4MDDA

Crystal structure of the glucocorticoid receptor bound to a non-steroidal antagonist reveals repositioning and partial disordering of activation function helix 12
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
247
structure length
247
Chain Sequence
PTLVSALETIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMYLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPDMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQALFDAIRMTYIKELGKAIVKREGNSSQNSQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Glucocorticoid Receptor Bound to a Non-steroidal Antagonist Reveals Repositioning and Partial Disordering of Activation Function Helix 12
rcsb
molecule keywords Glucocorticoid receptor
molecule tags Protein binding
source organism Homo sapiens
total genus 92
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4mddA01
3WJ5A 2YLQA 3FEJA 3GWSX 5DXMA 4LSJA 1XPCA 3W5RA 2YFEA 5AAVA 3OKHA 2PJLA 2Q1HA 1XQ3A 1S9QA 4FHHA 3ET0A 4XAOA 1M13A 1I37A 1KNUA 2H79A 4OGHA 4OZTU 5ETHA 5AVLA 3V9TA 4FHIA 3D24A 2QXMA 3OS8C 2ZNNA 1PQ9A 1R20A 1RDTA 2B23A 2NPAA 2ZMHA 4OFRA 5DVVA 2ZMJA 3HLVA 1UOMA 3A2JA 4IW6A 1EREA 4XI3A 2REWA 3VTCA 3AN4A 3OKIA 4P6XA 1IE9A 2I4JA 2Z4BA 3B1MA 5KCFA 4TV1B 3U9QA 3PLZA 5C4TA 1XZXX 1ZH7A 3E00D 3P88A 3W0CA 3DZUD 2XYXA 5LGAA 2NW4A 4ZNWA 2AX8A 5FQSA 4L98A 2P7ZA 5DXQA 1P8DA 4M8HA 3MNPA 5AZTA 5KRMA 3D90A 4ZNVA 1EXAA 3OS9A 2YLYA 1PQCA 5E19A 5E15A 3G9EA 3X31A 1FM6D 2R40D 1SR7A 2EWPA 1PRGA 3IMYA 3HVLA 2GTKA 3IXPA 2GL8A 4J24A 3WMHA 5DSHA 5FQRA 1ILGA 5G45A 3RLJA 5SYZA 4RMDA 1MZNA 2G0HA 2Q5PA 3VTDA 5JJMA 2VV1A 3VSPA 4A4VA 3KFCA 3UVVB 5AK2A 4DM6A 2HC4A 1R20D 1RDTD 3K22A 5F9BA 1G2NA 3ILZA 3RUTA 1X7RA 1NHZA 3B67A 2OVMA 2VV3A 3SP9A 3PEQA 3HODA 1X7EA 4IA2A 2HVCA 3AZ3A 4PXMA 3OLSA 4UDBA 4WHFA 2J7XA 3R29A 5DP0A 4POJA 4ZN9A 3DZYA 2AA7A 1Z95A 2G5OA 4MGBA 5DYDA 3UUAA 3WTQA 4MG8B 2VV2A 4ZJRA 5DZ1A 3A2HA 1NQ0A 1FCYA 5HCVA 3WT5A 5KRFA 2IOGA 1E3GA 2PNUA 1M7WA 2I0GA 5DKGA 2VV0A 2AXAA 4UDCA 2AYRA 4OZRE 4PP5A 3HC6A 2J7YA 1ZGYA 3NSQA 5DKEA 5DVSA 2QA8B 3FS1A 3SZ1A 2QR9A 5KCWA 1X76A 2Q5GA 5HJSA 5GIEA 3VHUA 2PIOA 1RKHA 2R6YA 4S0SA 4ZN7A 3P8XA 4CI5A 5AYGA 2JFAA 3ZR7A 1YOKA 5DMFA 2VV4A 1YUCA 2Q1VA 5DXPA 4OZRU 3VJHA 3WWRA 3PRGA 3IA6A 5KRCA 2ZXZA 3HO0A 2V0VA 4IVYA 3TKMA 2YJDA 3DZYD 4IVWA 4P6WA 2ZBSA 3H52A 1YY4A 4RZEA 3W5QA 3L0LA 2AX9A 4R6SA 4WQPA 3ET1A 3ADXA 4ZOMA 5L7HA 4PF3A 1VJBA 2NXXE 2FSZA 1MVCA 3OMPA 4IUIA 3T03A 5KROA 3IPSA 3FUGA 5DL4A 2AWHA 2PIQA 4KZIA 2PIVA 2ABIA 2GWXA 3E94A 2V7CA 2ZK5A 4WPFA 4DMAA 2AB2A 1TFCA 2NXXA 2ZK0A 4OHAA 4XUMA 2G0GA 1XV9A 2ZFXA 4TUZA 1Z5XE 3BC5A 3OZ0A 4L96A 5AWKA 4JYGA 5DUEA 3V49A 3K23A 2PIPL 3AUNA 4JGVA 5G5WA 3X1HA 5ACCA 4K7AA 4MG9A 2HB8A 2ZNPA 2QXSA 4XT9A 5DYBA 3HZFA 1E3KA 1ZEOA 4PLEA 5E14A 3AURA 2HBHA 5EC9A 5KYJA 1UHLB 5DWLA 4QE8A 3P89A 1XDKA 2QGWA 3IPUA 5DX3A 1OVLB 1ZKYA 2XYJA 5APKA 4OZTE 4EM9A 2BAWA 1UPWA 5DWGA 4MGAB 1GWXA 4OIUA 4YPQA 3PBAA 2J14A 4DOSA 1FM6A 3FEIA 3GZ9A 1XQCA 2AX6A 3TX7B 1BSXA 1XLSE 1R1KA 1Y0SA 2H77A 2B1ZA 2W8YA 3W0AA 5EITA 1OSVA 4XTAA 4LBDA 2ZXMA 1G1UA 4UDAA 3JZCA 5DIGA 1K74A 5C4SA 4Y29A 5DIDA 4YT1A 1XLSA 3TY0A 1MV9A 4ZNTA 1DKFA 4K4JA 5G44A 1NDEA 4HLWA 5DV6A 5AVIA 5KRIA 3UU7B 4DM8A 3CS8A 3FC6A 1FM9A 4G2HA 1LBDA 3R8IA 3VRTA 4N5GA 3VT9A 4OH6A 4EMAA 5DK9A 5H1EA 4OKWA 4G2IA 2ZK4A 4J5XC 2YLPA 4O8FA 4S14A 4PVUA 2J4AA 3V4AA 5M96A 4XUHA 1GWRA 1KKQA 4ZJWA 3G0WA 1ZDUA 3OS8A 5G43A 4APUA 3B0WA 3AN3A 2NV7A 3WJ4A 4MGCA 5GIDA 