3KBAA

Progesterone receptor bound to sulfonamide pyrrolidine partial agonist
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
251
structure length
243
Chain Sequence
QLIPPLINLLMSIEPDVIYAGHDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKEFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Improving the developability profile of pyrrolidine progesterone receptor partial agonists.
pubmed doi rcsb
molecule keywords Progesterone receptor
molecule tags Transcription
source organism Homo sapiens
total genus 93
structure length 243
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3kbaA00
5DP0A 1XQCA 3OLSA 3OS9A 5DWEA 3VN2A 2ATHA 3GZ9A 4NIEA 5DU5A 3ZR7A 2GPPA 4LBDA 5DWJA 5DXGA 5KYAA 3PO9A 4G2HA 1A52A 5JI0D 1NAVA 3R8AA 5G46A 1U3SA 1NYXA 2ZNQA 2HBHA 2PIUA 1NAXA 4WPFA 5KRAA 4YMQA 3WWRA 4DM8A 5I4VA 4NY9A 5KCUA 3CTBA 4PVUA 1T7TA 5DYBA 2HB8A 2Q59A 4G20A 3B0WA 3OS8C 3F7DA 5HJSA 3UVVA 4P6XA 2Q61A 2GPVA 5DIEA 5DLRA 2GP7A 3IPQA 5DUHA 4PPSA 3P8XA 3MNPA 4EMAA 1X78A 5E7VA 3VT6A 5DSHA 2Q60A 3BQDA 3VI8A 4JGVA 4YPQA 2AX9A 1M2ZA 3AN3A 1T5ZA 4OEYA 3CJWA 3ET1A 3UUDB 3H0AA 2NXXE 4IW8A 4JL4A 3WT7A 3WT6A 2HARA 3R8DA 5LWPA 4S15A 1SKXA 2OM9A 2VV1B 3NSPA 4ZNUA 5DXMA 1U3QA 1YINA 3FC6B 3L3XA 3NSQA 3VT4A 4X1GA 1FCYA 4PPPA 4R6SA 2P1VA 4B7WA 3VTBA 2PIQA 2PIWA 4ZN7A 4RZEA 1Z5XE 1PQ6A 2AXAA 4ZNSA 3ET2A 1Y0XX 2JFAB 2YLYA 4FNEA 2POGA 5DWLA 1XZXX 1KV6A 5DZHA 3S9SA 5DXPA 2ZK6A 5ICKA 2AA5A 4UDCA 5E0XA 5DY8A 5C4OA 4MGCA 2NXXA 3PLZA 3KFCA 1M7WA 1FM9A 3D90A 1S0ZA 5DK9A 1YYEA 3B1MA 3DR1A 4OKTA 1QKTA 1K4WA 2Q5SA 2ZMJA 3A2IA 4HEEX 4OGHA 5FQTA 2XYJA 3AZ3A 2AA2A 3FUGA 2QH6A 3LBDA 4J5WC 3P89A 3HZFA 1M13A 4A4WA 4MG8B 3OOFA 5DUEA 1EXAA 4PWLA 3W0YA 4XUHA 3VT5A 1VJBA 5EI1A 4ZN9A 1PK5A 4Y29A 4HLWA 2YFEA 3JZCA 4ZO1X 2QA8A 3ADUA 1UHLB 4IA2A 1NQ1A 3B65A 4OZTE 4R06A 3U9QA 1DB1A 3W0AA 3WMHA 1TFCA 1ILHA 1T74A 1XLSE 5EITA 2HWRA 3IPSA 4ONIA 4MG7B 1LBDA 3ERDA 3IA6A 4K4JA 1XJ7A 3KPZA 3HLVA 2Q1HA 3OMQA 2AX6A 4MGAA 1NHZA 3PCUA 2O4JA 2YJAB 3K22A 2Q7LA 3ADSA 2P1UA 4OZRE 3OZJA 3M7RA 4KZMA 5DXBA 4IWCA 4PLEA 4PXMA 4RMDA 4IS8A 4OH5A 2Q1VA 1XP6A 2ZK4A 3G8IA 1XP1A 1YIMA 4G1DA 4OKWA 4Q13A 5DIGA 3OMPA 2Q3YA 3D5FA 4E2JA 5EGVA 2I4ZA 2YHDA 1EREA 1QKNA 1G2NA 2P54A 1XLSA 3OKIA 4RZFA 2ACLA 3V9TA 2W8YA 1MV9A 3W5QA 2HFPA 2G0GA 4TUZA 3RLJA 5KCEA 2YJDA 1NQ0A 1XB7A 3HC5A 3IMYA 4XHDA 5AAVB 2GPOA 4JYGA 2ZNOA 1Z5XU 2AMAA 3VJTA 3IXPD 5DVCA 1NQ7A 5E19A 5G44A 1T73A 4DM6A 4ZJRA 1X7JA 2QABA 2VSTA 3OKHA 3R2AA 3V3EA 3HM1A 3VTCA 4DOSA 5B5BA 2QGWA 5JJMB 4RMCA 3TY0A 1SR7A 2Q70A 4WLBA 3VRUA 1H9UA 1TXIA 2PJLA 3KBAA 3X1IA 5M96A 4IA3A 5DZIA 3SP9A 3UUCA 3D57A 1XNNA 4G1ZA 5IXKA 5KRHA 4BCRA 2QMVA 2F4BA 2B1VA 2QXMA 2OVMA 3VSPA 3CS6A 1Q4XA 4TV1B 5E0WA 2QGTA 2HCDA 1GWQA 1WM0X 5KROA 4FHHA 2AX8A 5IZ0A 2Q6RA 2VV2A 4L96A 4OKBA 3E00D 3DCTA 2A3IA 3RVFA 3L1BA 3EYBA 4IW6A 3T03A 3R29A 4OJBA 5DI7A 5L7EA 1XVPB 3W5PA 4LTWA 5KCTA 3WFFA 5E15A 4MGBB 3WT5A 2REWA 4OZRU 4OC7A 3HO0A 1ERRA 1UPWA 1G5YA 2VV0A 3Q95B 5KCWA 3KMZA 2I0JA 4XLDA 5AZTA 4CI5A 3AUQA 3B5RA 3FLIA 5HJPA 4IVYA 5DX3B 5AYGA 4YNKA 2ZBSA 1R20D 5DVVA 5KCCA 5DWGA 2AWHA 3KMRA 4MG9A 5A86A 4IV4A 3V3QA 3GYUA 5GT4A 2P1TA 4Q0AC 4IQRA 4JYIA 3VJSA 5C4UA 4JAZA 5B41A 1T7FA 3A9EA 4MDDA 1FM6D 1S9QA 3JZBA 2QW4A 5G43A 3UU7A 1FD0A 2BJ4A 3TKCA 2BAWA 3KWYA 1K74D 4MG6A 2YLQA 4ZJWA 4RUPA 3F5CB 1Z95A 3CWDA 3OAPA 2Q8SA 4XTAA 5AAUA 3CDPA 1RKGA 3GWSX 2PINA 2QZOB 2ZVTA 4E4QA 1Y0SA 2GL8A 2PNUA 1SJ0A 4OIUA 3L0EA 5C4SA 1XDKA 5G42A 2NW4A 4QJRA 5DV6A 5DZ3A 3DY6A 4LNWA 3RY9A 1T7RA 1MVCA 3HODA 4QK4A 3W0JA 1I37A 2OCFA 3W0HA 1RDTD 1ZUCA 2QNVA 2YLPA 4JYHA 2J7YA 3B3KA 2R6YA 3VSOA 2ZLCA 3FALA 4FGYA 5DXRA 4MGDB 1QKMA 1OVLA 1R5KA 2XYWA 2ZXNA 4CSJA 3GYTA 5HYKA 1R6GA 3AFRA 4S0SA 5G5WA 2Q5PA 4APUA 2OAXA 4N8RA 1EXXA 3VHWA 4WHGA 3RUTA 4CI4A 4K6IA 3A40X 2ZY0A 5KRCA 2Q5GA 3G0WA 4J26A 5DIDA 1T76A 3SP6A 4OIVA 4PLDA 4WVDA 1L2JA 3VT9A 4PP3A 1NDEA 3RLLA 2VV3A 1U9EA 3ILZA 3P88A 5SYZA 1HJ1A 1KNUA 1N83A 3DCUA 4OEZA 2ABIA 1E3KA 3R5MA 3CS8A 3FURA 3OMMA 4OJ9A 4MG5A 4RE8A 3WTQA 3L03A 3UUAA 1YMTA 3E7CA 2VV4A 2AB2A 5CJ6A 5DZ1A 5APJA 3PRGA 3WJ4A 2FSZA 5KCDA 4IVWA 2QSEA 1HG4A 2ZK0A 5H1EA 5KRIA 2J4AA 4POJA 1DKFA 1PQ9A 2GIUA 3R8IA 3B0TA 1NRLA 1R1KD 2Q59B 2ZNPA 3IXPA 3W0GA 3UVVB 2FVJA 3O1EA 1IE8A 1MZNA 2E2RA 5FQRA 3OLFA 4A2JA 3VJHA 5KCFA 5DMCA 5DYDA 4PRGA 2NPAA 3H52A 3VHUA 1PZLA 1XV9A 1ZDTA 2PIOA 1N46A 1X7EA 1T65A 1T7MA 3R5NA 4N1YA 4YT1A 4WHFA 2IOKA 3W0CA 2ZFXA 5ETHA 2OUZA 3KYTA 5ACCA 3PEQA 5FQPA 4KZJA 2PIPL 1FM9D 3AN4A 5G3JA 4FHIA 2ZK5A 3A3ZX 2Q7JA 1ZKYA 3OS8A 5KRJA 5AWKA 5DMFA 4REEA 4ITFA 2ZLAA 2P7ZA 2LBDA 3K8SA 3E00A 3PBAA 2O4RA 5GIDA 2FAIA 3CQVA 1S19A 1X76A 1PCGA 2PIVA 4ZO1B 2YLOA 3OSIA 4OILA 4XAOA 4IWFA 4OEDA 4PP5A 4L98A 2AO6A 3RUUA 1G1UA 4ZI1A 2QE4A 1FBYA 5DKEA 1G50A 1PDUA 2HB7A 4UDBA 2AX7A 3WJ5A 2G5OA 2IHQA 4OEAA 4LSJA 3UUDA 4REFA 4QL8A 4XT9A 4J5XC 3VRTA 1R20A 4M8EA 1OSHA 3VT7A 5HZCA 5L11A 2PRGA 1T79A 2G44A 3AURA 3V9VA 2VV1A 3ZQTA 2HVCA 2Q7IA 3AZ2A 3FC6A 2QA8B 5KRKA 5K13A 1I7IA 5E1CA 1FM6A 2ZK1A 4J24A 3DZYD 2R40D 1YA3A 1K74A 2I4JA 3UP3A 1I7GA 2JFAA 5EJVA 3L0LA 3OMKA 2P15A 4MGAB 1OSVA 4OKXA 3O1DA 1RJKA 2J14A 5DXQA 4J5WA 5KRMA 5L7GA 4RMEA 2QR9A 3SZ1A 4NUFA 4RUOX 3DZUD 5DXBB 1K7LA 2POBA 5DKSA 4EM9A 3OOKA 2J7XA 1I38A 2GTKA 2PIXA 3A78A 3KDUA 2PITA 3FS1A 3QT0A 5KRFA 4OLMA 3OZ0A 3OLLA 2ACLB 4MG8A 2I4PA 3OSAA 3X36A 5DRJA 4TUZB 5F9BA 2GWXA 2B1ZA 3V49A 2OVHA 3ET0A 1UHLA 2EWPA 1ILGA 5DRMA 4OH6A 2AAXA 4POHA 5JY3A 5AVLA 3ZRAA 3B66A 3GWXA 4MG7A 3AX8A 4IUIA 1P8DA 4IA7A 3A2HA 3ADWA 4RUJA 3TX7B 5FQSA 5DXKA 3ET3A 3HC6A 3IPUA 2HC4A 3OSWA 5AK2A 1E3GA 2AM9A 4O8FA 1XAPA 1A28A 1NQ2A 4E4KA 3WFGA 3BC5A 5DV3A 2ZXMA 2H77A 3FEIA 2VSRA 1GS4A 4N5GA 2ZKCA 5GIEA 2IOGA 5AZVA 2ZNNA 1SQNA 2P7AA 1YY4A 3VRWA 5E14A 3VRVA 1YOKA 1ZH7A 2QA6A 5AAVA 4NQAB 1RKHA 4DQMA 4LNXA 1R1KA 3W0IA 5APHA 3X1HA 2NV7A 3UP0A 2QTUA 1N4HA 1XP9A 2V0VA 1ZEOA 3AZ1A 4IA1A 5DV8A 3CS4A 3D24A 5L7HA 3WGPA 4DK8A 1YOWA 5JJMA 1U3RA 3V9YA 1T63A 2ZK3A 2ZK2A 3P0UA 5G45A 3G8OA 5KRLA 1X7RA 4N73A 4ZNHA 3B0RA 5LGAA 3W5TA 2Q6JA 3VTDA 2HAMA 2Q7KA 4J5XA 4ITEA 1S0XA 4G2IA 5HJPB 4A4VA 2JJ3A 3L3ZA 3ZRBA 3H0AD 4MG9B 1QKUA 3V4AA 4TV1A 4OFUA 4QE6A 5DL4A 3L0JA 1Y9RA 5IAWA 2P4YA 3A9EB 1UPVA 3ADVA 1ZDUA 2B23A 3UU7B 2BJ4B 1XOWA 3A2JA 5FQVA 2Z4JA 3KMGA 5DTVA 2H79A 5DKBA 5AVIA 1YP0A 1ZGYA 3MNOA 4M8HA 1XQ3A 2HWQA 1LV2A 2GPUA 3CLDA 5DZ0A 5DKGA 4K7AA 1XVPA 3CDSA 3NOAA 4DMAA 4MGBA 5DVSA 2Z4BA 2ZMHA 1IE9A 3B0QA 4F9MA 2ZL9A 2ZMIA 3Q95A 1ZAFA 2PKLA 2AA6A 4ZNTA 3GD2A 1XDKB 4Q50A 4S14A 1YJEA 2G0HA 4XI3A 4WQPA 5DX3A 5HCVA 5KD9A 2OZ7A 1GWXA 4DORA 2QPYA 2P7GA 4OFRA 3D6DA 4PF3A 4IV2A 1S9PA 4OJ4A 5AWJA 2B50A 2V7CA 2AYRA 3FALB 3K6PA 4PP6A 1OVLB 4FN9A 4RWVA 4RZGA 3VT8A 1UOMA 3DZYA 2R40A 1P93A 4G21A 3AUNA 3ADTA 3OMOA 5DXEA 2I0GA 2HASA 3HQ5A 4R2UA 5DUGA 3MNEA 3F5CA 4ZOMA 3TKMA 4UDDA 3VJIA 1X7BA 1PRGA 3DZUA 2QZOA 4QE8A 3G9EA 1YUCA 1OT7A 2AA7A 2ZXZA 3E94A 1XIUA 1XPCA 3FEJA 4ZNWA 1KKQA 1RK3A 3ADXA 4RFWA 4ZNVA 3B67A 1L2IA 2XHSA 5APKA 2Q6SA 4IU7A 2JF9A 4S0TA 3N00A 3LMPA 3X31A 2AMBA 4XUMA 3UUAB 3VHVA 4UDAA 2VV4B 3FXVA 2PIRA 5DWIA 2R6WA 4G1YA 4KZIA 3B68A 2ZASA 4MGDA 3OGTA 1XNXA 1NUOA 1DKFB 3K23A 3ERTA 3BEJA 2O9IA 4RAKA 5HYRA 4OARA 5EC9A 1BSXA 3GBKA 3HVLA 3W5RA 2XKWA 4OZTU 1PQCA 4P6WA 1FCXA 1GWRA 4OHAA 4OK1A 5GICA 5C4TA 2XYXA 1FCZA 3DT3A 5EHJA 4DK7A 5KYJA 3GN8A 3KDTA 4X1FA 1XV9B 2QXSA 4QM0A 3VT3A 4NB6A 2YATA 1RDTA 5KR9A
