE A;  4IA3 A;  4QK4 A;  4QE6 A;  4OLM A;  5E7V A;  3G8O A;  1ILG A;  5JY3 A;  2JFA A;  2OVM A;  4LBD A;  4PP5 A;  1NQ2 A;  5CJ6 A;  5G5W A;  2Q5G A;  3V9T A;  1YJE A;  1ZGY A;  3IPS A;  5KRK A;  3GYT A;  1YIM A;  4UDC A;  3VSP A;  1P93 A;  2QAB A;  1YIN A;  3BEJ A;  4J5X C;  5EIT A;  3DR1 A;  4E4Q A;  1GS4 A;  1M13 A;  3RUT A;  3ADT A;  3R2A A;  2AA5 A;  2HCD A;  3ADU A;  3CS6 A;  4IS8 A;  1S9Q A;  1WM0 X;  4OIU A;  4OEY A;  1X7E A;  4JYH A;  1MVC A;  3WWR A;  3WT5 A;  4K6I A;  3H0A A;  5DIE A;  2PIT A;  3GWS X;  1G1U A;  3CJW A;  4IU7 A;  4X1G A;  4XUM A;  5C4S A;  3VHV A;  3VJT A;  1U3S A;  2ZMI A;  1ILH A;  5G44 A;  4MGA B;  4IUI A;  1XNN A;  2HFP A;  2AYR A;  3VTD A;  1SJ0 A;  2Q1V A;  1ZAF A;  3FXV A;  1PCG A;  4PLD A;  4TUZ B;  1N4H A;  2F4B A;  5EHJ A;  5KCF A;  3FUR A;  3OKH A;  3CS8 A;  2QA6 A;  5DZ3 A;  1T79 A;  4OKB A;  3DT3 A;  5G46 A;  3E00 A;  5DWJ A;  1ZEO A;  2LBD A;  2HWQ A;  4RE8 A;  2XKW A;  5DXK A;  5KYJ A;  2Q3Y A;  3UUA B;  5DK9 A;  4IWF A;  4YT1 A;  1IE8 A;  5APJ A;  4J24 A;  1R5K A;  4O8F A;  2Q5P A;  3A2J A;  2ZLC A;  2QXS A;  4UDB A;  2VSR A;  5DV8 A;  3IPU A;  1XP6 A;  4RUJ A;  4JAZ A;  4S15 A;  1E3K A;  4MG8 A;  3UU7 A;  5H1E A;  1ZUC A;  2PIV A;  3P89 A;  4IW6 A;  4IA2 A;  1NHZ A;  4OEZ A;  3F7D A;  2HBH A;  3ZRB A;  2Q6R A;  4IQR A;  1Y9R A;  3ILZ A;  2QPY A;  5DVS A;  1YYE A;  3DZU A;  3DY6 A;  2ZK5 A;  2I4J A;  3X36 A;  2Q60 A;  4OIL A;  1OSH A;  5KRF A;  1I37 A;  3RLL A;  2VV4 B;  2HVC A;  1L2I A;  2G0H A;  4G1Z A;  3U9Q A;  5KD9 A;  5KYA A;  5DKS A;  4QJR A;  5DRJ A;  5DUG A;  2ZY0 A;  2IOG A;  2Q7I A;  4HLW A;  5DV6 A;  3TY0 A;  5HJP A;  2AWH A;  3L0L A;  2YLY A;  4ZN9 A;  1L2J A;  1KNU A;  3ERD A;  4A2J A;  3HC5 A;  3W5R A;  1HJ1 A;  2ZXM A;  3IXP A;  2ZK3 A;  5HCV A;  4MG5 A;  1RJK A;  1NUO A;  3W5T A;  3VTC A;  5IXK A;  3KMZ A;  5DKG A;  4RZE A;  3T03 A;  3KMR A;  4OKT A;  3L0J A;  5DWI A;  4DOR A;  2ZMJ A;  3AZ3 A;  3B68 A;  3ET0 