1R1KD 2YJAB 2O4JA 5DTVA 4Q50A 5DUHA 3VN2A 1XV9B 3RUUA 3O1EA 4XHDA 3GWXA 3HM1A 3PCUA 3OAPA 1XP1A 5DXBA 2Q6JA 3G8IA 1K74D 5KCEA 2Q61A 4MG9B 1PDUA 3ADUA 3CLDA 3ZRAA 3OMKA 3F5CA 2AO6A 1U3QA 2QA6A 2QZOB 3B0QA 4IW8A 3LMPA 3R5MA 3A9EB 5DIEA 2ZY0A 4Q0AC 4IU7A 2P15A 1FM9D 2IOKA 3KDTA 4PWLA 3FALA 5DXKA 5B5BA 4G1YA 1XIUA 3D57A 3BQDA 4B7WA 5HJPB 4IWFA 5KYAA 4CSJA 1X7BA 2ACLA 3L0JA 1FBYA 5L7EA 2Q60A 4QE6A 1U3RA 1ZDTA 4MG7B 1XVPB 1T5ZA 2HAMA 3W5PA 4MDDA 5IAWA 3G8OA 4G1ZA 1YINA 5A86A 3VJIA 4OH5A 2AAXA 2P7GA 1RKGA 3FXVA 3WFFA 3VRVA 2P1TA 3JZBA 3Q95A 3W0YA 4PP6A 1XOWA 4G1DA 4IWCA 5L7GA 5AAVB 3WT6A 3OZJA 1QKNA 1S0ZA 4OJ4A 4LNXA 1PQ6A 1K7LA 1TXIA 2Q5SA 3K8SA 4OEDA 3WT7A 1IE8A 3D6DA 4FNEA 4DORA 5DXGA 3UUDA 2Q59A 2XHSA 2Q3YA 2Z4JA 3AZ2A 4OILA 5IXKA 4LTWA 3L03A 1T7FA 3VRWA 3R5NA 3L3XA 2HARA 2ZK1A 3KMGA 1YP0A 5EI1A 1RK3A 5KRHA 2QABA 2PIXA 2QSEA 2PKLA 2QPYA 2QW4A 2HFPA 3FURA 5FQTA 3B0RA 5DWEA 3WFGA 3OSIA 2Q70A 1R5KA 3QT0A 2GIUA 4X1GA 3R8DA 5G46A 3UUCA 4ZNSA 4DQMA 3OLFA 1A52A 4OK1A 5E1CA 4K6IA 3CWDA 5DV8A 4MG5A 2ZVTA 1XNNA 1XP9A 3HC5A 3O1DA 4NB6A 5EGVA 1EXXA 2JF9A 2YHDA 2ZK3A 4RE8A 3H0AA 4IA7A 1HJ1A 3R8AA 2ZASA 3IPQA 4CI4A 1G50A 1NQ7A 2BJ4A 3MNEA 1SJ0A 5DI7A 1NRLA 3KDUA 3M7RA 4FGYA 4RUJA 3AUQA 2VV1B 3ERTA 5HZCA 5JJMB 1YOWA 5HYRA 4J5WC 5JI0D 5DXBB 1KV6A 3B3KA 5LWPA 2ZKCA 5C4UA 3DT3A 2HASA 4RUPA 3B65A 3WGPA 2OZ7A 1ZAFA 4IV2A 5K13A 4TV1A 3A3ZX 1L2IA 2PIWA 2POGA 4XLDA 2GPVA 3VJSA 3ADWA 2OM9A 1K4WA 5L11A 5G42A 1G5YA 2Q7IA 3S9SA 5APHA 2B1VA 4FN9A 3NOAA 1U9EA 4NY9A 2AMAA 3CS4A 1NQ1A 4QJRA 1T76A 3VHWA 5EJVA 5DWIA 4MGBB 3CJWA 2AMBA 4M8EA 5GT4A 4PPPA 3UUAB 3VT3A 4RZGA 3W0HA 2ZK2A 3GYUA 3VT6A 4RMEA 1PK5A 2Q7KA 2F4BA 3H0AD 3D5FA 3LBDA 1YIMA 2E2RA 3VRUA 3OMOA 5KCTA 3ADSA 3OMQA 5DV3A 4JYIA 5DZHA 3VSOA 1ERRA 3W0IA 3VJTA 2P1UA 2GPPA 3KBAA 4DK7A 4OKTA 2Q8SA 2YATA 4OC7A 4RUOX 4JL4A 3RLLA 3ZRBA 3MNOA 3A2IA 2QH6A 1NYXA 4RMCA 4UDDA 5DRMA 2B50A 2QMVA 1P93A 1ILHA 5AZVA 4S0TA 4QL8A 4ITEA 5B41A 4JYHA 4ZO1B 1N83A 1DB1A 4JAZA 2JFAB 3UP3A 4NUFA 5E0XA 2PITA 2VV4B 1X7JA 3VT8A 3KYTA 4YNKA 2VSRA 2Q7LA 4MG8A 2PINA 3V9VA 3VT7A 4PP3A 2ZLCA 2Q6RA 1NAVA 4REEA 4OARA 2ATHA 4E2JA 2G44A 3KMRA 2FAIA 2XKWA 3P0UA 2JJ3A 5AWJA 2GPOA 2QA8A 2ZL9A 3UP0A 4OIVA 3DCTA 4IA1A 5KCUA 4G20A 2P54A 3EYBA 3CTBA 5DRJA 4ONIA 2OVHA 2IHQA 5FQPA 2AX7A 1OT7A 2BJ4B 3AX8A 3VTBA 1GWQA 2P4YA 3OOFA 5DY8A 1T74A 4TUZB 5DKSA 3W0JA 3GYTA 4J26A 3RVFA 1YMTA 1ZUCA 2ZXNA 3V3QA 1OSHA 2GP7A 4J5XA 2AA6A 3OGTA 4OFUA 5DKBA 4NQAB 1XJ7A 2ZLAA 4MGDA 3AFRA 2GPUA 2LBDA 4X1FA 1T79A 1NUOA 1SQNA 3A40X 5EHJA 2O4RA 5DUGA 4A4WA 1H9UA 1N4HA 3TKCA 1XDKB 4E4QA 4N73A 4OEAA 2QE4A 5DX3B 1SKXA 4WLBA 1NQ2A 3VT5A 1NAXA 1FCXA 4RWVA 1PCGA 5E0WA 1QKTA 3ET2A 3OSWA 1X78A 1YYEA 1YA3A 5KD9A 5DXRA 4PPSA 4E4KA 3V9YA 1XP6A 1UPVA 2P7AA 5DZIA 4BCRA 2FVJA 3R2AA 4RFWA 1XB7A 1M2ZA 4Q13A 5KR9A 3HQ5A 5G3JA 2ZK6A 3SP6A 1T7RA 2POBA 4F9MA 3CDPA 2AA5A 3L1BA 1T73A 4IQRA 3V3EA 3CDSA 5DVCA 3CS6A 5FQVA 3DY6A 1UHLA 3F7DA 3B68A 1DKFB 4OJBA 4OKXA 1L2JA 3VT4A 5DWJA 1XNXA 2PRGA 2A3IA 1OVLA 4IV4A 1I38A 3FC6B 1R6GA 3FLIA 4MGAA 4N8RA 5DU5A 1WM0X 3ADTA 1S19A 4MG6A 3VHVA 5HYKA 1FCZA 3IXPD 3CQVA 4OJ9A 4OKBA 3NSPA 2AM9A 5APJA 5I4VA 5DZ3A 1T65A 4G21A 5KRJA 4REFA 2AA2A 2QTUA 1S9PA 5DMCA 5KCDA 1RJKA 1A28A 4QK4A 5JY3A 3L0EA 5DXEA 3A78A 5DZ0A 3RY9A 3KMZA 5CJ6A 3DCUA 3AZ1A 4PLDA 4NIEA 5KRLA 3GD2A 4QM0A 2Q6SA 4RAKA 5GICA 2VSTA 5DLRA 4HEEX 4ZNUA 4WHGA 3UU7A 4R2UA 2ZMIA 2R6WA 2HWRA 1YJEA 5KRKA 3F5CB 2QGTA 2PIUA 