chains in the Genus database with same CATH superfamily
5DP0A 1XQCA 3OLSA 3OS9A 5DWEA 3VN2A 2ATHA 3GZ9A 4NIEA 5DU5A 3ZR7A 2GPPA 4LBDA 5DWJA 5DXGA 5KYAA 3PO9A 4G2HA 1A52A 5JI0D 1NAVA 3R8AA 5G46A 1U3SA 1NYXA 2ZNQA 2HBHA 2PIUA 1NAXA 4WPFA 5KRAA 4YMQA 3WWRA 4DM8A 5I4VA 4NY9A 5KCUA 3CTBA 4PVUA 1T7TA 5DYBA 2HB8A 2Q59A 4G20A 3B0WA 3OS8C 3F7DA 5HJSA 3UVVA 4P6XA 2Q61A 2GPVA 5DIEA 5DLRA 2GP7A 3IPQA 5DUHA 4PPSA 3P8XA 3MNPA 4EMAA 1X78A 5E7VA 3VT6A 5DSHA 2Q60A 3BQDA 3VI8A 4JGVA 4YPQA 2AX9A 1M2ZA 3AN3A 1T5ZA 4OEYA 3CJWA 3ET1A 3UUDB 3H0AA 2NXXE 4IW8A 4JL4A 3WT7A 3WT6A 2HARA 3R8DA 5LWPA 4S15A 1SKXA 2OM9A 2VV1B 3NSPA 4ZNUA 5DXMA 1U3QA 1YINA 3FC6B 3L3XA 3NSQA 3VT4A 4X1GA 1FCYA 4PPPA 4R6SA 2P1VA 4B7WA 3VTBA 2PIQA 2PIWA 4ZN7A 4RZEA 1Z5XE 1PQ6A 2AXAA 4ZNSA 3ET2A 1Y0XX 2JFAB 2YLYA 4FNEA 2POGA 5DWLA 1XZXX 1KV6A 5DZHA 3S9SA 5DXPA 2ZK6A 5ICKA 2AA5A 4UDCA 5E0XA 5DY8A 5C4OA 4MGCA 2NXXA 3PLZA 3KFCA 1M7WA 1FM9A 3D90A 1S0ZA 5DK9A 1YYEA 3B1MA 3DR1A 4OKTA 1QKTA 1K4WA 2Q5SA 2ZMJA 3A2IA 4HEEX 4OGHA 5FQTA 2XYJA 3AZ3A 2AA2A 3FUGA 2QH6A 3LBDA 4J5WC 3P89A 3HZFA 1M13A 4A4WA 4MG8B 3OOFA 5DUEA 1EXAA 4PWLA 3W0YA 4XUHA 3VT5A 1VJBA 5EI1A 4ZN9A 1PK5A 4Y29A 4HLWA 2YFEA 3JZCA 4ZO1X 2QA8A 3ADUA 1UHLB 4IA2A 1NQ1A 3B65A 4OZTE 4R06A 3U9QA 1DB1A 3W0AA 3WMHA 1TFCA 1ILHA 1T74A 1XLSE 5EITA 2HWRA 3IPSA 4ONIA 4MG7B 1LBDA 3ERDA 3IA6A 4K4JA 1XJ7A 3KPZA 3HLVA 2Q1HA 3OMQA 2AX6A 4MGAA 1NHZA 3PCUA 2O4JA 2YJAB 3K22A 2Q7LA 3ADSA 2P1UA 4OZRE 3OZJA 3M7RA 4KZMA 5DXBA 4IWCA 4PLEA 4PXMA 4RMDA 4IS8A 4OH5A 2Q1VA 1XP6A 2ZK4A 3G8IA 1XP1A 1YIMA 4G1DA 4OKWA 4Q13A 5DIGA 3OMPA 2Q3YA 3D5FA 4E2JA 5EGVA 2I4ZA 2YHDA 1EREA 1QKNA 1G2NA 2P54A 1XLSA 3OKIA 4RZFA 2ACLA 3V9TA 2W8YA 1MV9A 3W5QA 2HFPA 2G0GA 4TUZA 3RLJA 5KCEA 2YJDA 1NQ0A 1XB7A 3HC5A 3IMYA 4XHDA 5AAVB 2GPOA 4JYGA 2ZNOA 1Z5XU 2AMAA 3VJTA 3IXPD 5DVCA 1NQ7A 5E19A 5G44A 1T73A 4DM6A 4ZJRA 1X7JA 2QABA 2VSTA 3OKHA 3R2AA 3V3EA 3HM1A 3VTCA 4DOSA 5B5BA 2QGWA 5JJMB 4RMCA 3TY0A 1SR7A 2Q70A 4WLBA 3VRUA 1H9UA 1TXIA 2PJLA 3KBAA 3X1IA 5M96A 4IA3A 5DZIA 3SP9A 3UUCA 3D57A 1XNNA 4G1ZA 5IXKA 5KRHA 4BCRA 2QMVA 2F4BA 2B1VA 2QXMA 2OVMA 3VSPA 3CS6A 1Q4XA 4TV1B 5E0WA 2QGTA 2HCDA 1GWQA 1WM0X 5KROA 4FHHA 2AX8A 5IZ0A 2Q6RA 2VV2A 4L96A 4OKBA 3E00D 3DCTA 2A3IA 3RVFA 3L1BA 3EYBA 4IW6A 3T03A 3R29A 4OJBA 5DI7A 5L7EA 1XVPB 3W5PA 4LTWA 5KCTA 3WFFA 5E15A 4MGBB 3WT5A 2REWA 4OZRU 4OC7A 3HO0A 1ERRA 1UPWA 1G5YA 2VV0A 3Q95B 5KCWA 3KMZA 2I0JA 4XLDA 5AZTA 4CI5A 3AUQA 3B5RA 3FLIA 5HJPA 4IVYA 5DX3B 5AYGA 4YNKA 2ZBSA 1R20D 5DVVA 5KCCA 5DWGA 2AWHA 3KMRA 4MG9A 5A86A 4IV4A 3V3QA 3GYUA 5GT4A 2P1TA 4Q0AC 4IQRA 4JYIA 3VJSA 5C4UA 4JAZA 5B41A 1T7FA 3A9EA 4MDDA 1FM6D 1S9QA 3JZBA 2QW4A 5G43A 3UU7A 1FD0A 2BJ4A 3TKCA 2BAWA 3KWYA 1K74D 4MG6A 2YLQA 4ZJWA 4RUPA 3F5CB 1Z95A 3CWDA 3OAPA 2Q8SA 4XTAA 5AAUA 3CDPA 1RKGA 3GWSX 2PINA 2QZOB 2ZVTA 4E4QA 1Y0SA 2GL8A 2PNUA 1SJ0A 4OIUA 3L0EA 5C4SA 1XDKA 5G42A 2NW4A 4QJRA 5DV6A 5DZ3A 3DY6A 4LNWA 3RY9A 1T7RA 1MVCA 3HODA 4QK4A 3W0JA 1I37A 2OCFA 3W0HA 1RDTD 1ZUCA 2QNVA 2YLPA 4JYHA 2J7YA 3B3KA 2R6YA 3VSOA 2ZLCA 3FALA 4FGYA 5DXRA 4MGDB 1QKMA 1OVLA 1R5KA 2XYWA 2ZXNA 4CSJA 3GYTA 5HYKA 1R6GA 3AFRA 4S0SA 5G5WA 2Q5PA 4APUA 2OAXA 4N8RA 1EXXA 3VHWA 4WHGA 3RUTA 4CI4A 4K6IA 3A40X 2ZY0A 5KRCA 2Q5GA 3G0WA 4J26A 5DIDA 1T76A 3SP6A 4OIVA 4PLDA 4WVDA 1L2JA 3VT9A 4PP3A 1NDEA 3RLLA 2VV3A 1U9EA 3ILZA 3P88A 5SYZA 1HJ1A 1KNUA 1N83A 3DCUA 4OEZA 2ABIA 1E3KA 3R5MA 3CS8A 3FURA 3OMMA 4OJ9A 4MG5A 4RE8A 3WTQA 3L03A 3UUAA 1YMTA 3E7CA 2VV4A 2AB2A 5CJ6A 5DZ1A 5APJA 3PRGA 3WJ4A 2FSZA 5KCDA 4IVWA 2QSEA 1HG4A 2ZK0A 5H1EA 5KRIA 2J4AA 4POJA 1DKFA 1PQ9A 2GIUA 3R8IA 3B0TA 1NRLA 1R1KD 2Q59B 2ZNPA 3IXPA 3W0GA 3UVVB 2FVJA 3O1EA 1IE8A 1MZNA 2E2RA 5FQRA 3OLFA 4A2JA 3VJHA 5KCFA 5DMCA 5DYDA 4PRGA 2NPAA 3H52A 3VHUA 1PZLA 1XV9A 1ZDTA 2PIOA 1N46A 1X7EA 1T65A 1T7MA 3R5NA 4N1YA 4YT1A 4WHFA 2IOKA 3W0CA 2ZFXA 5ETHA 2OUZA 3KYTA 5ACCA 3PEQA 5FQPA 4KZJA 2PIPL 1FM9D 3AN4A 5G3JA 4FHIA 2ZK5A 3A3ZX 2Q7JA 1ZKYA 3OS8A 5KRJA 5AWKA 5DMFA 4REEA 4ITFA 2ZLAA 2P7ZA 2LBDA 3K8SA 3E00A 3PBAA 2O4RA 5GIDA 2FAIA 3CQVA 1S19A 1X76A 1PCGA 2PIVA 4ZO1B 2YLOA 3OSIA 4OILA 4XAOA 4IWFA 4OEDA 4PP5A 4L98A 2AO6A 3RUUA 1G1UA 4ZI1A 2QE4A 1FBYA 5DKEA 1G50A 1PDUA 2HB7A 4UDBA 2AX7A 3WJ5A 2G5OA 2IHQA 4OEAA 4LSJA 3UUDA 4REFA 4QL8A 4XT9A 4J5XC 3VRTA 1R20A 4M8EA 1OSHA 3VT7A 5HZCA 5L11A 2PRGA 1T79A 2G44A 3AURA 3V9VA 2VV1A 3ZQTA 2HVCA 2Q7IA 3AZ2A 3FC6A 2QA8B 5KRKA 5K13A 1I7IA 5E1CA 1FM6A 2ZK1A 4J24A 3DZYD 2R40D 1YA3A 1K74A 2I4JA 3UP3A 1I7GA 2JFAA 5EJVA 3L0LA 3OMKA 2P15A 4MGAB 1OSVA 4OKXA 3O1DA 1RJKA 2J14A 5DXQA 4J5WA 5KRMA 5L7GA 4RMEA 2QR9A 3SZ1A 4NUFA 4RUOX 3DZUD 5DXBB 1K7LA 2POBA 5DKSA 4EM9A 3OOKA 2J7XA 1I38A 2GTKA 2PIXA 3A78A 3KDUA 2PITA 3FS1A 3QT0A 5KRFA 4OLMA 3OZ0A 3OLLA 2ACLB 4MG8A 2I4PA 3OSAA 3X36A 5DRJA 4TUZB 5F9BA 2GWXA 2B1ZA 3V49A 2OVHA 3ET0A 1UHLA 2EWPA 1ILGA 5DRMA 4OH6A 2AAXA 4POHA 5JY3A 5AVLA 3ZRAA 3B66A 3GWXA 4MG7A 3AX8A 4IUIA 1P8DA 4IA7A 3A2HA 3ADWA 4RUJA 3TX7B 5FQSA 5DXKA 3ET3A 3HC6A 3IPUA 2HC4A 3OSWA 5AK2A 1E3GA 2AM9A 4O8FA 1XAPA 1A28A 1NQ2A 4E4KA 3WFGA 3BC5A 5DV3A 2ZXMA 2H77A 3FEIA 2VSRA 1GS4A 4N5GA 2ZKCA 5GIEA 2IOGA 5AZVA 2ZNNA 1SQNA 2P7AA 1YY4A 3VRWA 5E14A 3VRVA 1YOKA 1ZH7A 2QA6A 5AAVA 4NQAB 1RKHA 4DQMA 4LNXA 1R1KA 3W0IA 5APHA 3X1HA 2NV7A 3UP0A 2QTUA 1N4HA 1XP9A 2V0VA 1ZEOA 3AZ1A 4IA1A 5DV8A 3CS4A 3D24A 5L7HA 3WGPA 4DK8A 1YOWA 5JJMA 1U3RA 3V9YA 1T63A 2ZK3A 2ZK2A 3P0UA 5G45A 3G8OA 5KRLA 1X7RA 4N73A 4ZNHA 3B0RA 5LGAA 3W5TA 2Q6JA 3VTDA 2HAMA 2Q7KA 4J5XA 4ITEA 1S0XA 4G2IA 