A;  1RK3 A;  3P8X A;  2ZMH A;  1YOW A;  3L0E A;  4L98 A;  2ZFX A;  3B5R A;  4IVY A;  4LNW A;  1BSX A;  1ZKY A;  2P1V A;  3AX8 A;  4MG7 B;  4FGY A;  4UDA A;  2YJD A;  4UDD A;  5C4T A;  3CS4 A;  2YLQ A;  3FUG A;  2AX7 A;  4L96 A;  1G2N A;  4J5W C;  3L03 A;  3HVL A;  4OC7 A;  5G42 A;  4PRG A;  2O4J A;  2PIX A;  5FQV A;  5DL4 A;  2P7Z A;  2OVH A;  3WJ4 A;  3GD2 A;  1KKQ A;  4N1Y A;  2B1Z A;  5DMF A;  3SP9 A;  4PLE A;  4G2H A;  4G1D A;  4DM8 A;  2P7G A;  3PEQ A;  2PRG A;  2Q1H A;  5GIC A;  4NQA B;  2Q70 A;  4PVU A;  1XP1 A;  5DV3 A;  1T63 A;  3OMQ A;  2E2R A;  4E2J A;  3A9E A;  5IZ0 A;  3OMP A;  3S9S A;  1UPV A;  3IPQ A;  3WJ5 A;  3M7R A;  2AM9 A;  4MGB B;  5JJM A;  1YA3 A;  3RUU A;  2PIU A;  3IA6 A;  4JL4 A;  2AA7 A;  3PLZ A;  4OJB A;  4OKW A;  4PXM A;  4OED A;  3B66 A;  2OCF A;  1GWR A;  1R6G A;  1DKF A;  2ZXZ A;  4K7A A;  5C4U A;  4FN9 A;  5DZ1 A;  5DX3 B;  3R8D A;  3O1E A;  5DVV A;  5KRA A;  4OKX A;  3VT9 A;  1XV9 B;  3SZ1 A;  5B41 A;  2QGT A;  3B3K A;  1T7M A;  3W0I A;  4LSJ A;  2P54 A;  2Q7J A;  5DXM A;  3TKC A;  1FM9 D;  3N00 A;  3ADW A;  4ZOM A;  3FAL A;  3B67 A;  1S19 A;  4OH5 A;  3OSW A;  3FEJ A;  4JYG A;  5DXG A;  5AZV A;  3KWY A;  2QGW A;  4R6S A;  5LGA A;  4KZJ A;  3VRT A;  1PQ9 A;  1OVL B;  5E14 A;  5DYB A;  2VV0 A;  3FEI A;  2ZL9 A;  1GWQ A;  1Z5X U;  2ACL A;  1SR7 A;  4OZR E;  3GN8 A;  2QZO A;  3OAP A;  4OEA A;  2VV2 A;  1UHL B;  5DKB A;  3VJI A;  2G44 A;  3UUD A;  1XVP B;  3K22 A;  4PP6 A;  2HAR A;  1YOK A;  1UPW A;  4QL8 A;  3RLJ A;  2BJ4 B;  2IOK A;  3ZQT A;  2ZK1 A;  1OT7 A;  4P6W A;  2B50 A;  3A2I A;  2G0G A;  3B0W A;  3W5Q A;  2AX9 A;  1XQC A;  2V7C A;  4CSJ A;  5KCC A;  5M96 A;  2P1T A;  3VT4 A;  3KDU A;  3KMG A;  5KRH A;  1A28 A; 
#chains in the Genus database with same CATH homology