4OLMA 3W0GA 2OAXA 4MGDB 1T7TA 3VI8A 3BEJA 4POHA 3FALB 5IZ0A 1PZLA 3PO9A 4RZFA 5KCCA 3OSAA 1T7MA 2P1VA 3L3ZA 3W5TA 2ACLB 5AAUA 3ET3A 2I4PA 3B66A 2XYWA 4J5WA 4IA3A 2PIRA 3ERDA 5C4OA 2HWQA 2OUZA 3ADVA 4ZI1A 4A2JA 1I7IA 1QKMA 3X36A 1LV2A 1QKUA 3E7CA 4KZMA 2I4ZA 3Q95B 3UVVA 3ZQTA 4DK8A 1N46A 3DR1A 4OEYA 1GS4A 2ZNOA 3B5RA 2HCDA 3OMMA 5ICKA 2QZOA 2R40A 4S15A 3KWYA 1Y0XX 2I0JA 3A9EA 4IS8A 4ITFA 4LNWA 4ZO1X 5E7VA 2Q7JA 5KRAA 3UUDB 1Y9RA 4R06A 2Q59B 2HB7A 3K6PA 3KPZA 3OLLA 2QNVA 3E00A 1I7GA 1FD0A 2OCFA 4KZJA 3X1IA 4PRGA 1Z5XU 3OOKA 5HJPA 3B0TA 3DZUA 4ZNHA 1HG4A 4MG7A 1XVPA 4YMQA 2O9IA 1XAPA 2YLOA 1U3SA 2ZNQA 3GBKA 1T63A 3N00A 4N1YA 1Q4XA 3GN8A 1S0XA 4OEZA 4WVDA
chains in the Genus database with same CATH superfamily
3WJ5A 2YLQA 3FEJA 3GWSX 5DXMA 4LSJA 1XPCA 3W5RA 2YFEA 5AAVA 3OKHA 2PJLA 2Q1HA 1XQ3A 1S9QA 4FHHA 3ET0A 4XAOA 1M13A 1I37A 1KNUA 2H79A 4OGHA 4OZTU 5ETHA 5AVLA 3V9TA 4FHIA 3D24A 2QXMA 3OS8C 2ZNNA 1PQ9A 1R20A 1RDTA 2B23A 2NPAA 2ZMHA 4OFRA 5DVVA 2ZMJA 3HLVA 1UOMA 3A2JA 4IW6A 1EREA 4XI3A 2REWA 3VTCA 3AN4A 3OKIA 4P6XA 1IE9A 2I4JA 2Z4BA 3B1MA 5KCFA 4TV1B 3U9QA 3PLZA 5C4TA 1XZXX 1ZH7A 3E00D 3P88A 3W0CA 3DZUD 2XYXA 5LGAA 2NW4A 4ZNWA 2AX8A 5FQSA 4L98A 2P7ZA 5DXQA 1P8DA 4M8HA 3MNPA 5AZTA 5KRMA 3D90A 4ZNVA 1EXAA 3OS9A 2YLYA 1PQCA 5E19A 5E15A 3G9EA 3X31A 1FM6D 2R40D 1SR7A 2EWPA 1PRGA 3IMYA 3HVLA 2GTKA 3IXPA 2GL8A 4J24A 3WMHA 5DSHA 5FQRA 1ILGA 5G45A 3RLJA 5SYZA 4RMDA 1MZNA 2G0HA 2Q5PA 3VTDA 5JJMA 2VV1A 3VSPA 4A4VA 3KFCA 3UVVB 5AK2A 4DM6A 2HC4A 1R20D 1RDTD 3K22A 5F9BA 1G2NA 3ILZA 3RUTA 1X7RA 1NHZA 3B67A 2OVMA 2VV3A 3SP9A 3PEQA 3HODA 1X7EA 4IA2A 2HVCA 3AZ3A 4PXMA 3OLSA 4UDBA 4WHFA 2J7XA 3R29A 5DP0A 4POJA 4ZN9A 3DZYA 2AA7A 1Z95A 2G5OA 4MGBA 5DYDA 3UUAA 3WTQA 4MG8B 2VV2A 4ZJRA 5DZ1A 3A2HA 1NQ0A 1FCYA 5HCVA 3WT5A 5KRFA 2IOGA 1E3GA 2PNUA 1M7WA 2I0GA 5DKGA 2VV0A 2AXAA 4UDCA 2AYRA 4OZRE 4PP5A 3HC6A 2J7YA 1ZGYA 3NSQA 5DKEA 5DVSA 2QA8B 3FS1A 3SZ1A 2QR9A 5KCWA 1X76A 2Q5GA 5HJSA 5GIEA 3VHUA 2PIOA 1RKHA 2R6YA 4S0SA 4ZN7A 3P8XA 4CI5A 5AYGA 2JFAA 3ZR7A 1YOKA 5DMFA 2VV4A 1YUCA 2Q1VA 5DXPA 4OZRU 3VJHA 3WWRA 3PRGA 3IA6A 5KRCA 2ZXZA 3HO0A 2V0VA 4IVYA 3TKMA 2YJDA 3DZYD 4IVWA 4P6WA 2ZBSA 3H52A 1YY4A 4RZEA 3W5QA 3L0LA 2AX9A 4R6SA 4WQPA 3ET1A 3ADXA 4ZOMA 5L7HA 4PF3A 1VJBA 2NXXE 2FSZA 1MVCA 3OMPA 4IUIA 3T03A 5KROA 3IPSA 3FUGA 5DL4A 2AWHA 2PIQA 4KZIA 2PIVA 2ABIA 2GWXA 3E94A 2V7CA 2ZK5A 4WPFA 4DMAA 2AB2A 1TFCA 2NXXA 2ZK0A 4OHAA 4XUMA 2G0GA 1XV9A 2ZFXA 4TUZA 1Z5XE 3BC5A 3OZ0A 4L96A 5AWKA 4JYGA 5DUEA 3V49A 3K23A 2PIPL 3AUNA 4JGVA 5G5WA 3X1HA 5ACCA 4K7AA 4MG9A 2HB8A 2ZNPA 2QXSA 4XT9A 5DYBA 3HZFA 1E3KA 1ZEOA 4PLEA 5E14A 3AURA 2HBHA 5EC9A 5KYJA 1UHLB 5DWLA 4QE8A 3P89A 1XDKA 2QGWA 3IPUA 5DX3A 1OVLB 1ZKYA 2XYJA 5APKA 4OZTE 4EM9A 2BAWA 1UPWA 5DWGA 4MGAB 1GWXA 4OIUA 4YPQA 3PBAA 2J14A 4DOSA 1FM6A 3FEIA 3GZ9A 1XQCA 2AX6A 3TX7B 1BSXA 1XLSE 1R1KA 1Y0SA 2H77A 2B1ZA 2W8YA 3W0AA 5EITA 1OSVA 4XTAA 4LBDA 2ZXMA 1G1UA 4UDAA 3JZCA 5DIGA 1K74A 5C4SA 4Y29A 5DIDA 4YT1A 1XLSA 3TY0A 1MV9A 4ZNTA 1DKFA 4K4JA 5G44A 1NDEA 4HLWA 5DV6A 5AVIA 5KRIA 3UU7B 4DM8A 3CS8A 3FC6A 1FM9A 4G2HA 1LBDA 3R8IA 3VRTA 4N5GA 3VT9A 4OH6A 4EMAA 5DK9A 5H1EA 4OKWA 4G2IA 2ZK4A 4J5XC 2YLPA 4O8FA 4S14A 4PVUA 2J4AA 3V4AA 5M96A 4XUHA 1GWRA 1KKQA 4ZJWA 3G0WA 1ZDUA 3OS8A 5G43A 4APUA 3B0WA 3AN3A 2NV7A 3WJ4A 4MGCA 5GIDA 1R1KD 2YJAB 2O4JA 5DTVA 4Q50A 5DUHA 3VN2A 1XV9B 3RUUA 3O1EA 4XHDA 3GWXA 3HM1A 3PCUA 3OAPA 1XP1A 5DXBA 2Q6JA 3G8IA 1K74D 5KCEA 2Q61A 