5HJPB 4A4VA 2JJ3A 3L3ZA 3ZRBA 3H0AD 4MG9B 1QKUA 3V4AA 4TV1A 4OFUA 4QE6A 5DL4A 3L0JA 1Y9RA 5IAWA 2P4YA 3A9EB 1UPVA 3ADVA 1ZDUA 2B23A 3UU7B 2BJ4B 1XOWA 3A2JA 5FQVA 2Z4JA 3KMGA 5DTVA 2H79A 5DKBA 5AVIA 1YP0A 1ZGYA 3MNOA 4M8HA 1XQ3A 2HWQA 1LV2A 2GPUA 3CLDA 5DZ0A 5DKGA 4K7AA 1XVPA 3CDSA 3NOAA 4DMAA 4MGBA 5DVSA 2Z4BA 2ZMHA 1IE9A 3B0QA 4F9MA 2ZL9A 2ZMIA 3Q95A 1ZAFA 2PKLA 2AA6A 4ZNTA 3GD2A 1XDKB 4Q50A 4S14A 1YJEA 2G0HA 4XI3A 4WQPA 5DX3A 5HCVA 5KD9A 2OZ7A 1GWXA 4DORA 2QPYA 2P7GA 4OFRA 3D6DA 4PF3A 4IV2A 1S9PA 4OJ4A 5AWJA 2B50A 2V7CA 2AYRA 3FALB 3K6PA 4PP6A 1OVLB 4FN9A 4RWVA 4RZGA 3VT8A 1UOMA 3DZYA 2R40A 1P93A 4G21A 3AUNA 3ADTA 3OMOA 5DXEA 2I0GA 2HASA 3HQ5A 4R2UA 5DUGA 3MNEA 3F5CA 4ZOMA 3TKMA 4UDDA 3VJIA 1X7BA 1PRGA 3DZUA 2QZOA 4QE8A 3G9EA 1YUCA 1OT7A 2AA7A 2ZXZA 3E94A 1XIUA 1XPCA 3FEJA 4ZNWA 1KKQA 1RK3A 3ADXA 4RFWA 4ZNVA 3B67A 1L2IA 2XHSA 5APKA 2Q6SA 4IU7A 2JF9A 4S0TA 3N00A 3LMPA 3X31A 2AMBA 4XUMA 3UUAB 3VHVA 4UDAA 2VV4B 3FXVA 2PIRA 5DWIA 2R6WA 4G1YA 4KZIA 3B68A 2ZASA 4MGDA 3OGTA 1XNXA 1NUOA 1DKFB 3K23A 3ERTA 3BEJA 2O9IA 4RAKA 5HYRA 4OARA 5EC9A 1BSXA 3GBKA 3HVLA 3W5RA 2XKWA 4OZTU 1PQCA 4P6WA 1FCXA 1GWRA 4OHAA 4OK1A 5GICA 5C4TA 2XYXA 1FCZA 3DT3A 5EHJA 4DK7A 5KYJA 3GN8A 3KDTA 4X1FA 1XV9B 2QXSA 4QM0A 3VT3A 4NB6A 2YATA 1RDTA 5KR9A
chains in the Genus database with same CATH topology
5DP0A 1XQCA 3OLSA 3OS9A 5DWEA 3VN2A 2ATHA 3GZ9A 4NIEA 5DU5A 3ZR7A 2GPPA 4LBDA 5DWJA 5DXGA 5KYAA 3PO9A 4G2HA 1A52A 5JI0D 1NAVA 3R8AA 5G46A 1U3SA 1NYXA 2ZNQA 2HBHA 2PIUA 1NAXA 4WPFA 5KRAA 4YMQA 3WWRA 4DM8A 5I4VA 4NY9A 5KCUA 3CTBA 4PVUA 1T7TA 5DYBA 2HB8A 2Q59A 4G20A 3B0WA 3OS8C 3F7DA 5HJSA 3UVVA 4P6XA 2Q61A 2GPVA 5DIEA 5DLRA 2GP7A 3IPQA 5DUHA 4PPSA 3P8XA 3MNPA 4EMAA 1X78A 5E7VA 3VT6A 5DSHA 2Q60A 3BQDA 3VI8A 4JGVA 4YPQA 2AX9A 1M2ZA 3AN3A 1T5ZA 4OEYA 3CJWA 3ET1A 3UUDB 3H0AA 2NXXE 4IW8A 4JL4A 3WT7A 3WT6A 2HARA 3R8DA 5LWPA 4S15A 1SKXA 2OM9A 2VV1B 3NSPA 4ZNUA 5DXMA 1U3QA 1YINA 3FC6B 3L3XA 3NSQA 3VT4A 4X1GA 1FCYA 4PPPA 4R6SA 2P1VA 4B7WA 3VTBA 2PIQA 2PIWA 4ZN7A 4RZEA 1Z5XE 1PQ6A 2AXAA 4ZNSA 3ET2A 1Y0XX 2JFAB 2YLYA 4FNEA 2POGA 5DWLA 1XZXX 1KV6A 5DZHA 3S9SA 5DXPA 2ZK6A 5ICKA 2AA5A 4UDCA 5E0XA 5DY8A 5C4OA 4MGCA 2NXXA 3PLZA 3KFCA 1M7WA 1FM9A 3D90A 1S0ZA 5DK9A 1YYEA 3B1MA 3DR1A 4OKTA 1QKTA 1K4WA 2Q5SA 2ZMJA 3A2IA 4HEEX 4OGHA 5FQTA 2XYJA 3AZ3A 2AA2A 3FUGA 2QH6A 3LBDA 4J5WC 3P89A 3HZFA 1M13A 4A4WA 4MG8B 3OOFA 5DUEA 1EXAA 4PWLA 3W0YA 4XUHA 3VT5A 1VJBA 5EI1A 4ZN9A 1PK5A 4Y29A 4HLWA 2YFEA 3JZCA 4ZO1X 2QA8A 3ADUA 1UHLB 4IA2A 1NQ1A 3B65A 4OZTE 4R06A 3U9QA 1DB1A 3W0AA 3WMHA 1TFCA 1ILHA 1T74A 1XLSE 5EITA 2HWRA 3IPSA 4ONIA 4MG7B 1LBDA 3ERDA 3IA6A 4K4JA 1XJ7A 3KPZA 3HLVA 2Q1HA 3OMQA 2AX6A 4MGAA 1NHZA 3PCUA 2O4JA 2YJAB 3K22A 2Q7LA 3ADSA 2P1UA 4OZRE 3OZJA 3M7RA 4KZMA 5DXBA 4IWCA 4PLEA 4PXMA 4RMDA 4IS8A 4OH5A 2Q1VA 1XP6A 2ZK4A 3G8IA 1XP1A 1YIMA 4G1DA 4OKWA 4Q13A 5DIGA 3OMPA 2Q3YA 3D5FA 4E2JA 5EGVA 2I4ZA 2YHDA 1EREA 1QKNA 1G2NA 2P54A 1XLSA 3OKIA 4RZFA 2ACLA 3V9TA 2W8YA 1MV9A 3W5QA 2HFPA 2G0GA 4TUZA 3RLJA 5KCEA 2YJDA 1NQ0A 1XB7A 3HC5A 3IMYA 4XHDA 5AAVB 2GPOA 4JYGA 2ZNOA 1Z5XU 2AMAA 3VJTA 3IXPD 5DVCA 1NQ7A 5E19A 5G44A 1T73A 4DM6A 4ZJRA 1X7JA 2QABA 2VSTA 3OKHA 3R2AA 3V3EA 3HM1A 3VTCA 4DOSA 5B5BA 2QGWA 5JJMB 4RMCA 3TY0A 1SR7A 2Q70A 4WLBA 3VRUA 1H9UA 1TXIA 2PJLA 3KBAA 3X1IA 5M96A 4IA3A 5DZIA 3SP9A 3UUCA 3D57A 1XNNA 4G1ZA 5IXKA 5KRHA 4BCRA 2QMVA 2F4BA 2B1VA 2QXMA 2OVMA 3VSPA 3CS6A 1Q4XA 4TV1B 5E0WA 2QGTA 2HCDA 1GWQA 1WM0X 5KROA 4FHHA 2AX8A 5IZ0A 2Q6RA 2VV2A 4L96A 4OKBA 3E00D 3DCTA 2A3IA 3RVFA 3L1BA 3EYBA 4IW6A 3T03A 3R29A 4OJBA 5DI7A 5L7EA 1XVPB 3W5PA 4LTWA 5KCTA 3WFFA 5E15A 4MGBB 3WT5A 2REWA 4OZRU 4OC7A 3HO0A 1ERRA 1UPWA 1G5YA 2VV0A 3Q95B 5KCWA 3KMZA 2I0JA 4XLDA 5AZTA 4CI5A 3AUQA 3B5RA 3FLIA 5HJPA 4IVYA 5DX3B 5AYGA 4YNKA 2ZBSA 1R20D 5DVVA 5KCCA 5DWGA 2AWHA 3KMRA 4MG9A 5A86A 4IV4A 3V3QA 3GYUA 5GT4A 2P1TA 4Q0AC 4IQRA 4JYIA 3VJSA 5C4UA 4JAZA 5B41A 1T7FA 3A9EA 4MDDA 1FM6D 1S9QA 3JZBA 2QW4A 5G43A 3UU7A 1FD0A 2BJ4A 3TKCA 2BAWA 3KWYA 1K74D 4MG6A 2YLQA 4ZJWA 4RUPA 3F5CB 1Z95A 3CWDA 3OAPA 2Q8SA 4XTAA 5AAUA 3CDPA 1RKGA 3GWSX 2PINA 2QZOB 2ZVTA 4E4QA 1Y0SA 2GL8A 2PNUA 1SJ0A 4OIUA 3L0EA 5C4SA 1XDKA 5G42A 2NW4A 4QJRA 5DV6A 5DZ3A 3DY6A 4LNWA 3RY9A 1T7RA 1MVCA 3HODA 4QK4A 3W0JA 1I37A 2OCFA 3W0HA 1RDTD 1ZUCA 2QNVA 2YLPA 4JYHA 2J7YA 3B3KA 2R6YA 3VSOA 2ZLCA 3FALA 4FGYA 5DXRA 4MGDB 1QKMA 1OVLA 1R5KA 2XYWA 2ZXNA 4CSJA 3GYTA 5HYKA 1R6GA 3AFRA 4S0SA 5G5WA 2Q5PA 4APUA 2OAXA 4N8RA 1EXXA 3VHWA 4WHGA 3RUTA 4CI4A 4K6IA 3A40X 2ZY0A 5KRCA 2Q5GA 3G0WA 4J26A 5DIDA 1T76A 3SP6A 4OIVA 4PLDA 4WVDA 1L2JA 3VT9A 4PP3A 1NDEA 3RLLA 2VV3A 1U9EA 3ILZA 3P88A 5SYZA 1HJ1A 1KNUA 1N83A 3DCUA 4OEZA 2ABIA 1E3KA 3R5MA 3CS8A 3FURA 3OMMA 4OJ9A 4MG5A 4RE8A 3WTQA 3L03A 3UUAA 1YMTA 3E7CA 2VV4A 2AB2A 5CJ6A 5DZ1A 5APJA 3PRGA 3WJ4A 2FSZA 5KCDA 4IVWA 2QSEA 1HG4A 2ZK0A 5H1EA 5KRIA 2J4AA 4POJA 1DKFA 1PQ9A 2GIUA 3R8IA 3B0TA 1NRLA 1R1KD 2Q59B 2ZNPA 3IXPA 3W0GA 3UVVB 2FVJA 3O1EA 1IE8A 1MZNA 2E2RA 5FQRA 3OLFA 4A2JA 3VJHA 5KCFA 5DMCA 5DYDA 4PRGA 2NPAA 3H52A 3VHUA 1PZLA 1XV9A 1ZDTA 2PIOA 1N46A 1X7EA 1T65A 1T7MA 3R5NA 4N1YA 4YT1A 4WHFA 2IOKA 3W0CA 2ZFXA 5ETHA 2OUZA 3KYTA 5ACCA 3PEQA 5FQPA 4KZJA 2PIPL 1FM9D 3AN4A 5G3JA 4FHIA 2ZK5A 3A3ZX 2Q7JA 1ZKYA 3OS8A 5KRJA 5AWKA 5DMFA 4REEA 4ITFA 2ZLAA 2P7ZA 2LBDA 3K8SA 3E00A 3PBAA 2O4RA 5GIDA 2FAIA 3CQVA 1S19A 1X76A 1PCGA 2PIVA 4ZO1B 2YLOA 3OSIA 4OILA 4XAOA 4IWFA 4OEDA 4PP5A 4L98A 2AO6A 3RUUA 1G1UA 4ZI1A 2QE4A 1FBYA 5DKEA 1G50A 1PDUA 2HB7A 4UDBA 2AX7A 3WJ5A 2G5OA 2IHQA 4OEAA 4LSJA 3UUDA 4REFA 4QL8A 4XT9A 4J5XC 3VRTA 1R20A 4M8EA 1OSHA 3VT7A 5HZCA 5L11A 2PRGA 1T79A 2G44A 3AURA 3V9VA 2VV1A 3ZQTA 2HVCA 2Q7IA 3AZ2A 3FC6A 2QA8B 5KRKA 5K13A 1I7IA 5E1CA 1FM6A 2ZK1A 4J24A 3DZYD 2R40D 1YA3A 1K74A 2I4JA 3UP3A 1I7GA 2JFAA 5EJVA 3L0LA 3OMKA 2P15A 4MGAB 1OSVA 4OKXA 3O1DA 1RJKA 2J14A 5DXQA 4J5WA 5KRMA 5L7GA 4RMEA 2QR9A 3SZ1A 4NUFA 4RUOX 3DZUD 5DXBB 1K7LA 2POBA 5DKSA 4EM9A 3OOKA 2J7XA 1I38A 2GTKA 2PIXA 3A78A 3KDUA 2PITA 3FS1A 3QT0A 5KRFA 4OLMA 3OZ0A 3OLLA 2ACLB 4MG8A 2I4PA 3OSAA 3X36A 5DRJA 4TUZB 5F9BA 2GWXA 2B1ZA 3V49A 2OVHA 3ET0A 1UHLA 2EWPA 1ILGA 5DRMA 4OH6A 2AAXA 4POHA 5JY3A 5AVLA 3ZRAA 3B66A 3GWXA 4MG7A 3AX8A 4IUIA 1P8DA 4IA7A 3A2HA 3ADWA 4RUJA 3TX7B 5FQSA 5DXKA 3ET3A 3HC6A 3IPUA 2HC4A 3OSWA 5AK2A 1E3GA 2AM9A 4O8FA 1XAPA 1A28A 1NQ2A 4E4KA 3WFGA 3BC5A 5DV3A 2ZXMA 2H77A 3FEIA 2VSRA 1GS4A 4N5GA 2ZKCA 5GIEA 2IOGA 5AZVA 2ZNNA 1SQNA 2P7AA 