 4MG6 A;  3W0Y A;  2P1U A;  1PQ6 A;  4IA1 A;  4ZJW A;  4IWC A;  3B1M A;  2XYW A;  1XLS E;  2GP7 A;  1P8D A;  3F5C B;  2REW A;  1ZDT A;  3MNP A;  2P4Y A;  4XTA A;  5EI1 A;  3HLV A;  4OZT E;  5DXQ A;  2ZXN A;  5HYK A;  2Z4J A;  1G5Y A;  3ET1 A;  4M8H A;  2QR9 A;  4MGD B;  4MGA A;  5GT4 A;  2Q8S A;  4M8E A;  2HAM A;  3CLD A;  1K7L A;  4REE A;  4DK7 A;  2Q7K A;  3ET2 A;  5E15 A;  2GL8 A;  3WTQ A;  5DTV A;  3VT6 A;  1U3R A;  1XQ3 A;  1T5Z A;  4MDD A;  1G50 A;  5AAU A;  5KRM A;  2PIR A;  2R6W A;  3HC6 A;  1X78 A;  3KPZ A;  5B5B A;  2AAX A;  3UUA A;  1U9E A;  3V4A A;  1RDT D;  3R5M A;  1XPC A;  4PWL A;  3AUQ A;  4K4J A;  4ZI1 A;  5I4V A;  4WHG A;  2ZNQ A;  2QMV A;  3MNO A;  1X7R A;  4RUO X;  4G1Y A;  4CI5 A;  1XP9 A;  3OZ0 A;  1NDE A;  5DXB B;  3GWX A;  4IV2 A;  4MGC A;  4S14 A;  1I7I A;  2Q59 A;  5ICK A;  3D24 A;  5DU5 A;  4BCR A;  5DI7 A;  2Q61 A;  4FHH A;  4MG8 B;  3UU7 B;  3Q95 B;  3JZC A;  2ZK4 A;  3W0G A;  3OGT A;  3OLS A;  4RUP A;  4TV1 B;  2ZVT A;  5KCU A;  4APU A;  4B7W A;  5L7E A;  3L1B A;  1NQ7 A;  1T73 A;  3D5F A;  3OKI A;  2VV1 A;  4OJ9 A;  5DIG A;  2AB2 A;  4EM9 A;  1EXX A;  3K8S A;  5DMC A;  3V9Y A;  4Q50 A;  3RY9 A;  5APH A;  3VRV A;  3X1I A;  5FQR A;  2QNV A;  2V0V A;  1NRL A;  5HJP B;  2ZKC A;  3FC6 A;  4OFU A;  2R40 D;  2ZBS A;  2XYX A;  3B0Q A;  5E1C A;  3KFC A;  3PCU A;  3X31 A;  1XAP A;  1TXI A;  3ADV A;  3D6D A;  4J26 A;  5JI0 D;  5DXR A;  2GPV A;  2OZ7 A;  2ATH A;  3V3E A;  3TX7 B;  2ZAS A;  1YP0 A;  5DID A;  2QW4 A;  1SKX A;  4RMD A;  2VV3 A;  5KRC A;  1OSV A;  4QE8 A;  1MZN A;  3OS9 A;  4ZNU A;  1X7B A;  2Q5S A;  1GWX A;  1T74 A;  2YAT A;  1I7G A;  2PIN A;  5KCT A;  3P88 A;  1NYX A;  5APK A;  3VSO A;  2Q7L A;  4LNX A;  4RZF A;  3AUN A;  3NSP A;  3PRG A;  4XI3 A;  4XUH A;  2R6Y A;  3UVV A;  1XNX A;  1Z95 A;  3HQ5 A;  3A3Z X;  2QXM A;  4A4W A;  4A4V A;  1K74 D;  3D57 A;  1Q4X A;  4KZI A;  2YHD A;  4R06 A;  3UP0 A;  3ERT A;  4Q13 A;  1LBD A;  3SP6 A;  2AO6 A;  2I4P A;  2YJA B;  4ZN7 A;  3FS1 A;  3V9V A;  1FM9 A;  4WVD A;  5AVL A;  3CDS A;  3ADS A;  2GIU A;  1T7T A;  2QH6 A;  3LBD A;  1YUC A;  4MGB A;  1Y0X X;  2JF9 A;  