4MG9B 1PDUA 3ADUA 3CLDA 3ZRAA 3OMKA 3F5CA 2AO6A 1U3QA 2QA6A 2QZOB 3B0QA 4IW8A 3LMPA 3R5MA 3A9EB 5DIEA 2ZY0A 4Q0AC 4IU7A 2P15A 1FM9D 2IOKA 3KDTA 4PWLA 3FALA 5DXKA 5B5BA 4G1YA 1XIUA 3D57A 3BQDA 4B7WA 5HJPB 4IWFA 5KYAA 4CSJA 1X7BA 2ACLA 3L0JA 1FBYA 5L7EA 2Q60A 4QE6A 1U3RA 1ZDTA 4MG7B 1XVPB 1T5ZA 2HAMA 3W5PA 4MDDA 5IAWA 3G8OA 4G1ZA 1YINA 5A86A 3VJIA 4OH5A 2AAXA 2P7GA 1RKGA 3FXVA 3WFFA 3VRVA 2P1TA 3JZBA 3Q95A 3W0YA 4PP6A 1XOWA 4G1DA 4IWCA 5L7GA 5AAVB 3WT6A 3OZJA 1QKNA 1S0ZA 4OJ4A 4LNXA 1PQ6A 1K7LA 1TXIA 2Q5SA 3K8SA 4OEDA 3WT7A 1IE8A 3D6DA 4FNEA 4DORA 5DXGA 3UUDA 2Q59A 2XHSA 2Q3YA 2Z4JA 3AZ2A 4OILA 5IXKA 4LTWA 3L03A 1T7FA 3VRWA 3R5NA 3L3XA 2HARA 2ZK1A 3KMGA 1YP0A 5EI1A 1RK3A 5KRHA 2QABA 2PIXA 2QSEA 2PKLA 2QPYA 2QW4A 2HFPA 3FURA 5FQTA 3B0RA 5DWEA 3WFGA 3OSIA 2Q70A 1R5KA 3QT0A 2GIUA 4X1GA 3R8DA 5G46A 3UUCA 4ZNSA 4DQMA 3OLFA 1A52A 4OK1A 5E1CA 4K6IA 3CWDA 5DV8A 4MG5A 2ZVTA 1XNNA 1XP9A 3HC5A 3O1DA 4NB6A 5EGVA 1EXXA 2JF9A 2YHDA 2ZK3A 4RE8A 3H0AA 4IA7A 1HJ1A 3R8AA 2ZASA 3IPQA 4CI4A 1G50A 1NQ7A 2BJ4A 3MNEA 1SJ0A 5DI7A 1NRLA 3KDUA 3M7RA 4FGYA 4RUJA 3AUQA 2VV1B 3ERTA 5HZCA 5JJMB 1YOWA 5HYRA 4J5WC 5JI0D 5DXBB 1KV6A 3B3KA 5LWPA 2ZKCA 5C4UA 3DT3A 2HASA 4RUPA 3B65A 3WGPA 2OZ7A 1ZAFA 4IV2A 5K13A 4TV1A 3A3ZX 1L2IA 2PIWA 2POGA 4XLDA 2GPVA 3VJSA 3ADWA 2OM9A 1K4WA 5L11A 5G42A 1G5YA 2Q7IA 3S9SA 5APHA 2B1VA 4FN9A 3NOAA 1U9EA 4NY9A 2AMAA 3CS4A 1NQ1A 4QJRA 1T76A 3VHWA 5EJVA 5DWIA 4MGBB 3CJWA 2AMBA 4M8EA 5GT4A 4PPPA 3UUAB 3VT3A 4RZGA 3W0HA 2ZK2A 3GYUA 3VT6A 4RMEA 1PK5A 2Q7KA 2F4BA 3H0AD 3D5FA 3LBDA 1YIMA 2E2RA 3VRUA 3OMOA 5KCTA 3ADSA 3OMQA 5DV3A 4JYIA 5DZHA 3VSOA 1ERRA 3W0IA 3VJTA 2P1UA 2GPPA 3KBAA 4DK7A 4OKTA 2Q8SA 2YATA 4OC7A 4RUOX 4JL4A 3RLLA 3ZRBA 3MNOA 3A2IA 2QH6A 1NYXA 4RMCA 4UDDA 5DRMA 2B50A 2QMVA 1P93A 1ILHA 5AZVA 4S0TA 4QL8A 4ITEA 5B41A 4JYHA 4ZO1B 1N83A 1DB1A 4JAZA 2JFAB 3UP3A 4NUFA 5E0XA 2PITA 2VV4B 1X7JA 3VT8A 3KYTA 4YNKA 2VSRA 2Q7LA 4MG8A 2PINA 3V9VA 3VT7A 4PP3A 2ZLCA 2Q6RA 1NAVA 4REEA 4OARA 2ATHA 4E2JA 2G44A 3KMRA 2FAIA 2XKWA 3P0UA 2JJ3A 5AWJA 2GPOA 2QA8A 2ZL9A 3UP0A 4OIVA 3DCTA 4IA1A 5KCUA 4G20A 2P54A 3EYBA 3CTBA 5DRJA 4ONIA 2OVHA 2IHQA 5FQPA 2AX7A 1OT7A 2BJ4B 3AX8A 3VTBA 1GWQA 2P4YA 3OOFA 5DY8A 1T74A 4TUZB 5DKSA 3W0JA 3GYTA 4J26A 3RVFA 1YMTA 1ZUCA 2ZXNA 3V3QA 1OSHA 2GP7A 4J5XA 2AA6A 3OGTA 4OFUA 5DKBA 4NQAB 1XJ7A 2ZLAA 4MGDA 3AFRA 2GPUA 2LBDA 4X1FA 1T79A 1NUOA 1SQNA 3A40X 5EHJA 2O4RA 5DUGA 4A4WA 1H9UA 1N4HA 3TKCA 1XDKB 4E4QA 4N73A 4OEAA 2QE4A 5DX3B 1SKXA 4WLBA 1NQ2A 3VT5A 1NAXA 1FCXA 4RWVA 1PCGA 5E0WA 1QKTA 3ET2A 3OSWA 1X78A 1YYEA 1YA3A 5KD9A 5DXRA 4PPSA 4E4KA 3V9YA 1XP6A 1UPVA 2P7AA 5DZIA 4BCRA 2FVJA 3R2AA 4RFWA 1XB7A 1M2ZA 4Q13A 5KR9A 3HQ5A 5G3JA 2ZK6A 3SP6A 1T7RA 2POBA 4F9MA 3CDPA 2AA5A 3L1BA 1T73A 4IQRA 3V3EA 3CDSA 5DVCA 3CS6A 5FQVA 3DY6A 1UHLA 3F7DA 3B68A 1DKFB 4OJBA 4OKXA 1L2JA 3VT4A 5DWJA 1XNXA 2PRGA 2A3IA 1OVLA 4IV4A 1I38A 3FC6B 1R6GA 3FLIA 4MGAA 4N8RA 5DU5A 1WM0X 3ADTA 1S19A 4MG6A 3VHVA 5HYKA 1FCZA 3IXPD 3CQVA 4OJ9A 4OKBA 3NSPA 2AM9A 5APJA 5I4VA 5DZ3A 1T65A 4G21A 5KRJA 4REFA 2AA2A 2QTUA 1S9PA 5DMCA 5KCDA 1RJKA 1A28A 4QK4A 5JY3A 3L0EA 5DXEA 3A78A 5DZ0A 3RY9A 3KMZA 5CJ6A 3DCUA 3AZ1A 4PLDA 4NIEA 5KRLA 3GD2A 4QM0A 2Q6SA 4RAKA 5GICA 2VSTA 5DLRA 4HEEX 4ZNUA 4WHGA 3UU7A 4R2UA 2ZMIA 2R6WA 2HWRA 1YJEA 5KRKA 3F5CB 2QGTA 2PIUA 4OLMA 3W0GA 2OAXA 4MGDB 1T7TA 3VI8A 3BEJA 4POHA 3FALB 5IZ0A 1PZLA 3PO9A 4RZFA 5KCCA 3OSAA 1T7MA 2P1VA 3L3ZA 3W5TA 2ACLB 5AAUA 3ET3A 