1YY4A 3VRWA 5E14A 3VRVA 1YOKA 1ZH7A 2QA6A 5AAVA 4NQAB 1RKHA 4DQMA 4LNXA 1R1KA 3W0IA 5APHA 3X1HA 2NV7A 3UP0A 2QTUA 1N4HA 1XP9A 2V0VA 1ZEOA 3AZ1A 4IA1A 5DV8A 3CS4A 3D24A 5L7HA 3WGPA 4DK8A 1YOWA 5JJMA 1U3RA 3V9YA 1T63A 2ZK3A 2ZK2A 3P0UA 5G45A 3G8OA 5KRLA 1X7RA 4N73A 4ZNHA 3B0RA 5LGAA 3W5TA 2Q6JA 3VTDA 2HAMA 2Q7KA 4J5XA 4ITEA 1S0XA 4G2IA 5HJPB 4A4VA 2JJ3A 3L3ZA 3ZRBA 3H0AD 4MG9B 1QKUA 3V4AA 4TV1A 4OFUA 4QE6A 5DL4A 3L0JA 1Y9RA 5IAWA 2P4YA 3A9EB 1UPVA 3ADVA 1ZDUA 2B23A 3UU7B 2BJ4B 1XOWA 3A2JA 5FQVA 2Z4JA 3KMGA 5DTVA 2H79A 5DKBA 5AVIA 1YP0A 1ZGYA 3MNOA 4M8HA 1XQ3A 2HWQA 1LV2A 2GPUA 3CLDA 5DZ0A 5DKGA 4K7AA 1XVPA 3CDSA 3NOAA 4DMAA 4MGBA 5DVSA 2Z4BA 2ZMHA 1IE9A 3B0QA 4F9MA 2ZL9A 2ZMIA 3Q95A 1ZAFA 2PKLA 2AA6A 4ZNTA 3GD2A 1XDKB 4Q50A 4S14A 1YJEA 2G0HA 4XI3A 4WQPA 5DX3A 5HCVA 5KD9A 2OZ7A 1GWXA 4DORA 2QPYA 2P7GA 4OFRA 3D6DA 4PF3A 4IV2A 1S9PA 4OJ4A 5AWJA 2B50A 2V7CA 2AYRA 3FALB 3K6PA 4PP6A 1OVLB 4FN9A 4RWVA 4RZGA 3VT8A 1UOMA 3DZYA 2R40A 1P93A 4G21A 3AUNA 3ADTA 3OMOA 5DXEA 2I0GA 2HASA 3HQ5A 4R2UA 5DUGA 3MNEA 3F5CA 4ZOMA 3TKMA 4UDDA 3VJIA 1X7BA 1PRGA 3DZUA 2QZOA 4QE8A 3G9EA 1YUCA 1OT7A 2AA7A 2ZXZA 3E94A 1XIUA 1XPCA 3FEJA 4ZNWA 1KKQA 1RK3A 3ADXA 4RFWA 4ZNVA 3B67A 1L2IA 2XHSA 5APKA 2Q6SA 4IU7A 2JF9A 4S0TA 3N00A 3LMPA 3X31A 2AMBA 4XUMA 3UUAB 3VHVA 4UDAA 2VV4B 3FXVA 2PIRA 5DWIA 2R6WA 4G1YA 4KZIA 3B68A 2ZASA 4MGDA 3OGTA 1XNXA 1NUOA 1DKFB 3K23A 3ERTA 3BEJA 2O9IA 4RAKA 5HYRA 4OARA 5EC9A 1BSXA 3GBKA 3HVLA 3W5RA 2XKWA 4OZTU 1PQCA 4P6WA 1FCXA 1GWRA 4OHAA 4OK1A 5GICA 5C4TA 2XYXA 1FCZA 3DT3A 5EHJA 4DK7A 5KYJA 3GN8A 3KDTA 4X1FA 1XV9B 2QXSA 4QM0A 3VT3A 4NB6A 2YATA 1RDTA 5KR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DP0 A;  1XQC A;  3OLS A;  3OS9 A;  5DWE A;  3VN2 A;  2ATH A;  3GZ9 A;  4NIE A;  5DU5 A;  3ZR7 A;  2GPP A;  4LBD A;  5DWJ A;  5DXG A;  5KYA A;  3PO9 A;  4G2H A;  1A52 A;  5JI0 D;  1NAV A;  3R8A A;  5G46 A;  1U3S A;  1NYX A;  2ZNQ A;  2HBH A;  2PIU A;  1NAX A;  4WPF A;  5KRA A;  4YMQ A;  3WWR A;  4DM8 A;  5I4V A;  4NY9 A;  5KCU A;  3CTB A;  4PVU A;  1T7T A;  5DYB A;  2HB8 A;  2Q59 A;  4G20 A;  3B0W A;  3OS8 C;  3F7D A;  5HJS A;  3UVV A;  4P6X A;  2Q61 A;  2GPV A;  5DIE A;  5DLR A;  2GP7 A;  3IPQ A;  5DUH A;  4PPS A;  3P8X A;  3MNP A;  4EMA A;  1X78 A;  5E7V A;  3VT6 A;  5DSH A;  2Q60 A;  3BQD A;  3VI8 A;  4JGV A;  4YPQ A;  2AX9 A;  1M2Z A;  3AN3 A;  1T5Z A;  4OEY A;  3CJW A;  3ET1 A;  3UUD B;  3H0A A;  2NXX E;  4IW8 A;  4JL4 A;  3WT7 A;  3WT6 A;  2HAR A;  3R8D A;  5LWP A;  4S15 A;  1SKX A;  2OM9 A;  2VV1 B;  3NSP A;  4ZNU A;  5DXM A;  1U3Q A;  1YIN A;  3FC6 B;  3L3X A;  3NSQ A;  3VT4 A;  4X1G A;  1FCY A;  4PPP A;  4R6S A;  2P1V A;  4B7W A;  3VTB A;  2PIQ A;  2PIW A;  4ZN7 A;  4RZE A;  1Z5X E;  1PQ6 A;  2AXA A;  4ZNS A;  3ET2 A;  1Y0X X;  2JFA B;  2YLY A;  4FNE A;  2POG A;  5DWL A;  1XZX X;  1KV6 A;  5DZH A;  3S9S A;  5DXP A;  2ZK6 A;  5ICK A;  2AA5 A;  4UDC A;  5E0X A;  5DY8 A;  5C4O A;  4MGC A;  2NXX A;  3PLZ A;  3KFC A;  1M7W A;  1FM9 A;  3D90 A;  1S0Z A;  5DK9 A;  1YYE A;  3B1M A;  3DR1 A;  4OKT A;  1QKT A;  1K4W A;  2Q5S A;  2ZMJ A;  3A2I A;  4HEE X;  4OGH A;  5FQT A;  2XYJ A;  3AZ3 A;  2AA2 A;  3FUG A;  2QH6 A;  3LBD A;  4J5W C;  3P89 A;  3HZF A;  1M13 A;  4A4W A;  4MG8 B;  3OOF A;  5DUE A;  1EXA A;  4PWL A;  3W0Y A;  4XUH A;  3VT5 A;  1VJB A;  5EI1 A;  4ZN9 A;  1PK5 A;  4Y29 A;  4HLW A;  2YFE A;  3JZC A;  4ZO1 X;  2QA8 A;  3ADU A;  1UHL B;  4IA2 A;  1NQ1 A;  3B65 A;  4OZT E;  4R06 A;  3U9Q A;  1DB1 A;  3W0A A;  3WMH A;  1TFC A;  1ILH A;  1T74 A;  1XLS E;  5EIT A;  2HWR A;  3IPS A;  4ONI A;  4MG7 B;  1LBD A;  3ERD A;  3IA6 A;  4K4J A;  1XJ7 A;  3KPZ A;  3HLV A;  2Q1H A;  3OMQ A;  2AX6 A;  4MGA A;  1NHZ A;  3PCU A;  2O4J A;  2YJA B;  3K22 A;  2Q7L A;  3ADS A;  2P1U A;  4OZR E;  3OZJ A;  3M7R A;  4KZM A;  5DXB A;  4IWC A;  4PLE A;  4PXM A;  4RMD A;  4IS8 A;  4OH5 A;  2Q1V A;  1XP6 A;  2ZK4 A;  3G8I A;  1XP1 A;  1YIM A;  4G1D A;  4OKW A;  4Q13 A;  5DIG A;  3OMP A;  2Q3Y A;  3D5F A;  4E2J A;  5EGV A;  2I4Z A;  2YHD A;  1ERE A;  1QKN A;  1G2N A;  2P54 A;  1XLS A;  3OKI A;  4RZF A;  2ACL A;  3V9T A;  2W8Y A;  1MV9 A;  3W5Q A;  2HFP A;  2G0G A;  4TUZ A;  3RLJ A;  5KCE A;  2YJD A;  1NQ0 A;  1XB7 A;  3HC5 A;  3IMY A;  4XHD A;  5AAV B;  2GPO A;  4JYG A;  2ZNO A;  1Z5X U;  2AMA A;  3VJT A;  3IXP D;  5DVC A;  1NQ7 A;  5E19 A;  5G44 A;  1T73 A;  4DM6 A;  4ZJR A;  1X7J A;  2QAB A;  2VST A;  3OKH A;  3R2A A;  3V3E A;  3HM1 A;  3VTC A;  4DOS A;  5B5B A;  2QGW A;  5JJM B;  4RMC A;  3TY0 A;  1SR7 A;  2Q70 A;  4WLB A;  3VRU A;  1H9U A;  1TXI A;  2PJL A;  3KBA A;  3X1I A;  5M96 A;  4IA3 A;  5DZI A;  3SP9 A;  3UUC A;  3D57 A;  1XNN A;  4G1Z A;  5IXK A;  5KRH A;  4BCR A;  2QMV A;  2F4B A;  2B1V A;  2QXM A;  2OVM A;  3VSP A;  3CS6 A;  1Q4X A;  4TV1 B;  5E0W A;  2QGT A;  2HCD A;  1GWQ A;  1WM0 X;  5KRO A;  4FHH A;  2AX8 A;  5IZ0 A;  2Q6R A;  2VV2 A;  4L96 A;  4OKB A;  3E00 D;  3DCT A;  2A3I A;  3RVF A;  3L1B A;  3EYB A;  4IW6 A;  3T03 A;  3R29 A;  4OJB A;  5DI7 A;  5L7E A;  1XVP B;  3W5P A;  4LTW A;  5KCT A;  3WFF A;  5E15 A;  4MGB B;  3WT5 A;  2REW A;  4OZR U;  4OC7 A;  3HO0 A;  1ERR A;  1UPW A;  1G5Y A;  2VV0 A;  3Q95 B;  5KCW A;  3KMZ A;  2I0J A;  4XLD A;  5AZT A;  4CI5 A;  3AUQ A;  3B5R A;  3FLI A;  5HJP A;  4IVY A;  5DX3 B;  5AYG A;  4YNK A;  2ZBS A;  1R20 D;  5DVV A;  5KCC A;  5DWG A;  2AWH A;  3KMR A;  4MG9 A;  5A86 A;  4IV4 A;  3V3Q A;  3GYU A;  5GT4 A;  2P1T A;  4Q0A C;  4IQR A;  4JYI A;  3VJS A;  5C4U A;  4JAZ A;  5B41 A;  1T7F A;  3A9E A;  4MDD A;  1FM6 D;  1S9Q A;  3JZB A;  2QW4 A;  5G43 A;  3UU7 A;  1FD0 A;  2BJ4 A;  3TKC A;  2BAW A;  3KWY A;  1K74 D;  4MG6 A;  2YLQ A;  4ZJW A;  4RUP A;  3F5C B;  1Z95 A;  3CWD A;  3OAP A;  2Q8S A;  4XTA A;  5AAU A;  3CDP A;  1RKG A;  3GWS X;  2PIN A;  2QZO B;  2ZVT A;  4E4Q A;  1Y0S A;  2GL8 A;  2PNU A;  1SJ0 A;  4OIU A;  3L0E A;  5C4S A;  1XDK A;  5G42 A;  2NW4 A;  4QJR A;  5DV6 A;  5DZ3 A;  3DY6 A;  4LNW A;  3RY9 A;  1T7R A;  1MVC A;  3HOD A;  4QK4 A;  3W0J A;  1I37 A;  2OCF A;  3W0H A;  1RDT D;  1ZUC A;  2QNV A;  2YLP A;  4JYH A;  2J7Y A;  3B3K A;  2R6Y A;  3VSO A;  2ZLC A;  3FAL A;  4FGY A;  5DXR A;  4MGD B;  1QKM A;  1OVL A;  1R5K A;  2XYW A;  2ZXN A;  4CSJ A;  3GYT A;  5HYK A;  1R6G A;  3AFR A;  4S0S A;  5G5W A;  2Q5P A;  4APU A;  2OAX A;  4N8R A;  1EXX A;  3VHW A;  4WHG A;  3RUT A;  4CI4 A;  4K6I