4OZT U;  4REF A;  5EC9 A;  2VST A;  3A9E B;  2ZK0 A;  4YPQ A;  5IAW A;  2NXX E;  3OS8 A;  1QKM A;  2HC4 A;  3QT0 A;  3TKM A;  2ZNO A;  5JJM B;  3E7C A;  4KZM A;  3G8I A;  1FCZ A;  1K4W A;  2PIP L;  5G45 A;  1R20 D;  1VJB A;  2AX6 A;  4N8R A;  3W0J A;  4PP3 A;  3B65 A;  5AZT A;  1DKF B;  2B23 A;  3GZ9 A;  3HOD A;  5KCW A;  2QA8 A;  1TFC A;  5HZC A;  3R8I A;  3WFF A;  1A52 A;  4XLD A;  2B1V A;  2J7Y A;  1XDK A;  3KDT A;  4NIE A;  3WT7 A;  1X76 A;  3R8A A;  3AZ1 A;  4DK8 A;  3VJS A;  5DWE A;  4MG9 B;  3LMP A;  4OAR A;  5LWP A;  3VT7 A;  3G0W A;  1IE9 A;  2XYJ A;  3FAL B;  3OOF A;  4WQP A;  5AAV B;  2FSZ A;  3AN3 A;  3A2H A;  5DRM A;  4CI4 A;  2BAW A;  1NQ1 A;  2PIO A;  2Q6J A;  5KRJ A;  4ZNV A;  3DCU A;  1RKH A;  1EXA A;  1ERR A;  3A40 X;  3O1D A;  3OMM A;  2PNU A;  3AUR A;  1UHL A;  4XAO A;  5DUH A;  2ACL B;  3WGP A;  1YMT A;  3ZRA A;  4DOS A;  5C4O A;  2JFA B;  2ZNP A;  4OHA A;  2GPP A;  4PPP A;  2QZO B;  4F9M A;  1T76 A;  3WFG A;  3E94 A;  2NV7 A;  3UUD B;  3VT8 A;  2AA2 A;  1R1K D;  3H52 A;  3K23 A;  4RMC A;  1RKG A;  2PKL A;  2AXA A;  5L7H A;  1FD0 A;  2OM9 A;  1QKU A;  5G3J A;  2G5O A;  4ZNH A;  5GID A;  1KV6 A;  4NUF A;  2P7A A;  2P15 A;  1FCX A;  5FQS A;  1T65 A;  4S0S A;  1XJ7 A;  4WLB A;  3PBA A;  2IHQ A;  4J5X A;  4N5G A;  4OK1 A;  4YNK A;  3F5C A;  4IVW A;  1RDT A;  3UUC A;  3AFR A;  4TUZ A;  5EJV A;  3VT3 A;  4MGD A;  4DQM A;  3P0U A;  2PIQ A;  3DZY A;  4WHF A;  2H79 A;  3D90 A;  2GPO A;  5AK2 A;  3WMH A;  5DP0 A;  5KR9 A;  5DZH A;  4Q0A C;  2FAI A;  2NW4 A;  1FM6 A;  4JGV A;  3K6P A;  4IA7 A;  3DCT A;  5DY8 A;  3OLF A;  3W5P A;  3AN4 A;  4ITF A;  5ACC A;  2NXX A;  1ERE A;  3GYU A;  4OJ4 A;  1I38 A;  3R5N A;  5SYZ A;  2ZNN A;  2PIW A;  3H0A D;  1UOM A;  5HYR A;  1PRG A;  3EYB A;  2QE4 A;  4LTW A;  5KRL A;  3DZY D;  3W0A A;  2Z4B A;  3CTB A;  1M7W A;  1Y0S A;  4EMA A;  1FM6 D;  4XT9 A;  4IW8 A;  4ZO1 X;  2YFE A;  1X7J A;  4IV4 A;  5FQT A;  1LV2 A;  3BC5 A;  2J14 