2I4PA 3B66A 2XYWA 4J5WA 4IA3A 2PIRA 3ERDA 5C4OA 2HWQA 2OUZA 3ADVA 4ZI1A 4A2JA 1I7IA 1QKMA 3X36A 1LV2A 1QKUA 3E7CA 4KZMA 2I4ZA 3Q95B 3UVVA 3ZQTA 4DK8A 1N46A 3DR1A 4OEYA 1GS4A 2ZNOA 3B5RA 2HCDA 3OMMA 5ICKA 2QZOA 2R40A 4S15A 3KWYA 1Y0XX 2I0JA 3A9EA 4IS8A 4ITFA 4LNWA 4ZO1X 5E7VA 2Q7JA 5KRAA 3UUDB 1Y9RA 4R06A 2Q59B 2HB7A 3K6PA 3KPZA 3OLLA 2QNVA 3E00A 1I7GA 1FD0A 2OCFA 4KZJA 3X1IA 4PRGA 1Z5XU 3OOKA 5HJPA 3B0TA 3DZUA 4ZNHA 1HG4A 4MG7A 1XVPA 4YMQA 2O9IA 1XAPA 2YLOA 1U3SA 2ZNQA 3GBKA 1T63A 3N00A 4N1YA 1Q4XA 3GN8A 1S0XA 4OEZA 4WVDA
chains in the Genus database with same CATH topology
3WJ5A 2YLQA 3FEJA 3GWSX 5DXMA 4LSJA 1XPCA 3W5RA 2YFEA 5AAVA 3OKHA 2PJLA 2Q1HA 1XQ3A 1S9QA 4FHHA 3ET0A 4XAOA 1M13A 1I37A 1KNUA 2H79A 4OGHA 4OZTU 5ETHA 5AVLA 3V9TA 4FHIA 3D24A 2QXMA 3OS8C 2ZNNA 1PQ9A 1R20A 1RDTA 2B23A 2NPAA 2ZMHA 4OFRA 5DVVA 2ZMJA 3HLVA 1UOMA 3A2JA 4IW6A 1EREA 4XI3A 2REWA 3VTCA 3AN4A 3OKIA 4P6XA 1IE9A 2I4JA 2Z4BA 3B1MA 5KCFA 4TV1B 3U9QA 3PLZA 5C4TA 1XZXX 1ZH7A 3E00D 3P88A 3W0CA 3DZUD 2XYXA 5LGAA 2NW4A 4ZNWA 2AX8A 5FQSA 4L98A 2P7ZA 5DXQA 1P8DA 4M8HA 3MNPA 5AZTA 5KRMA 3D90A 4ZNVA 1EXAA 3OS9A 2YLYA 1PQCA 5E19A 5E15A 3G9EA 3X31A 1FM6D 2R40D 1SR7A 2EWPA 1PRGA 3IMYA 3HVLA 2GTKA 3IXPA 2GL8A 4J24A 3WMHA 5DSHA 5FQRA 1ILGA 5G45A 3RLJA 5SYZA 4RMDA 1MZNA 2G0HA 2Q5PA 3VTDA 5JJMA 2VV1A 3VSPA 4A4VA 3KFCA 3UVVB 5AK2A 4DM6A 2HC4A 1R20D 1RDTD 3K22A 5F9BA 1G2NA 3ILZA 3RUTA 1X7RA 1NHZA 3B67A 2OVMA 2VV3A 3SP9A 3PEQA 3HODA 1X7EA 4IA2A 2HVCA 3AZ3A 4PXMA 3OLSA 4UDBA 4WHFA 2J7XA 3R29A 5DP0A 4POJA 4ZN9A 3DZYA 2AA7A 1Z95A 2G5OA 4MGBA 5DYDA 3UUAA 3WTQA 4MG8B 2VV2A 4ZJRA 5DZ1A 3A2HA 1NQ0A 1FCYA 5HCVA 3WT5A 5KRFA 2IOGA 1E3GA 2PNUA 1M7WA 2I0GA 5DKGA 2VV0A 2AXAA 4UDCA 2AYRA 4OZRE 4PP5A 3HC6A 2J7YA 1ZGYA 3NSQA 5DKEA 5DVSA 2QA8B 3FS1A 3SZ1A 2QR9A 5KCWA 1X76A 2Q5GA 5HJSA 5GIEA 3VHUA 2PIOA 1RKHA 2R6YA 4S0SA 4ZN7A 3P8XA 4CI5A 5AYGA 2JFAA 3ZR7A 1YOKA 5DMFA 2VV4A 1YUCA 2Q1VA 5DXPA 4OZRU 3VJHA 3WWRA 3PRGA 3IA6A 5KRCA 2ZXZA 3HO0A 2V0VA 4IVYA 3TKMA 2YJDA 3DZYD 4IVWA 4P6WA 2ZBSA 3H52A 1YY4A 4RZEA 3W5QA 3L0LA 2AX9A 4R6SA 4WQPA 3ET1A 3ADXA 4ZOMA 5L7HA 4PF3A 1VJBA 2NXXE 2FSZA 1MVCA 3OMPA 4IUIA 3T03A 5KROA 3IPSA 3FUGA 5DL4A 2AWHA 2PIQA 4KZIA 2PIVA 2ABIA 2GWXA 3E94A 2V7CA 2ZK5A 4WPFA 4DMAA 2AB2A 1TFCA 2NXXA 2ZK0A 4OHAA 4XUMA 2G0GA 1XV9A 2ZFXA 4TUZA 1Z5XE 3BC5A 3OZ0A 4L96A 5AWKA 4JYGA 5DUEA 3V49A 3K23A 2PIPL 3AUNA 4JGVA 5G5WA 3X1HA 5ACCA 4K7AA 4MG9A 2HB8A 2ZNPA 2QXSA 4XT9A 5DYBA 3HZFA 1E3KA 1ZEOA 4PLEA 5E14A 3AURA 2HBHA 5EC9A 5KYJA 1UHLB 5DWLA 4QE8A 3P89A 1XDKA 2QGWA 3IPUA 5DX3A 1OVLB 1ZKYA 2XYJA 5APKA 4OZTE 4EM9A 2BAWA 1UPWA 5DWGA 4MGAB 1GWXA 4OIUA 4YPQA 3PBAA 2J14A 4DOSA 1FM6A 3FEIA 3GZ9A 1XQCA 2AX6A 3TX7B 1BSXA 1XLSE 1R1KA 1Y0SA 2H77A 2B1ZA 2W8YA 3W0AA 5EITA 1OSVA 4XTAA 4LBDA 2ZXMA 1G1UA 4UDAA 3JZCA 5DIGA 1K74A 5C4SA 4Y29A 5DIDA 4YT1A 1XLSA 3TY0A 1MV9A 4ZNTA 1DKFA 4K4JA 5G44A 1NDEA 4HLWA 5DV6A 5AVIA 5KRIA 3UU7B 4DM8A 3CS8A 3FC6A 1FM9A 4G2HA 1LBDA 3R8IA 3VRTA 4N5GA 3VT9A 4OH6A 4EMAA 5DK9A 5H1EA 4OKWA 4G2IA 2ZK4A 4J5XC 2YLPA 4O8FA 4S14A 4PVUA 2J4AA 3V4AA 5M96A 4XUHA 1GWRA 1KKQA 4ZJWA 3G0WA 1ZDUA 3OS8A 5G43A 4APUA 3B0WA 3AN3A 2NV7A 3WJ4A 4MGCA 5GIDA 1R1KD 2YJAB 2O4JA 5DTVA 4Q50A 5DUHA 3VN2A 1XV9B 3RUUA 3O1EA 4XHDA 3GWXA 3HM1A 3PCUA 3OAPA 1XP1A 5DXBA 2Q6JA 3G8IA 1K74D 5KCEA 2Q61A 4MG9B 1PDUA 3ADUA 3CLDA 3ZRAA 3OMKA 3F5CA 2AO6A 1U3QA 2QA6A 2QZOB 3B0QA 4IW8A 3LMPA 3R5MA 3A9EB 5DIEA 2ZY0A 4Q0AC 4IU7A 2P15A 1FM9D 