A;  3A40 X;  2ZY0 A;  5KRC A;  2Q5G A;  3G0W A;  4J26 A;  5DID A;  1T76 A;  3SP6 A;  4OIV A;  4PLD A;  4WVD A;  1L2J A;  3VT9 A;  4PP3 A;  1NDE A;  3RLL A;  2VV3 A;  1U9E A;  3ILZ A;  3P88 A;  5SYZ A;  1HJ1 A;  1KNU A;  1N83 A;  3DCU A;  4OEZ A;  2ABI A;  1E3K A;  3R5M A;  3CS8 A;  3FUR A;  3OMM A;  4OJ9 A;  4MG5 A;  4RE8 A;  3WTQ A;  3L03 A;  3UUA A;  1YMT A;  3E7C A;  2VV4 A;  2AB2 A;  5CJ6 A;  5DZ1 A;  5APJ A;  3PRG A;  3WJ4 A;  2FSZ A;  5KCD A;  4IVW A;  2QSE A;  1HG4 A;  2ZK0 A;  5H1E A;  5KRI A;  2J4A A;  4POJ A;  1DKF A;  1PQ9 A;  2GIU A;  3R8I A;  3B0T A;  1NRL A;  1R1K D;  2Q59 B;  2ZNP A;  3IXP A;  3W0G A;  3UVV B;  2FVJ A;  3O1E A;  1IE8 A;  1MZN A;  2E2R A;  5FQR A;  3OLF A;  4A2J A;  3VJH A;  5KCF A;  5DMC A;  5DYD A;  4PRG A;  2NPA A;  3H52 A;  3VHU A;  1PZL A;  1XV9 A;  1ZDT A;  2PIO A;  1N46 A;  1X7E A;  1T65 A;  1T7M A;  3R5N A;  4N1Y A;  4YT1 A;  4WHF A;  2IOK A;  3W0C A;  2ZFX A;  5ETH A;  2OUZ A;  3KYT A;  5ACC A;  3PEQ A;  5FQP A;  4KZJ A;  2PIP L;  1FM9 D;  3AN4 A;  5G3J A;  4FHI A;  2ZK5 A;  3A3Z X;  2Q7J A;  1ZKY A;  3OS8 A;  5KRJ A;  5AWK A;  5DMF A;  4REE A;  4ITF A;  2ZLA A;  2P7Z A;  2LBD A;  3K8S A;  3E00 A;  3PBA A;  2O4R A;  5GID A;  2FAI A;  3CQV A;  1S19 A;  1X76 A;  1PCG A;  2PIV A;  4ZO1 B;  2YLO A;  3OSI A;  4OIL A;  4XAO A;  4IWF A;  4OED A;  4PP5 A;  4L98 A;  2AO6 A;  3RUU A;  1G1U A;  4ZI1 A;  2QE4 A;  1FBY A;  5DKE A;  1G50 A;  1PDU A;  2HB7 A;  4UDB A;  2AX7 A;  3WJ5 A;  2G5O A;  2IHQ A;  4OEA A;  4LSJ A;  3UUD A;  4REF A;  4QL8 A;  4XT9 A;  4J5X C;  3VRT A;  1R20 A;  4M8E A;  1OSH A;  3VT7 A;  5HZC A;  5L11 A;  2PRG A;  1T79 A;  2G44 A;  3AUR A;  3V9V A;  2VV1 A;  3ZQT A;  2HVC A;  2Q7I A;  3AZ2 A;  3FC6 A;  2QA8 B;  5KRK A;  5K13 A;  1I7I A;  5E1C A;  1FM6 A;  2ZK1 A;  4J24 A;  3DZY D;  2R40 D;  1YA3 A;  1K74 A;  2I4J A;  3UP3 A;  1I7G A;  2JFA A;  5EJV A;  3L0L A;  3OMK A;  2P15 A;  4MGA B;  1OSV A;  4OKX A;  3O1D A;  1RJK A;  2J14 A;  5DXQ A;  4J5W A;  5KRM A;  5L7G A;  4RME A;  2QR9 A;  3SZ1 A;  4NUF A;  4RUO X;  3DZU D;  5DXB B;  1K7L A;  2POB A;  5DKS A;  4EM9 A;  3OOK A;  2J7X A;  1I38 A;  2GTK A;  2PIX A;  3A78 A;  3KDU A;  2PIT A;  3FS1 A;  3QT0 A;  5KRF A;  4OLM A;  3OZ0 A;  3OLL A;  2ACL B;  4MG8 A;  2I4P A;  3OSA A;  3X36 A;  5DRJ A;  4TUZ B;  5F9B A;  2GWX A;  2B1Z A;  3V49 A;  2OVH A;  3ET0 A;  1UHL A;  2EWP A;  1ILG A;  5DRM A;  4OH6 A;  2AAX A;  4POH A;  5JY3 A;  5AVL A;  3ZRA A;  3B66 A;  3GWX A;  4MG7 A;  3AX8 A;  4IUI A;  1P8D A;  4IA7 A;  3A2H A;  3ADW A;  4RUJ A;  3TX7 B;  5FQS A;  5DXK A;  3ET3 A;  3HC6 A;  3IPU A;  2HC4 A;  3OSW A;  5AK2 A;  1E3G A;  2AM9 A;  4O8F A;  1XAP A;  1A28 A;  1NQ2 A;  4E4K A;  3WFG A;  3BC5 A;  5DV3 A;  2ZXM A;  2H77 A;  3FEI A;  2VSR A;  1GS4 A;  4N5G A;  2ZKC A;  5GIE A;  2IOG A;  5AZV A;  2ZNN A;  1SQN A;  2P7A A;  1YY4 A;  3VRW A;  5E14 A;  3VRV A;  1YOK A;  1ZH7 A;  2QA6 A;  5AAV A;  4NQA B;  1RKH A;  4DQM A;  4LNX A;  1R1K A;  3W0I A;  5APH A;  3X1H A;  2NV7 A;  3UP0 A;  2QTU A;  1N4H A;  1XP9 A;  2V0V A;  1ZEO A;  3AZ1 A;  4IA1 A;  5DV8 A;  3CS4 A;  3D24 A;  5L7H A;  3WGP A;  4DK8 A;  1YOW A;  5JJM A;  1U3R A;  3V9Y A;  1T63 A;  2ZK3 A;  2ZK2 A;  3P0U A;  5G45 A;  3G8O A;  5KRL A;  1X7R A;  4N73 A;  4ZNH A;  3B0R A;  5LGA A;  3W5T A;  2Q6J A;  3VTD A;  2HAM A;  2Q7K A;  4J5X A;  4ITE A;  1S0X A;  4G2I A;  5HJP B;  4A4V A;  2JJ3 A;  3L3Z A;  3ZRB A;  3H0A D;  4MG9 B;  1QKU A;  3V4A A;  4TV1 A;  4OFU A;  4QE6 A;  5DL4 A;  3L0J A;  1Y9R A;  5IAW A;  2P4Y A;  3A9E B;  1UPV A;  3ADV A;  1ZDU A;  2B23 A;  3UU7 B;  2BJ4 B;  1XOW A;  3A2J A;  5FQV A;  2Z4J A;  3KMG A;  5DTV A;  2H79 A;  5DKB A;  5AVI A;  1YP0 A;  1ZGY A;  3MNO A;  4M8H A;  1XQ3 A;  2HWQ A;  1LV2 A;  2GPU A;  3CLD A;  5DZ0 A;  5DKG A;  4K7A A;  1XVP A;  3CDS A;  3NOA A;  4DMA A;  4MGB A;  5DVS A;  2Z4B A;  2ZMH A;  1IE9 A;  3B0Q A;  4F9M A;  2ZL9 A;  2ZMI A;  3Q95 A;  1ZAF A;  2PKL A;  2AA6 A;  4ZNT A;  3GD2 A;  1XDK B;  4Q50 A;  4S14 A;  1YJE A;  2G0H A;  4XI3 A;  4WQP A;  5DX3 A;  5HCV A;  5KD9 A;  2OZ7 A;  1GWX A;  4DOR A;  2QPY A;  2P7G A;  4OFR A;  3D6D A;  4PF3 A;  4IV2 A;  1S9P A;  4OJ4 A;  5AWJ A;  2B50 A;  2V7C A;  2AYR A;  3FAL B;  3K6P A;  4PP6 A;  1OVL B;  4FN9 A;  4RWV A;  4RZG A;  3VT8 A;  1UOM A;  3DZY A;  2R40 A;  1P93 A;  4G21 A;  3AUN A;  3ADT A;  3OMO A;  5DXE A;  2I0G A;  2HAS A;  3HQ5 A;  4R2U A;  5DUG A;  3MNE A;  3F5C A;  4ZOM A;  3TKM A;  4UDD A;  3VJI A;  1X7B A;  1PRG A;  3DZU A;  2QZO A;  4QE8 A;  3G9E A;  1YUC A;  1OT7 A;  2AA7 A;  2ZXZ A;  3E94 A;  1XIU A;  1XPC A;  3FEJ A;  4ZNW A;  1KKQ A;  1RK3 A;  3ADX A;  4RFW A;  4ZNV A;  3B67 A;  1L2I A;  2XHS A;  5APK A;  2Q6S A;  4IU7 A;  2JF9 A;  4S0T A;  3N00 A;  3LMP A;  3X31 A;  2AMB A;  4XUM A;  3UUA B;  3VHV A;  4UDA A;  2VV4 B;  3FXV A;  2PIR A;  5DWI A;  2R6W A;  4G1Y A;  4KZI A;  3B68 A;  2ZAS A;  4MGD A;  3OGT A;  1XNX A;  1NUO A;  1DKF B;  3K23 A;  3ERT A;  3BEJ A;  2O9I A;  4RAK A;  5HYR A;  4OAR A;  5EC9 A;  1BSX A;  3GBK A;  3HVL A;  3W5R A;  2XKW A;  4OZT U;  1PQC A;  4P6W A;  1FCX A;  1GWR A;  4OHA A;  4OK1 A;  5GIC A;  5C4T A;  2XYX A;  1FCZ A;  3DT3 A;  5EHJ A;  4DK7 A;  5KYJ A;  3GN8 A;  3KDT A;  4X1F A;  1XV9 B;  2QXS A;  4QM0 A;  3VT3 A;  4NB6 A;  2YAT A;  1RDT A;  5KR9 A; 
#chains in the Genus database with same CATH topology
 5DP0 A;  1XQC A;  3OLS A;  3OS9 A;  5DWE A;  3VN2 A;  2ATH A;  3GZ9 A;  4NIE A;  5DU5 A;  3ZR7 A;  2GPP A;  4LBD A;  5DWJ A;  5DXG A;  5KYA A;  3PO9 A;  4G2H A;  1A52 A;  5JI0 D;  1NAV A;  3R8A A;  5G46 A;  1U3S A;  1NYX A;  2ZNQ A;  2HBH A;  2PIU A;  1NAX A;  4WPF A;  5KRA A;  4YMQ A;  3WWR A;  4DM8 A;  5I4V A;  4NY9 A;  5KCU A;  3CTB A;  4PVU A;  1T7T A;  5DYB A;  2HB8 A;  2Q59 A;  4G20 A;  3B0W A;  3OS8 C;  3F7D A;  5HJS A;  3UVV A;  4P6X A;  2Q61 A;  2GPV A;  5DIE A;  5DLR A;  2GP7 A;  3IPQ A;  5DUH A;  4PPS A;  3P8X A;  3MNP A;  4EMA A;  1X78 A;  5E7V A;  3VT6 A;  5DSH A;  2Q60 A;  3BQD A;  3VI8 A;  4JGV A;  4YPQ A;  2AX9 A;  1M2Z A;  3AN3 A;  1T5Z A;  4OEY A;  3CJW A;  3ET1 A;  3UUD B;  3H0A A;  2NXX E;  4IW8 A;  4JL4 A;  3WT7 A;  3WT6 A;  2HAR A;  3R8D A;  5LWP A;  4S15 A;  1SKX A;  2OM9 A;  2VV1 B;  3NSP A;  4ZNU A;  5DXM A;  1U3Q A;  1YIN A;  3FC6 B;  3L3X A;  3NSQ A;  3VT4 A;  4X1G A;  1FCY A;  4PPP A;  4R6S A;  2P1V A;  4B7W A;  3VTB A;  