A;  3IMY A;  4RWV A;  2W8Y A;  3R29 A;  5DWG A;  1XIU A;  5DWL A;  2I4Z A;  5ETH A;  4G20 A;  3W0H A;  5DXB A;  2Q6S A;  2AMA A;  5KRO A;  3OSI A;  3VT5 A;  3E00 D;  5E19 A;  4Y29 A;  2VV4 A;  3RVF A;  4JYI A;  2R40 A;  1E3G A;  4OH6 A;  3MNE A;  2HAS A;  2HB7 A;  1SQN A;  2FVJ A;  3B0T A;  3JZB A;  4R2U A;  1Z5X E;  3Q95 A;  5DKE A;  5AVI A;  3VHW A;  2HB8 A;  2ZK6 A;  2Q59 B;  4TV1 A;  3VJH A;  1XB7 A;  1PQC A;  5L11 A;  4OIV A;  3V3Q A;  2H77 A;  4E4K A;  5FQP A;  1S0Z A;  3A78 A;  4NB6 A;  3VTB A;  3VI8 A;  4DM6 A;  4S0T A;  2AX8 A;  2VV1 B;  3NSQ A;  3UP3 A;  1YY4 A;  3OMO A;  3L3X A;  1ZDU A;  2O9I A;  3HZF A;  4POJ A;  1PDU A;  4RME A;  2GWX A;  4NY9 A;  4ONI A;  4OZR U;  4WPF A;  2YLP A;  3ADX A;  3DZU D;  2HWR A;  1K74 A;  3FC6 B;  1HG4 A;  1XLS A;  3WT6 A;  4DMA A;  4RAK A;  2GTK A;  4ITE A;  3OSA A;  4MG7 A;  4HEE X;  5GIE A;  1PK5 A;  1QKN A;  5EGV A;  1N83 A;  4G21 A;  2OUZ A;  5AWJ A;  3VRU A;  1NAV A;  3VHU A;  1PZL A;  2I0G A;  2POB A;  2YLO A;  5DSH A;  2QSE A;  4PPS A;  5DUE A;  4N73 A;  1T7R A;  2NPA A;  4OGH A;  1N46 A;  3BQD A;  5KRI A;  4XHD A;  1XOW A;  3VRW A;  4ZNT A;  3IXP D;  5DXP A;  2ZLA A;  1MV9 A;  1H9U A;  2A3I A;  5AWK A;  4ZNS A;  1S0X A;  4X1F A;  5KCD A;  2QTU A;  3CWD A;  3VN2 A;  4QM0 A;  1R20 A;  5L7G A;  4G2I A;  4J5W A;  2XHS A;  3KBA A;  3UVV B;  5G43 A;  3OOK A;  4ZNW A;  3OS8 C;  5E0W A;  5HJS A;  1FBY A;  2JJ3 A;  1FCY A;  4POH A;  2O4R A;  3OLL A;  1NAX A;  5DXE A;  2PJL A;  2POG A;  3ET3 A;  4FNE A;  1QKT A;  2EWP A;  4ZO1 B;  5DX3 A;  4ZJR A;  1NQ0 A;  1S9P A;  1XV9 A;  1DB1 A;  4FHI A;  3KYT A;  5DZ0 A;  3W0C A;  4OFR A;  3G9E A;  5DVC A;  2J7X A;  3GBK A;  1XZX X;  3L3Z A;  5F9B A;  3B0R A;  1OVL A;  3CQV A;  1ZH7 A;  1U3Q A;  4RZG A;  3V49 A;  2AA6 A;  4PF3 A;  3HO0 A;  2QA8 B;  2J4A A;  1M2Z A;  3ZR7 A;  1R1K A;  5K13 A;  4MG9 A;  1XDK B;  5DYD A;  5DZI A;  5A86 A;  2ABI A;  2AMB A;  2ZK2 A;  4P6X A;  4YMQ A;  5AAV A;  