2IOKA 3KDTA 4PWLA 3FALA 5DXKA 5B5BA 4G1YA 1XIUA 3D57A 3BQDA 4B7WA 5HJPB 4IWFA 5KYAA 4CSJA 1X7BA 2ACLA 3L0JA 1FBYA 5L7EA 2Q60A 4QE6A 1U3RA 1ZDTA 4MG7B 1XVPB 1T5ZA 2HAMA 3W5PA 4MDDA 5IAWA 3G8OA 4G1ZA 1YINA 5A86A 3VJIA 4OH5A 2AAXA 2P7GA 1RKGA 3FXVA 3WFFA 3VRVA 2P1TA 3JZBA 3Q95A 3W0YA 4PP6A 1XOWA 4G1DA 4IWCA 5L7GA 5AAVB 3WT6A 3OZJA 1QKNA 1S0ZA 4OJ4A 4LNXA 1PQ6A 1K7LA 1TXIA 2Q5SA 3K8SA 4OEDA 3WT7A 1IE8A 3D6DA 4FNEA 4DORA 5DXGA 3UUDA 2Q59A 2XHSA 2Q3YA 2Z4JA 3AZ2A 4OILA 5IXKA 4LTWA 3L03A 1T7FA 3VRWA 3R5NA 3L3XA 2HARA 2ZK1A 3KMGA 1YP0A 5EI1A 1RK3A 5KRHA 2QABA 2PIXA 2QSEA 2PKLA 2QPYA 2QW4A 2HFPA 3FURA 5FQTA 3B0RA 5DWEA 3WFGA 3OSIA 2Q70A 1R5KA 3QT0A 2GIUA 4X1GA 3R8DA 5G46A 3UUCA 4ZNSA 4DQMA 3OLFA 1A52A 4OK1A 5E1CA 4K6IA 3CWDA 5DV8A 4MG5A 2ZVTA 1XNNA 1XP9A 3HC5A 3O1DA 4NB6A 5EGVA 1EXXA 2JF9A 2YHDA 2ZK3A 4RE8A 3H0AA 4IA7A 1HJ1A 3R8AA 2ZASA 3IPQA 4CI4A 1G50A 1NQ7A 2BJ4A 3MNEA 1SJ0A 5DI7A 1NRLA 3KDUA 3M7RA 4FGYA 4RUJA 3AUQA 2VV1B 3ERTA 5HZCA 5JJMB 1YOWA 5HYRA 4J5WC 5JI0D 5DXBB 1KV6A 3B3KA 5LWPA 2ZKCA 5C4UA 3DT3A 2HASA 4RUPA 3B65A 3WGPA 2OZ7A 1ZAFA 4IV2A 5K13A 4TV1A 3A3ZX 1L2IA 2PIWA 2POGA 4XLDA 2GPVA 3VJSA 3ADWA 2OM9A 1K4WA 5L11A 5G42A 1G5YA 2Q7IA 3S9SA 5APHA 2B1VA 4FN9A 3NOAA 1U9EA 4NY9A 2AMAA 3CS4A 1NQ1A 4QJRA 1T76A 3VHWA 5EJVA 5DWIA 4MGBB 3CJWA 2AMBA 4M8EA 5GT4A 4PPPA 3UUAB 3VT3A 4RZGA 3W0HA 2ZK2A 3GYUA 3VT6A 4RMEA 1PK5A 2Q7KA 2F4BA 3H0AD 3D5FA 3LBDA 1YIMA 2E2RA 3VRUA 3OMOA 5KCTA 3ADSA 3OMQA 5DV3A 4JYIA 5DZHA 3VSOA 1ERRA 3W0IA 3VJTA 2P1UA 2GPPA 3KBAA 4DK7A 4OKTA 2Q8SA 2YATA 4OC7A 4RUOX 4JL4A 3RLLA 3ZRBA 3MNOA 3A2IA 2QH6A 1NYXA 4RMCA 4UDDA 5DRMA 2B50A 2QMVA 1P93A 1ILHA 5AZVA 4S0TA 4QL8A 4ITEA 5B41A 4JYHA 4ZO1B 1N83A 1DB1A 4JAZA 2JFAB 3UP3A 4NUFA 5E0XA 2PITA 2VV4B 1X7JA 3VT8A 3KYTA 4YNKA 2VSRA 2Q7LA 4MG8A 2PINA 3V9VA 3VT7A 4PP3A 2ZLCA 2Q6RA 1NAVA 4REEA 4OARA 2ATHA 4E2JA 2G44A 3KMRA 2FAIA 2XKWA 3P0UA 2JJ3A 5AWJA 2GPOA 2QA8A 2ZL9A 3UP0A 4OIVA 3DCTA 4IA1A 5KCUA 4G20A 2P54A 3EYBA 3CTBA 5DRJA 4ONIA 2OVHA 2IHQA 5FQPA 2AX7A 1OT7A 2BJ4B 3AX8A 3VTBA 1GWQA 2P4YA 3OOFA 5DY8A 1T74A 4TUZB 5DKSA 3W0JA 3GYTA 4J26A 3RVFA 1YMTA 1ZUCA 2ZXNA 3V3QA 1OSHA 2GP7A 4J5XA 2AA6A 3OGTA 4OFUA 5DKBA 4NQAB 1XJ7A 2ZLAA 4MGDA 3AFRA 2GPUA 2LBDA 4X1FA 1T79A 1NUOA 1SQNA 3A40X 5EHJA 2O4RA 5DUGA 4A4WA 1H9UA 1N4HA 3TKCA 1XDKB 4E4QA 4N73A 4OEAA 2QE4A 5DX3B 1SKXA 4WLBA 1NQ2A 3VT5A 1NAXA 1FCXA 4RWVA 1PCGA 5E0WA 1QKTA 3ET2A 3OSWA 1X78A 1YYEA 1YA3A 5KD9A 5DXRA 4PPSA 4E4KA 3V9YA 1XP6A 1UPVA 2P7AA 5DZIA 4BCRA 2FVJA 3R2AA 4RFWA 1XB7A 1M2ZA 4Q13A 5KR9A 3HQ5A 5G3JA 2ZK6A 3SP6A 1T7RA 2POBA 4F9MA 3CDPA 2AA5A 3L1BA 1T73A 4IQRA 3V3EA 3CDSA 5DVCA 3CS6A 5FQVA 3DY6A 1UHLA 3F7DA 3B68A 1DKFB 4OJBA 4OKXA 1L2JA 3VT4A 5DWJA 1XNXA 2PRGA 2A3IA 1OVLA 4IV4A 1I38A 3FC6B 1R6GA 3FLIA 4MGAA 4N8RA 5DU5A 1WM0X 3ADTA 1S19A 4MG6A 3VHVA 5HYKA 1FCZA 3IXPD 3CQVA 4OJ9A 4OKBA 3NSPA 2AM9A 5APJA 5I4VA 5DZ3A 1T65A 4G21A 5KRJA 4REFA 2AA2A 2QTUA 1S9PA 5DMCA 5KCDA 1RJKA 1A28A 4QK4A 5JY3A 3L0EA 5DXEA 3A78A 5DZ0A 3RY9A 3KMZA 5CJ6A 3DCUA 3AZ1A 4PLDA 4NIEA 5KRLA 3GD2A 4QM0A 2Q6SA 4RAKA 5GICA 2VSTA 5DLRA 4HEEX 4ZNUA 4WHGA 3UU7A 4R2UA 2ZMIA 2R6WA 2HWRA 1YJEA 5KRKA 3F5CB 2QGTA 2PIUA 4OLMA 3W0GA 2OAXA 4MGDB 1T7TA 3VI8A 3BEJA 4POHA 3FALB 5IZ0A 1PZLA 3PO9A 4RZFA 5KCCA 3OSAA 1T7MA 2P1VA 3L3ZA 3W5TA 2ACLB 5AAUA 3ET3A 2I4PA 3B66A 2XYWA 4J5WA 4IA3A 2PIRA 3ERDA 5C4OA 2HWQA 2OUZA 3ADVA 4ZI1A 4A2JA 1I7IA 1QKMA 3X36A 1LV2A 1QKUA 3E7CA 4KZMA 2I4ZA 3Q95B 