2PIQ A;  2PIW A;  4ZN7 A;  4RZE A;  1Z5X E;  1PQ6 A;  2AXA A;  4ZNS A;  3ET2 A;  1Y0X X;  2JFA B;  2YLY A;  4FNE A;  2POG A;  5DWL A;  1XZX X;  1KV6 A;  5DZH A;  3S9S A;  5DXP A;  2ZK6 A;  5ICK A;  2AA5 A;  4UDC A;  5E0X A;  5DY8 A;  5C4O A;  4MGC A;  2NXX A;  3PLZ A;  3KFC A;  1M7W A;  1FM9 A;  3D90 A;  1S0Z A;  5DK9 A;  1YYE A;  3B1M A;  3DR1 A;  4OKT A;  1QKT A;  1K4W A;  2Q5S A;  2ZMJ A;  3A2I A;  4HEE X;  4OGH A;  5FQT A;  2XYJ A;  3AZ3 A;  2AA2 A;  3FUG A;  2QH6 A;  3LBD A;  4J5W C;  3P89 A;  3HZF A;  1M13 A;  4A4W A;  4MG8 B;  3OOF A;  5DUE A;  1EXA A;  4PWL A;  3W0Y A;  4XUH A;  3VT5 A;  1VJB A;  5EI1 A;  4ZN9 A;  1PK5 A;  4Y29 A;  4HLW A;  2YFE A;  3JZC A;  4ZO1 X;  2QA8 A;  3ADU A;  1UHL B;  4IA2 A;  1NQ1 A;  3B65 A;  4OZT E;  4R06 A;  3U9Q A;  1DB1 A;  3W0A A;  3WMH A;  1TFC A;  1ILH A;  1T74 A;  1XLS E;  5EIT A;  2HWR A;  3IPS A;  4ONI A;  4MG7 B;  1LBD A;  3ERD A;  3IA6 A;  4K4J A;  1XJ7 A;  3KPZ A;  3HLV A;  2Q1H A;  3OMQ A;  2AX6 A;  4MGA A;  1NHZ A;  3PCU A;  2O4J A;  2YJA B;  3K22 A;  2Q7L A;  3ADS A;  2P1U A;  4OZR E;  3OZJ A;  3M7R A;  4KZM A;  5DXB A;  4IWC A;  4PLE A;  4PXM A;  4RMD A;  4IS8 A;  4OH5 A;  2Q1V A;  1XP6 A;  2ZK4 A;  3G8I A;  1XP1 A;  1YIM A;  4G1D A;  4OKW A;  4Q13 A;  5DIG A;  3OMP A;  2Q3Y A;  3D5F A;  4E2J A;  5EGV A;  2I4Z A;  2YHD A;  1ERE A;  1QKN A;  1G2N A;  2P54 A;  1XLS A;  3OKI A;  4RZF A;  2ACL A;  3V9T A;  2W8Y A;  1MV9 A;  3W5Q A;  2HFP A;  2G0G A;  4TUZ A;  3RLJ A;  5KCE A;  2YJD A;  1NQ0 A;  1XB7 A;  3HC5 A;  3IMY A;  4XHD A;  5AAV B;  2GPO A;  4JYG A;  2ZNO A;  1Z5X U;  2AMA A;  3VJT A;  3IXP D;  5DVC A;  1NQ7 A;  5E19 A;  5G44 A;  1T73 A;  4DM6 A;  4ZJR A;  1X7J A;  2QAB A;  2VST A;  3OKH A;  3R2A A;  3V3E A;  3HM1 A;  3VTC A;  4DOS A;  5B5B A;  2QGW A;  5JJM B;  4RMC A;  3TY0 A;  1SR7 A;  2Q70 A;  4WLB A;  3VRU A;  1H9U A;  1TXI A;  2PJL A;  3KBA A;  3X1I A;  5M96 A;  4IA3 A;  5DZI A;  3SP9 A;  3UUC A;  3D57 A;  1XNN A;  4G1Z A;  5IXK A;  5KRH A;  4BCR A;  2QMV A;  2F4B A;  2B1V A;  2QXM A;  2OVM A;  3VSP A;  3CS6 A;  1Q4X A;  4TV1 B;  5E0W A;  2QGT A;  2HCD A;  1GWQ A;  1WM0 X;  5KRO A;  4FHH A;  2AX8 A;  5IZ0 A;  2Q6R A;  2VV2 A;  4L96 A;  4OKB A;  3E00 D;  3DCT A;  2A3I A;  3RVF A;  3L1B A;  3EYB A;  4IW6 A;  3T03 A;  3R29 A;  4OJB A;  5DI7 A;  5L7E A;  1XVP B;  3W5P A;  4LTW A;  5KCT A;  3WFF A;  5E15 A;  4MGB B;  3WT5 A;  2REW A;  4OZR U;  4OC7 A;  3HO0 A;  1ERR A;  1UPW A;  1G5Y A;  2VV0 A;  3Q95 B;  5KCW A;  3KMZ A;  2I0J A;  4XLD A;  5AZT A;  4CI5 A;  3AUQ A;  3B5R A;  3FLI A;  5HJP A;  4IVY A;  5DX3 B;  5AYG A;  4YNK A;  2ZBS A;  1R20 D;  5DVV A;  5KCC A;  5DWG A;  2AWH A;  3KMR A;  4MG9 A;  5A86 A;  4IV4 A;  3V3Q A;  3GYU A;  5GT4 A;  2P1T A;  4Q0A C;  4IQR A;  4JYI A;  3VJS A;  5C4U A;  4JAZ A;  5B41 A;  1T7F A;  3A9E A;  4MDD A;  1FM6 D;  1S9Q A;  3JZB A;  2QW4 A;  5G43 A;  3UU7 A;  1FD0 A;  2BJ4 A;  3TKC A;  2BAW A;  3KWY A;  1K74 D;  4MG6 A;  2YLQ A;  4ZJW A;  4RUP A;  3F5C B;  1Z95 A;  3CWD A;  3OAP A;  2Q8S A;  4XTA A;  5AAU A;  3CDP A;  1RKG A;  3GWS X;  2PIN A;  2QZO B;  2ZVT A;  4E4Q A;  1Y0S A;  2GL8 A;  2PNU A;  1SJ0 A;  4OIU A;  3L0E A;  5C4S A;  1XDK A;  5G42 A;  2NW4 A;  4QJR A;  5DV6 A;  5DZ3 A;  3DY6 A;  4LNW A;  3RY9 A;  1T7R A;  1MVC A;  3HOD A;  4QK4 A;  3W0J A;  1I37 A;  2OCF A;  3W0H A;  1RDT D;  1ZUC A;  2QNV A;  2YLP A;  4JYH A;  2J7Y A;  3B3K A;  2R6Y A;  3VSO A;  2ZLC A;  3FAL A;  4FGY A;  5DXR A;  4MGD B;  1QKM A;  1OVL A;  1R5K A;  2XYW A;  2ZXN A;  4CSJ A;  3GYT A;  5HYK A;  1R6G A;  3AFR A;  4S0S A;  5G5W A;  2Q5P A;  4APU A;  2OAX A;  4N8R A;  1EXX A;  3VHW A;  4WHG A;  3RUT A;  4CI4 A;  4K6I A;  3A40 X;  2ZY0 A;  5KRC A;  2Q5G A;  3G0W A;  4J26 A;  5DID A;  1T76 A;  3SP6 A;  4OIV A;  4PLD A;  4WVD A;  1L2J A;  3VT9 A;  4PP3 A;  1NDE A;  3RLL A;  2VV3 A;  1U9E A;  3ILZ A;  3P88 A;  5SYZ A;  1HJ1 A;  1KNU A;  1N83 A;  3DCU A;  4OEZ A;  2ABI A;  1E3K A;  3R5M A;  3CS8 A;  3FUR A;  3OMM A;  4OJ9 A;  4MG5 A;  4RE8 A;  3WTQ A;  3L03 A;  3UUA A;  1YMT A;  3E7C A;  2VV4 A;  2AB2 A;  5CJ6 A;  5DZ1 A;  5APJ A;  3PRG A;  3WJ4 A;  2FSZ A;  5KCD A;  4IVW A;  2QSE A;  1HG4 A;  2ZK0 A;  5H1E A;  5KRI A;  2J4A A;  4POJ A;  1DKF A;  1PQ9 A;  2GIU A;  3R8I A;  3B0T A;  1NRL A;  1R1K D;  2Q59 B;  2ZNP A;  3IXP A;  3W0G A;  3UVV B;  2FVJ A;  3O1E A;  1IE8 A;  1MZN A;  2E2R A;  5FQR A;  3OLF A;  4A2J A;  3VJH A;  5KCF A;  5DMC A;  5DYD A;  4PRG A;  2NPA A;  3H52 A;  3VHU A;  1PZL A;  1XV9 A;  1ZDT A;  2PIO A;  1N46 A;  1X7E A;  1T65 A;  1T7M A;  3R5N A;  4N1Y A;  4YT1 A;  4WHF A;  2IOK A;  3W0C A;  2ZFX A;  5ETH A;  2OUZ A;  3KYT A;  5ACC A;  3PEQ A;  5FQP A;  4KZJ A;  2PIP L;  1FM9 D;  3AN4 A;  5G3J A;  4FHI A;  2ZK5 A;  3A3Z X;  2Q7J A;  1ZKY A;  3OS8 A;  5KRJ A;  5AWK A;  5DMF A;  4REE A;  4ITF A;  2ZLA A;  2P7Z A;  2LBD A;  3K8S A;  3E00 A;  3PBA A;  2O4R A;  5GID A;  2FAI A;  3CQV A;  1S19 A;  1X76 A;  1PCG A;  2PIV A;  4ZO1 B;  2YLO A;  3OSI A;  4OIL A;  4XAO A;  4IWF A;  4OED A;  4PP5 A;  4L98 A;  2AO6 A;  3RUU A;  1G1U A;  4ZI1 A;  2QE4 A;  1FBY A;  5DKE A;  1G50 A;  1PDU A;  2HB7 A;  4UDB A;  2AX7 A;  3WJ5 A;  2G5O A;  2IHQ A;  4OEA A;  4LSJ A;  3UUD A;  4REF A;  4QL8 A;  4XT9 A;  4J5X C;  3VRT A;  1R20 A;  4M8E A;  1OSH A;  3VT7 A;  5HZC A;  5L11 A;  2PRG A;  1T79 A;  2G44 A;  3AUR A;  3V9V A;  2VV1 A;  3ZQT A;  2HVC A;  2Q7I A;  3AZ2 A;  3FC6 A;  2QA8 B;  5KRK A;  5K13 A;  1I7I A;  5E1C A;  1FM6 A;  2ZK1 A;  4J24 A;  3DZY D;  2R40 D;  1YA3 A;  1K74 A;  2I4J A;  3UP3 A;  1I7G A;  2JFA A;  5EJV A;  3L0L A;  3OMK A;  2P15 A;  4MGA B;  1OSV A;  4OKX A;  3O1D A;  1RJK A;  2J14 A;  5DXQ A;  4J5W A;  5KRM A;  5L7G A;  4RME A;  2QR9 A;  3SZ1 A;  4NUF A;  4RUO X;  3DZU D;  5DXB B;  1K7L A;  2POB A;  5DKS A;  4EM9 A;  3OOK A;  2J7X A;  1I38 A;  2GTK A;  2PIX A;  3A78 A;  3KDU A;  2PIT A;  3FS1 A;  3QT0 A;  5KRF A;  4OLM A;  3OZ0 A;  3OLL A;  2ACL B;  4MG8 A;  2I4P A;  3OSA A;  3X36 A;  5DRJ A;  4TUZ B;  5F9B A;  2GWX A;  2B1Z A;  3V49 A;  2OVH A;  3ET0 A;  1UHL A;  2EWP A;  1ILG A;  5DRM A;  4OH6 A;  2AAX A;  4POH A;  5JY3 A;  5AVL A;  3ZRA A;  3B66 A;  3GWX A;  4MG7 A;  3AX8 A;  4IUI A;  1P8D A;  4IA7 A;  3A2H A;  3ADW A;  4RUJ A;  3TX7 B;  5FQS A;  5DXK A;  3ET3 A;  3HC6 A;  3IPU A;  2HC4 A;  3OSW A;  5AK2 A;  1E3G A;  2AM9 A;  4O8F A;  1XAP