3AZ2 A;  3X1H A;  1XVP A;  3FLI A;  3OMK A;  5DLR A;  3NOA A;  5E0X A;  2GPU A;  5AYG A;  2I0J A;  2OAX A;  3PO9 A;  1T7F A;  3CDP A;  3HM1 A;  4RFW A;  2BJ4 A;  3OZJ A;  5KCE A;  4IA3 A;  4QK4 A;  4QE6 A;  4OLM A;  5E7V A;  3G8O A;  1ILG A;  5JY3 A;  2JFA A;  2OVM A;  4LBD A;  4PP5 A;  1NQ2 A;  5CJ6 A;  5G5W A;  2Q5G A;  3V9T A;  1YJE A;  1ZGY A;  3IPS A;  5KRK A;  3GYT A;  1YIM A;  4UDC A;  3VSP A;  1P93 A;  2QAB A;  1YIN A;  3BEJ A;  4J5X C;  5EIT A;  3DR1 A;  4E4Q A;  1GS4 A;  1M13 A;  3RUT A;  3ADT A;  3R2A A;  2AA5 A;  2HCD A;  3ADU A;  3CS6 A;  4IS8 A;  1S9Q A;  1WM0 X;  4OIU A;  4OEY A;  1X7E A;  4JYH A;  1MVC A;  3WWR A;  3WT5 A;  4K6I A;  3H0A A;  5DIE A;  2PIT A;  3GWS X;  1G1U A;  3CJW A;  4IU7 A;  4X1G A;  4XUM A;  5C4S A;  3VHV A;  3VJT A;  1U3S A;  2ZMI A;  1ILH A;  5G44 A;  4MGA B;  4IUI A;  1XNN A;  2HFP A;  2AYR A;  3VTD A;  1SJ0 A;  2Q1V A;  1ZAF A;  3FXV A;  1PCG A;  4PLD A;  4TUZ B;  1N4H A;  2F4B A;  5EHJ A;  5KCF A;  3FUR A;  3OKH A;  3CS8 A;  2QA6 A;  5DZ3 A;  1T79 A;  4OKB A;  3DT3 A;  5G46 A;  3E00 A;  5DWJ A;  1ZEO A;  2LBD A;  2HWQ A;  4RE8 A;  2XKW A;  5DXK A;  5KYJ A;  2Q3Y A;  3UUA B;  5DK9 A;  4IWF A;  4YT1 A;  1IE8 A;  5APJ A;  4J24 A;  1R5K A;  4O8F A;  2Q5P A;  3A2J A;  2ZLC A;  2QXS A;  4UDB A;  2VSR A;  5DV8 A;  3IPU A;  1XP6 A;  4RUJ A;  4JAZ A;  4S15 A;  1E3K A;  4MG8 A;  3UU7 A;  5H1E A;  1ZUC A;  2PIV A;  3P89 A;  4IW6 A;  4IA2 A;  1NHZ A;  4OEZ A;  3F7D A;  2HBH A;  3ZRB A;  2Q6R A;  4IQR A;  1Y9R A;  3ILZ A;  2QPY A;  5DVS A;  1YYE A;  3DZU A;  3DY6 A;  2ZK5 A;  2I4J A;  3X36 A;  2Q60 A;  4OIL A;  1OSH A;  5KRF A;  1I37 A;  3RLL A;  2VV4 B;  2HVC A;  1L2I A;  2G0H A;  4G1Z A;  3U9Q A;  5KD9 A;  5KYA A;  5DKS A;  4QJR A;  5DRJ A;  5DUG A;  2ZY0 A;  2IOG A;  2Q7I A;  4HLW A;  5DV6 A;  3TY0 A;  5HJP A;  2AWH A;  3L0L A;  2YLY A;  4ZN9 A;  1L2J A;  1KNU A;  3ERD A;  4A2J A;  3HC5 A;  3W5R A;  1HJ1 A;  2ZXM A;  3IXP A;  2ZK3 A;  5HCV