3UVVA 3ZQTA 4DK8A 1N46A 3DR1A 4OEYA 1GS4A 2ZNOA 3B5RA 2HCDA 3OMMA 5ICKA 2QZOA 2R40A 4S15A 3KWYA 1Y0XX 2I0JA 3A9EA 4IS8A 4ITFA 4LNWA 4ZO1X 5E7VA 2Q7JA 5KRAA 3UUDB 1Y9RA 4R06A 2Q59B 2HB7A 3K6PA 3KPZA 3OLLA 2QNVA 3E00A 1I7GA 1FD0A 2OCFA 4KZJA 3X1IA 4PRGA 1Z5XU 3OOKA 5HJPA 3B0TA 3DZUA 4ZNHA 1HG4A 4MG7A 1XVPA 4YMQA 2O9IA 1XAPA 2YLOA 1U3SA 2ZNQA 3GBKA 1T63A 3N00A 4N1YA 1Q4XA 3GN8A 1S0XA 4OEZA 4WVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WJ5 A;  2YLQ A;  3FEJ A;  3GWS X;  5DXM A;  4LSJ A;  1XPC A;  3W5R A;  2YFE A;  5AAV A;  3OKH A;  2PJL A;  2Q1H A;  1XQ3 A;  1S9Q A;  4FHH A;  3ET0 A;  4XAO A;  1M13 A;  1I37 A;  1KNU A;  2H79 A;  4OGH A;  4OZT U;  5ETH A;  5AVL A;  3V9T A;  4FHI A;  3D24 A;  2QXM A;  3OS8 C;  2ZNN A;  1PQ9 A;  1R20 A;  1RDT A;  2B23 A;  2NPA A;  2ZMH A;  4OFR A;  5DVV A;  2ZMJ A;  3HLV A;  1UOM A;  3A2J A;  4IW6 A;  1ERE A;  4XI3 A;  2REW A;  3VTC A;  3AN4 A;  3OKI A;  4P6X A;  1IE9 A;  2I4J A;  2Z4B A;  3B1M A;  5KCF A;  4TV1 B;  3U9Q A;  3PLZ A;  5C4T A;  1XZX X;  1ZH7 A;  3E00 D;  3P88 A;  3W0C A;  3DZU D;  2XYX A;  5LGA A;  2NW4 A;  4ZNW A;  2AX8 A;  5FQS A;  4L98 A;  2P7Z A;  5DXQ A;  1P8D A;  4M8H A;  3MNP A;  5AZT A;  5KRM A;  3D90 A;  4ZNV A;  1EXA A;  3OS9 A;  2YLY A;  1PQC A;  5E19 A;  5E15 A;  3G9E A;  3X31 A;  1FM6 D;  2R40 D;  1SR7 A;  2EWP A;  1PRG A;  3IMY A;  3HVL A;  2GTK A;  3IXP A;  2GL8 A;  4J24 A;  3WMH A;  5DSH A;  5FQR A;  1ILG A;  5G45 A;  3RLJ A;  5SYZ A;  4RMD A;  1MZN A;  2G0H A;  2Q5P A;  3VTD A;  5JJM A;  2VV1 A;  3VSP A;  4A4V A;  3KFC A;  3UVV B;  5AK2 A;  4DM6 A;  2HC4 A;  1R20 D;  1RDT D;  3K22 A;  5F9B A;  1G2N A;  3ILZ A;  3RUT A;  1X7R A;  1NHZ A;  3B67 A;  2OVM A;  2VV3 A;  3SP9 A;  3PEQ A;  3HOD A;  1X7E A;  4IA2 A;  2HVC A;  3AZ3 A;  4PXM A;  3OLS A;  4UDB A;  4WHF A;  2J7X A;  3R29 A;  5DP0 A;  4POJ A;  4ZN9 A;  3DZY A;  2AA7 A;  1Z95 A;  2G5O A;  4MGB A;  5DYD A;  3UUA A;  3WTQ A;  4MG8 B;  2VV2 A;  4ZJR A;  5DZ1 A;  3A2H A;  1NQ0 A;  1FCY A;  5HCV A;  3WT5 A;  5KRF A;  2IOG A;  1E3G A;  2PNU A;  1M7W A;  2I0G A;  5DKG A;  2VV0 A;  2AXA A;  4UDC A;  2AYR A;  4OZR E;  4PP5 A;  3HC6 A;  2J7Y A;  1ZGY A;  3NSQ A;  5DKE A;  5DVS A;  2QA8 B;  3FS1 A;  3SZ1 A;  2QR9 A;  5KCW A;  1X76 A;  2Q5G A;  5HJS A;  5GIE A;  3VHU A;  2PIO A;  1RKH A;  2R6Y A;  4S0S A;  4ZN7 A;  3P8X A;  4CI5 A;  5AYG A;  2JFA A;  3ZR7 A;  1YOK A;  5DMF A;  2VV4 A;  1YUC A;  2Q1V A;  5DXP A;  4OZR U;  3VJH A;  3WWR A;  3PRG A;  3IA6 A;  5KRC A;  2ZXZ A;  3HO0 A;  2V0V A;  4IVY A;  3TKM A;  2YJD A;  3DZY D;  4IVW A;  4P6W A;  2ZBS A;  3H52 A;  1YY4 A;  4RZE A;  3W5Q A;  3L0L A;  2AX9 A;  4R6S A;  4WQP A;  3ET1 A;  3ADX A;  4ZOM A;  5L7H A;  4PF3 A;  1VJB A;  2NXX E;  2FSZ A;  1MVC A;  3OMP A;  4IUI A;  3T03 A;  5KRO A;  3IPS A;  3FUG A;  5DL4 A;  2AWH A;  2PIQ A;  4KZI A;  2PIV A;  2ABI A;  2GWX A;  3E94 A;  2V7C A;  2ZK5 A;  4WPF A;  4DMA A;  2AB2 A;  1TFC A;  2NXX A;  2ZK0 A;  4OHA A;  4XUM A;  2G0G A;  1XV9 A;  2ZFX A;  4TUZ A;  1Z5X E;  3BC5 A;  3OZ0 A;  4L96 A;  5AWK A;  4JYG A;  5DUE A;  3V49 A;  3K23 A;  2PIP L;  3AUN A;  4JGV A;  5G5W A;  3X1H A;  5ACC A;  4K7A A;  4MG9 A;  2HB8 A;  2ZNP A;  2QXS A;  4XT9 A;  5DYB A;  3HZF A;  1E3K A;  1ZEO A;  4PLE A;  5E14 A;  3AUR A;  2HBH A;  5EC9 A;  5KYJ A;  1UHL B;  5DWL A;  4QE8 A;  3P89 A;  1XDK A;  2QGW A;  3IPU A;  5DX3 A;  1OVL B;  1ZKY A;  2XYJ A;  5APK A;  4OZT