A;  1A28 A;  1NQ2 A;  4E4K A;  3WFG A;  3BC5 A;  5DV3 A;  2ZXM A;  2H77 A;  3FEI A;  2VSR A;  1GS4 A;  4N5G A;  2ZKC A;  5GIE A;  2IOG A;  5AZV A;  2ZNN A;  1SQN A;  2P7A A;  1YY4 A;  3VRW A;  5E14 A;  3VRV A;  1YOK A;  1ZH7 A;  2QA6 A;  5AAV A;  4NQA B;  1RKH A;  4DQM A;  4LNX A;  1R1K A;  3W0I A;  5APH A;  3X1H A;  2NV7 A;  3UP0 A;  2QTU A;  1N4H A;  1XP9 A;  2V0V A;  1ZEO A;  3AZ1 A;  4IA1 A;  5DV8 A;  3CS4 A;  3D24 A;  5L7H A;  3WGP A;  4DK8 A;  1YOW A;  5JJM A;  1U3R A;  3V9Y A;  1T63 A;  2ZK3 A;  2ZK2 A;  3P0U A;  5G45 A;  3G8O A;  5KRL A;  1X7R A;  4N73 A;  4ZNH A;  3B0R A;  5LGA A;  3W5T A;  2Q6J A;  3VTD A;  2HAM A;  2Q7K A;  4J5X A;  4ITE A;  1S0X A;  4G2I A;  5HJP B;  4A4V A;  2JJ3 A;  3L3Z A;  3ZRB A;  3H0A D;  4MG9 B;  1QKU A;  3V4A A;  4TV1 A;  4OFU A;  4QE6 A;  5DL4 A;  3L0J A;  1Y9R A;  5IAW A;  2P4Y A;  3A9E B;  1UPV A;  3ADV A;  1ZDU A;  2B23 A;  3UU7 B;  2BJ4 B;  1XOW A;  3A2J A;  5FQV A;  2Z4J A;  3KMG A;  5DTV A;  2H79 A;  5DKB A;  5AVI A;  1YP0 A;  1ZGY A;  3MNO A;  4M8H A;  1XQ3 A;  2HWQ A;  1LV2 A;  2GPU A;  3CLD A;  5DZ0 A;  5DKG A;  4K7A A;  1XVP A;  3CDS A;  3NOA A;  4DMA A;  4MGB A;  5DVS A;  2Z4B A;  2ZMH A;  1IE9 A;  3B0Q A;  4F9M A;  2ZL9 A;  2ZMI A;  3Q95 A;  1ZAF A;  2PKL A;  2AA6 A;  4ZNT A;  3GD2 A;  1XDK B;  4Q50 A;  4S14 A;  1YJE A;  2G0H A;  4XI3 A;  4WQP A;  5DX3 A;  5HCV A;  5KD9 A;  2OZ7 A;  1GWX A;  4DOR A;  2QPY A;  2P7G A;  4OFR A;  3D6D A;  4PF3 A;  4IV2 A;  1S9P A;  4OJ4 A;  5AWJ A;  2B50 A;  2V7C A;  2AYR A;  3FAL B;  3K6P A;  4PP6 A;  1OVL B;  4FN9 A;  4RWV A;  4RZG A;  3VT8 A;  1UOM A;  3DZY A;  2R40 A;  1P93 A;  4G21 A;  3AUN A;  3ADT A;  3OMO A;  5DXE A;  2I0G A;  2HAS A;  3HQ5 A;  4R2U A;  5DUG A;  3MNE A;  3F5C A;  4ZOM A;  3TKM A;  4UDD A;  3VJI A;  1X7B A;  1PRG A;  3DZU A;  2QZO A;  4QE8 A;  3G9E A;  1YUC A;  1OT7 A;  2AA7 A;  2ZXZ A;  3E94 A;  1XIU A;  1XPC A;  3FEJ A;  4ZNW A;  1KKQ A;  1RK3 A;  3ADX A;  4RFW A;  4ZNV A;  3B67 A;  1L2I A;  2XHS A;  5APK A;  2Q6S A;  4IU7 A;  2JF9 A;  4S0T A;  3N00 A;  3LMP A;  3X31 A;  2AMB A;  4XUM A;  3UUA B;  3VHV A;  4UDA A;  2VV4 B;  3FXV A;  2PIR A;  5DWI A;  2R6W A;  4G1Y A;  4KZI A;  3B68 A;  2ZAS A;  4MGD A;  3OGT A;  1XNX A;  1NUO A;  1DKF B;  3K23 A;  3ERT A;  3BEJ A;  2O9I A;  4RAK A;  5HYR A;  4OAR A;  5EC9 A;  1BSX A;  3GBK A;  3HVL A;  3W5R A;  2XKW A;  4OZT U;  1PQC A;  4P6W A;  1FCX A;  1GWR A;  4OHA A;  4OK1 A;  5GIC A;  5C4T A;  2XYX A;  1FCZ A;  3DT3 A;  5EHJ A;  4DK7 A;  5KYJ A;  3GN8 A;  3KDT A;  4X1F A;  1XV9 B;  2QXS A;  4QM0 A;  3VT3 A;  4NB6 A;  2YAT A;  1RDT A;  5KR9 A; 
#chains in the Genus database with same CATH homology
 5DP0 A;  1XQC A;  3OLS A;  3OS9 A;  5DWE A;  3VN2 A;  2ATH A;  3GZ9 A;  4NIE A;  5DU5 A;  3ZR7 A;  2GPP A;  4LBD A;  5DWJ A;  5DXG A;  5KYA A;  3PO9 A;  4G2H A;  1A52 A;  5JI0 D;  1NAV A;  3R8A A;  5G46 A;  1U3S A;  1NYX A;  2ZNQ A;  2HBH A;  2PIU A;  1NAX A;  4WPF A;  5KRA A;  4YMQ A;  3WWR A;  4DM8 A;  5I4V A;  4NY9 A;  5KCU A;  3CTB A;  4PVU A;  1T7T A;  5DYB A;  2HB8 A;  2Q59 A;  4G20 A;  3B0W A;  3OS8 C;  3F7D A;  5HJS A;  3UVV A;  4P6X A;  2Q61 A;  2GPV A;  5DIE A;  5DLR A;  2GP7 A;  3IPQ A;  5DUH A;  4PPS A;  3P8X A;  3MNP A;  4EMA A;  1X78 A;  5E7V A;  3VT6 A;  5DSH A;  2Q60 A;  3BQD A;  3VI8 A;  4JGV A;  4YPQ A;  2AX9 A;  1M2Z A;  3AN3 A;  1T5Z A;  4OEY A;  3CJW A;  3ET1 A;  3UUD B;  3H0A A;  2NXX E;  4IW8 A;  4JL4 A;  3WT7 A;  3WT6 A;  2HAR A;  3R8D A;  5LWP A;  4S15 A;  1SKX A;  2OM9 A;  2VV1 B;  3NSP A;  4ZNU A;  5DXM A;  1U3Q A;  1YIN A;  3FC6 B;  3L3X A;  3NSQ A;  3VT4 A;  4X1G A;  1FCY A;  4PPP A;  4R6S A;  2P1V A;  4B7W A;  3VTB A;  2PIQ A;  2PIW A;  4ZN7 A;  4RZE A;  1Z5X E;  1PQ6 A;  2AXA A;  4ZNS A;  3ET2 A;  1Y0X X;  2JFA B;  2YLY A;  4FNE A;  2POG A;  5DWL A;  1XZX X;  1KV6 A;  5DZH A;  3S9S A;  5DXP A;  2ZK6 A;  5ICK A;  2AA5 A;  4UDC A;  5E0X A;  5DY8 A;  5C4O A;  4MGC A;  2NXX A;  3PLZ A;  3KFC A;  1M7W A;  1FM9 A;  3D90 A;  1S0Z A;  5DK9 A;  1YYE A;  3B1M A;  3DR1 A;  4OKT A;  1QKT A;  1K4W A;  2Q5S A;  2ZMJ A;  3A2I A;  4HEE X;  4OGH A;  5FQT A;  2XYJ A;  3AZ3 A;  2AA2 A;  3FUG A;  2QH6 A;  3LBD A;  4J5W C;  3P89 A;  3HZF A;  1M13 A;  4A4W A;  4MG8 B;  3OOF A;  5DUE A;  1EXA A;  4PWL A;  3W0Y A;  4XUH A;  3VT5 A;  1VJB A;  5EI1 A;  4ZN9 A;  1PK5 A;  4Y29 A;  4HLW A;  2YFE A;  3JZC A;  4ZO1 X;  2QA8 A;  3ADU A;  1UHL B;  4IA2 A;  1NQ1 A;  3B65 A;  4OZT E;  4R06 A;  3U9Q A;  1DB1 A;  3W0A A;  3WMH A;  1TFC A;  1ILH A;  1T74 A;  1XLS E;  5EIT A;  2HWR A;  3IPS A;  4ONI A;  4MG7 B;  1LBD A;  3ERD A;  3IA6 A;  4K4J A;  1XJ7 A;  3KPZ A;  3HLV A;  2Q1H A;  3OMQ A;  2AX6 A;  4MGA A;  1NHZ A;  3PCU A;  2O4J A;  2YJA B;  3K22 A;  2Q7L A;  3ADS A;  2P1U A;  4OZR E;  3OZJ A;  3M7R A;  4KZM A;  5DXB A;  4IWC A;  4PLE A;  4PXM A;  4RMD A;  4IS8 A;  4OH5 A;  2Q1V A;  1XP6 A;  2ZK4 A;  3G8I A;  1XP1 A;  1YIM A;  4G1D A;  4OKW A;  4Q13 A;  5DIG A;  3OMP A;  2Q3Y A;  3D5F A;  4E2J A;  5EGV A;  2I4Z A;  2YHD A;  1ERE A;  1QKN A;  1G2N A;  2P54 A;  1XLS A;  3OKI A;  4RZF A;  2ACL A;  3V9T A;  2W8Y A;  1MV9 A;  3W5Q A;  2HFP A;  2G0G A;  4TUZ A;  3RLJ A;  5KCE A;  2YJD A;  1NQ0 A;  1XB7 A;  3HC5 A;  3IMY A;  4XHD A;  5AAV B;  2GPO A;  4JYG A;  2ZNO A;  1Z5X U;  2AMA A;  3VJT A;  3IXP D;  5DVC A;  1NQ7 A;  5E19 A;  5G44 A;  1T73 A;  4DM6 A;  4ZJR A;  1X7J A;  2QAB A;  2VST A;  3OKH A;  3R2A A;  3V3E A;  3HM1 A;  3VTC A;  4DOS A;  5B5B A;  2QGW A;  5JJM B;  4RMC A;  3TY0 A;  1SR7 A;  2Q70 A;  4WLB A;  3VRU A;  1H9U A;  1TXI A;  2PJL A;  3KBA A;  3X1I A;  5M96 A;  4IA3 A;  5DZI A;  3SP9 A;  3UUC A;  3D57 A;  1XNN A;  4G1Z A;  5IXK A;  5KRH A;  4BCR A;  2QMV A;  2F4B A;  2B1V A;  2QXM A;  2OVM A;  3VSP A;  3CS6 A;  1Q4X A;  4TV1 B;  5E0W A;  2QGT A;  2HCD A;  1GWQ A;  1WM0 X;  5KRO A;  4FHH A;  2AX8 A;  5IZ0 A;  2Q6R A;  2VV2 A;  4L96 A;  4OKB A;  3E00 D;  3DCT A;  2A3I A;  3RVF A;  3L1B A;  3EYB A;  4IW6 A;  3T03 A;  3R29 A;  4OJB A;  5DI7 A;  5L7E A;  1XVP B;  3W5P A;  4LTW A;  5KCT A;  3WFF A;  5E15 A;  4MGB B;  3WT5 A;  2REW A;  4OZR U;  4OC7 A;  3HO0 A;  1ERR A;  1UPW A;  1G5Y A;  2VV0 A;  3Q95 B;  5KCW A;  3KMZ A;  2I0J A;  4XLD A;  5AZT A;  4CI5 A;  3AUQ A;  3B5R A;  3FLI A;  5HJP A;  4IVY A;  5DX3 B;  5AYG A;  4YNK A;  2ZBS A;  1R20 D;  5DVV A;  5KCC A;  5DWG A;  2AWH A;  