A;  4MG5 A;  1RJK A;  1NUO A;  3W5T A;  3VTC A;  5IXK A;  3KMZ A;  5DKG A;  4RZE A;  3T03 A;  3KMR A;  4OKT A;  3L0J A;  5DWI A;  4DOR A;  2ZMJ A;  3AZ3 A;  3B68 A;  3ET0 A;  1RK3 A;  3P8X A;  2ZMH A;  1YOW A;  3L0E A;  4L98 A;  2ZFX A;  3B5R A;  4IVY A;  4LNW A;  1BSX A;  1ZKY A;  2P1V A;  3AX8 A;  4MG7 B;  4FGY A;  4UDA A;  2YJD A;  4UDD A;  5C4T A;  3CS4 A;  2YLQ A;  3FUG A;  2AX7 A;  4L96 A;  1G2N A;  4J5W C;  3L03 A;  3HVL A;  4OC7 A;  5G42 A;  4PRG A;  2O4J A;  2PIX A;  5FQV A;  5DL4 A;  2P7Z A;  2OVH A;  3WJ4 A;  3GD2 A;  1KKQ A;  4N1Y A;  2B1Z A;  5DMF A;  3SP9 A;  4PLE A;  4G2H A;  4G1D A;  4DM8 A;  2P7G A;  3PEQ A;  2PRG A;  2Q1H A;  5GIC A;  4NQA B;  2Q70 A;  4PVU A;  1XP1 A;  5DV3 A;  1T63 A;  3OMQ A;  2E2R A;  4E2J A;  3A9E A;  5IZ0 A;  3OMP A;  3S9S A;  1UPV A;  3IPQ A;  3WJ5 A;  3M7R A;  2AM9 A;  4MGB B;  5JJM A;  1YA3 A;  3RUU A;  2PIU A;  3IA6 A;  4JL4 A;  2AA7 A;  3PLZ A;  4OJB A;  4OKW A;  4PXM A;  4OED A;  3B66 A;  2OCF A;  1GWR A;  1R6G A;  1DKF A;  2ZXZ A;  4K7A A;  5C4U A;  4FN9 A;  5DZ1 A;  5DX3 B;  3R8D A;  3O1E A;  5DVV A;  5KRA A;  4OKX A;  3VT9 A;  1XV9 B;  3SZ1 A;  5B41 A;  2QGT A;  3B3K A;  1T7M A;  3W0I A;  4LSJ A;  2P54 A;  2Q7J A;  5DXM A;  3TKC A;  1FM9 D;  3N00 A;  3ADW A;  4ZOM A;  3FAL A;  3B67 A;  1S19 A;  4OH5 A;  3OSW A;  3FEJ A;  4JYG A;  5DXG A;  5AZV A;  3KWY A;  2QGW A;  4R6S A;  5LGA A;  4KZJ A;  3VRT A;  1PQ9 A;  1OVL B;  5E14 A;  5DYB A;  2VV0 A;  3FEI A;  2ZL9 A;  1GWQ A;  1Z5X U;  2ACL A;  1SR7 A;  4OZR E;  3GN8 A;  2QZO A;  3OAP A;  4OEA A;  2VV2 A;  1UHL B;  5DKB A;  3VJI A;  2G44 A;  3UUD A;  1XVP B;  3K22 A;  4PP6 A;  2HAR A;  1YOK A;  1UPW A;  4QL8 A;  3RLJ A;  2BJ4 B;  2IOK A;  3ZQT A;  2ZK1 A;  1OT7 A;  4P6W A;  2B50 A;  3A2I A;  2G0G A;  3B0W A;  3W5Q A;  2AX9 A;  1XQC A;  2V7C A;  4CSJ A;  5KCC A;  5M96 A;  2P1T A;  3VT4 A;  3KDU A;  3KMG A;  5KRH A;  1A28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...