3KMR A;  4MG9 A;  5A86 A;  4IV4 A;  3V3Q A;  3GYU A;  5GT4 A;  2P1T A;  4Q0A C;  4IQR A;  4JYI A;  3VJS A;  5C4U A;  4JAZ A;  5B41 A;  1T7F A;  3A9E A;  4MDD A;  1FM6 D;  1S9Q A;  3JZB A;  2QW4 A;  5G43 A;  3UU7 A;  1FD0 A;  2BJ4 A;  3TKC A;  2BAW A;  3KWY A;  1K74 D;  4MG6 A;  2YLQ A;  4ZJW A;  4RUP A;  3F5C B;  1Z95 A;  3CWD A;  3OAP A;  2Q8S A;  4XTA A;  5AAU A;  3CDP A;  1RKG A;  3GWS X;  2PIN A;  2QZO B;  2ZVT A;  4E4Q A;  1Y0S A;  2GL8 A;  2PNU A;  1SJ0 A;  4OIU A;  3L0E A;  5C4S A;  1XDK A;  5G42 A;  2NW4 A;  4QJR A;  5DV6 A;  5DZ3 A;  3DY6 A;  4LNW A;  3RY9 A;  1T7R A;  1MVC A;  3HOD A;  4QK4 A;  3W0J A;  1I37 A;  2OCF A;  3W0H A;  1RDT D;  1ZUC A;  2QNV A;  2YLP A;  4JYH A;  2J7Y A;  3B3K A;  2R6Y A;  3VSO A;  2ZLC A;  3FAL A;  4FGY A;  5DXR A;  4MGD B;  1QKM A;  1OVL A;  1R5K A;  2XYW A;  2ZXN A;  4CSJ A;  3GYT A;  5HYK A;  1R6G A;  3AFR A;  4S0S A;  5G5W A;  2Q5P A;  4APU A;  2OAX A;  4N8R A;  1EXX A;  3VHW A;  4WHG A;  3RUT A;  4CI4 A;  4K6I A;  3A40 X;  2ZY0 A;  5KRC A;  2Q5G A;  3G0W A;  4J26 A;  5DID A;  1T76 A;  3SP6 A;  4OIV A;  4PLD A;  4WVD A;  1L2J A;  3VT9 A;  4PP3 A;  1NDE A;  3RLL A;  2VV3 A;  1U9E A;  3ILZ A;  3P88 A;  5SYZ A;  1HJ1 A;  1KNU A;  1N83 A;  3DCU A;  4OEZ A;  2ABI A;  1E3K A;  3R5M A;  3CS8 A;  3FUR A;  3OMM A;  4OJ9 A;  4MG5 A;  4RE8 A;  3WTQ A;  3L03 A;  3UUA A;  1YMT A;  3E7C A;  2VV4 A;  2AB2 A;  5CJ6 A;  5DZ1 A;  5APJ A;  3PRG A;  3WJ4 A;  2FSZ A;  5KCD A;  4IVW A;  2QSE A;  1HG4 A;  2ZK0 A;  5H1E A;  5KRI A;  2J4A A;  4POJ A;  1DKF A;  1PQ9 A;  2GIU A;  3R8I A;  3B0T A;  1NRL A;  1R1K D;  2Q59 B;  2ZNP A;  3IXP A;  3W0G A;  3UVV B;  2FVJ A;  3O1E A;  1IE8 A;  1MZN A;  2E2R A;  5FQR A;  3OLF A;  4A2J A;  3VJH A;  5KCF A;  5DMC A;  5DYD A;  4PRG A;  2NPA A;  3H52 A;  3VHU A;  1PZL A;  1XV9 A;  1ZDT A;  2PIO A;  1N46 A;  1X7E A;  1T65 A;  1T7M A;  3R5N A;  4N1Y A;  4YT1 A;  4WHF A;  2IOK A;  3W0C A;  2ZFX A;  5ETH A;  2OUZ A;  3KYT A;  5ACC A;  3PEQ A;  5FQP A;  4KZJ A;  2PIP L;  1FM9 D;  3AN4 A;  5G3J A;  4FHI A;  2ZK5 A;  3A3Z X;  2Q7J A;  1ZKY A;  3OS8 A;  5KRJ A;  5AWK A;  5DMF A;  4REE A;  4ITF A;  2ZLA A;  2P7Z A;  2LBD A;  3K8S A;  3E00 A;  3PBA A;  2O4R A;  5GID A;  2FAI A;  3CQV A;  1S19 A;  1X76 A;  1PCG A;  2PIV A;  4ZO1 B;  2YLO A;  3OSI A;  4OIL A;  4XAO A;  4IWF A;  4OED A;  4PP5 A;  4L98 A;  2AO6 A;  3RUU A;  1G1U A;  4ZI1 A;  2QE4 A;  1FBY A;  5DKE A;  1G50 A;  1PDU A;  2HB7 A;  4UDB A;  2AX7 A;  3WJ5 A;  2G5O A;  2IHQ A;  4OEA A;  4LSJ A;  3UUD A;  4REF A;  4QL8 A;  4XT9 A;  4J5X C;  3VRT A;  1R20 A;  4M8E A;  1OSH A;  3VT7 A;  5HZC A;  5L11 A;  2PRG A;  1T79 A;  2G44 A;  3AUR A;  3V9V A;  2VV1 A;  3ZQT A;  2HVC A;  2Q7I A;  3AZ2 A;  3FC6 A;  2QA8 B;  5KRK A;  5K13 A;  1I7I A;  5E1C A;  1FM6 A;  2ZK1 A;  4J24 A;  3DZY D;  2R40 D;  1YA3 A;  1K74 A;  2I4J A;  3UP3 A;  1I7G A;  2JFA A;  5EJV A;  3L0L A;  3OMK A;  2P15 A;  4MGA B;  1OSV A;  4OKX A;  3O1D A;  1RJK A;  2J14 A;  5DXQ A;  4J5W A;  5KRM A;  5L7G A;  4RME A;  2QR9 A;  3SZ1 A;  4NUF A;  4RUO X;  3DZU D;  5DXB B;  1K7L A;  2POB A;  5DKS A;  4EM9 A;  3OOK A;  2J7X A;  1I38 A;  2GTK A;  2PIX A;  3A78 A;  3KDU A;  2PIT A;  3FS1 A;  3QT0 A;  5KRF A;  4OLM A;  3OZ0 A;  3OLL A;  2ACL B;  4MG8 A;  2I4P A;  3OSA A;  3X36 A;  5DRJ A;  4TUZ B;  5F9B A;  2GWX A;  2B1Z A;  3V49 A;  2OVH A;  3ET0 A;  1UHL A;  2EWP A;  1ILG A;  5DRM A;  4OH6 A;  2AAX A;  4POH A;  5JY3 A;  5AVL A;  3ZRA A;  3B66 A;  3GWX A;  4MG7 A;  3AX8 A;  4IUI A;  1P8D A;  4IA7 A;  3A2H A;  3ADW A;  4RUJ A;  3TX7 B;  5FQS A;  5DXK A;  3ET3 A;  3HC6 A;  3IPU A;  2HC4 A;  3OSW A;  5AK2 A;  1E3G A;  2AM9 A;  4O8F A;  1XAP A;  1A28 A;  1NQ2 A;  4E4K A;  3WFG A;  3BC5 A;  5DV3 A;  2ZXM A;  2H77 A;  3FEI A;  2VSR A;  1GS4 A;  4N5G A;  2ZKC A;  5GIE A;  2IOG A;  5AZV A;  2ZNN A;  1SQN A;  2P7A A;  1YY4 A;  3VRW A;  5E14 A;  3VRV A;  1YOK A;  1ZH7 A;  2QA6 A;  5AAV A;  4NQA B;  1RKH A;  4DQM A;  4LNX A;  1R1K A;  3W0I A;  5APH A;  3X1H A;  2NV7 A;  3UP0 A;  2QTU A;  1N4H A;  1XP9 A;  2V0V A;  1ZEO A;  3AZ1 A;  4IA1 A;  5DV8 A;  3CS4 A;  3D24 A;  5L7H A;  3WGP A;  4DK8 A;  1YOW A;  5JJM A;  1U3R A;  3V9Y A;  1T63 A;  2ZK3 A;  2ZK2 A;  3P0U A;  5G45 A;  3G8O A;  5KRL A;  1X7R A;  4N73 A;  4ZNH A;  3B0R A;  5LGA A;  3W5T A;  2Q6J A;  3VTD A;  2HAM A;  2Q7K A;  4J5X A;  4ITE A;  1S0X A;  4G2I A;  5HJP B;  4A4V A;  2JJ3 A;  3L3Z A;  3ZRB A;  3H0A D;  4MG9 B;  1QKU A;  3V4A A;  4TV1 A;  4OFU A;  4QE6 A;  5DL4 A;  3L0J A;  1Y9R A;  5IAW A;  2P4Y A;  3A9E B;  1UPV A;  3ADV A;  1ZDU A;  2B23 A;  3UU7 B;  2BJ4 B;  1XOW A;  3A2J A;  5FQV A;  2Z4J A;  3KMG A;  5DTV A;  2H79 A;  5DKB A;  5AVI A;  1YP0 A;  1ZGY A;  3MNO A;  4M8H A;  1XQ3 A;  2HWQ A;  1LV2 A;  2GPU A;  3CLD A;  5DZ0 A;  5DKG A;  4K7A A;  1XVP A;  3CDS A;  3NOA A;  4DMA A;  4MGB A;  5DVS A;  2Z4B A;  2ZMH A;  1IE9 A;  3B0Q A;  4F9M A;  2ZL9 A;  2ZMI A;  3Q95 A;  1ZAF A;  2PKL A;  2AA6 A;  4ZNT A;  3GD2 A;  1XDK B;  4Q50 A;  4S14 A;  1YJE A;  2G0H A;  4XI3 A;  4WQP A;  5DX3 A;  5HCV A;  5KD9 A;  2OZ7 A;  1GWX A;  4DOR A;  2QPY A;  2P7G A;  4OFR A;  3D6D A;  4PF3 A;  4IV2 A;  1S9P A;  4OJ4 A;  5AWJ A;  2B50 A;  2V7C A;  2AYR A;  3FAL B;  3K6P A;  4PP6 A;  1OVL B;  4FN9 A;  4RWV A;  4RZG A;  3VT8 A;  1UOM A;  3DZY A;  2R40 A;  1P93 A;  4G21 A;  3AUN A;  3ADT A;  3OMO A;  5DXE A;  2I0G A;  2HAS A;  3HQ5 A;  4R2U A;  5DUG A;  3MNE A;  3F5C A;  4ZOM A;  3TKM A;  4UDD A;  3VJI A;  1X7B A;  1PRG A;  3DZU A;  2QZO A;  4QE8 A;  3G9E A;  1YUC A;  1OT7 A;  2AA7 A;  2ZXZ A;  3E94 A;  1XIU A;  1XPC A;  3FEJ A;  4ZNW A;  1KKQ A;  1RK3 A;  3ADX A;  4RFW A;  4ZNV A;  3B67 A;  1L2I A;  2XHS A;  5APK A;  2Q6S A;  4IU7 A;  2JF9 A;  4S0T A;  3N00 A;  3LMP A;  3X31 A;  2AMB A;  4XUM A;  3UUA B;  3VHV A;  4UDA A;  2VV4 B;  3FXV A;  2PIR A;  5DWI A;  2R6W A;  4G1Y A;  4KZI A;  3B68 A;  2ZAS A;  4MGD A;  3OGT A;  1XNX A;  1NUO A;  1DKF B;  3K23 A;  3ERT A;  3BEJ A;  2O9I A;  4RAK A;  5HYR A;  4OAR A;  5EC9 A;  1BSX A;  3GBK A;  3HVL A;  3W5R A;  2XKW A;  4OZT U;  1PQC A;  4P6W A;  1FCX A;  1GWR A;  4OHA A;  4OK1 A;  5GIC A;  5C4T A;  2XYX A;  1FCZ A;  3DT3 A;  5EHJ A;  4DK7 A;  5KYJ A;  3GN8 A;  3KDT A;  4X1F A;  1XV9 B;  2QXS A;  4QM0 A;  3VT3 A;  4NB6 A;  2YAT A;  1RDT A;  5KR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...