E;  4EM9 A;  2BAW A;  1UPW A;  5DWG A;  4MGA B;  1GWX A;  4OIU A;  4YPQ A;  3PBA A;  2J14 A;  4DOS A;  1FM6 A;  3FEI A;  3GZ9 A;  1XQC A;  2AX6 A;  3TX7 B;  1BSX A;  1XLS E;  1R1K A;  1Y0S A;  2H77 A;  2B1Z A;  2W8Y A;  3W0A A;  5EIT A;  1OSV A;  4XTA A;  4LBD A;  2ZXM A;  1G1U A;  4UDA A;  3JZC A;  5DIG A;  1K74 A;  5C4S A;  4Y29 A;  5DID A;  4YT1 A;  1XLS A;  3TY0 A;  1MV9 A;  4ZNT A;  1DKF A;  4K4J A;  5G44 A;  1NDE A;  4HLW A;  5DV6 A;  5AVI A;  5KRI A;  3UU7 B;  4DM8 A;  3CS8 A;  3FC6 A;  1FM9 A;  4G2H A;  1LBD A;  3R8I A;  3VRT A;  4N5G A;  3VT9 A;  4OH6 A;  4EMA A;  5DK9 A;  5H1E A;  4OKW A;  4G2I A;  2ZK4 A;  4J5X C;  2YLP A;  4O8F A;  4S14 A;  4PVU A;  2J4A A;  3V4A A;  5M96 A;  4XUH A;  1GWR A;  1KKQ A;  4ZJW A;  3G0W A;  1ZDU A;  3OS8 A;  5G43 A;  4APU A;  3B0W A;  3AN3 A;  2NV7 A;  3WJ4 A;  4MGC A;  5GID A;  1R1K D;  2YJA B;  2O4J A;  5DTV A;  4Q50 A;  5DUH A;  3VN2 A;  1XV9 B;  3RUU A;  3O1E A;  4XHD A;  3GWX A;  3HM1 A;  3PCU A;  3OAP A;  1XP1 A;  5DXB A;  2Q6J A;  3G8I A;  1K74 D;  5KCE A;  2Q61 A;  4MG9 B;  1PDU A;  3ADU A;  3CLD A;  3ZRA A;  3OMK A;  3F5C A;  2AO6 A;  1U3Q A;  2QA6 A;  2QZO B;  3B0Q A;  4IW8 A;  3LMP A;  3R5M A;  3A9E B;  5DIE A;  2ZY0 A;  4Q0A C;  4IU7 A;  2P15 A;  1FM9 D;  2IOK A;  3KDT A;  4PWL A;  3FAL A;  5DXK A;  5B5B A;  4G1Y A;  1XIU A;  3D57 A;  3BQD A;  4B7W A;  5HJP B;  4IWF A;  5KYA A;  4CSJ A;  1X7B A;  2ACL A;  3L0J A;  1FBY A;  5L7E A;  2Q60 A;  4QE6 A;  1U3R A;  1ZDT A;  4MG7 B;  1XVP B;  1T5Z A;  2HAM A;  3W5P A;  4MDD A;  5IAW A;  3G8O A;  4G1Z A;  1YIN A;  5A86 A;  3VJI A;  4OH5 A;  2AAX A;  2P7G A;  1RKG A;  3FXV A;  3WFF A;  3VRV A;  2P1T A;  3JZB A;  3Q95 A;  3W0Y A;  4PP6 A;  1XOW A;  4G1D A;  4IWC A;  5L7G A;  5AAV B;  3WT6 A;  3OZJ A;  1QKN A;  1S0Z A;  4OJ4 A;  4LNX A;  1PQ6 A;  1K7L A;  1TXI A;  2Q5S A;  3K8S A;  4OED A;  3WT7 A;  1IE8 A;  3D6D A;  4FNE A;  4DOR A;  5DXG A;  3UUD A;  2Q59 A;  2XHS A;  2Q3Y A;  2Z4J A;  3AZ2 A;  4OIL A;  5IXK A;  4LTW A;  3L03 A;  1T7F A;  3VRW A;  3R5N A;  3L3X A;  2HAR A;  2ZK1 A;  3KMG A;  1YP0 A;  5EI1 A;  1RK3 A;  5KRH A;  2QAB A;  2PIX A;  2QSE A;  2PKL A;  2QPY A;  2QW4 A;  2HFP A;  3FUR A;  5FQT A;  3B0R A;  5DWE A;  3WFG A;  3OSI A;  2Q70 A;  1R5K A;  3QT0 A;  2GIU A;  4X1G A;  3R8D A;  5G46 A;  3UUC A;  4ZNS A;  4DQM A;  3OLF A;  1A52 A;  4OK1 A;  5E1C A;  4K6I A;  3CWD A;  5DV8 A;  4MG5 A;  2ZVT A;  1XNN A;  1XP9 A;  3HC5 A;  3O1D A;  4NB6 A;  5EGV A;  1EXX A;  2JF9 A;  2YHD A;  2ZK3 A;  4RE8 A;  3H0A A;  4IA7 A;  1HJ1 A;  3R8A A;  2ZAS A;  3IPQ A;  4CI4 A;  1G50 A;  1NQ7 A;  2BJ4 A;  3MNE A;  1SJ0 A;  5DI7 A;  1NRL A;  3KDU A;  3M7R A;  4FGY A;  4RUJ A;  3AUQ A;  2VV1 B;  3ERT A;  5HZC A;  5JJM B;  1YOW A;  5HYR A;  4J5W C;  5JI0 D;  5DXB B;  1KV6 A;  3B3K A;  5LWP A;  2ZKC A;  5C4U A;  3DT3 A;  2HAS A;  4RUP A;  3B65 A;  3WGP A;  2OZ7 A;  1ZAF A;  4IV2 A;  5K13 A;  4TV1 A;  3A3Z X;  1L2I A;  2PIW A;  2POG A;  4XLD A;  2GPV A;  3VJS A;  3ADW A;  2OM9 A;  1K4W A;  5L11 A;  5G42 A;  1G5Y A;  2Q7I A;  3S9S A;  5APH A;  2B1V A;  4FN9 A;  3NOA A;  1U9E A;  4NY9 A;  2AMA A;  3CS4 A;  1NQ1 A;  4QJR A;  1T76 A;  3VHW A;  5EJV A;  5DWI A;  4MGB B;  3CJW A;  2AMB A;  4M8E A;  5GT4 A;  4PPP A;  3UUA B;  3VT3 A;  4RZG A;  3W0H A;  2ZK2 A;  3GYU A;  3VT6 A;  4RME A;  1PK5 A;  2Q7K A;  2F4B A;  3H0A D;  3D5F A;  3LBD A;  1YIM A;  2E2R A;  3VRU A;  3OMO A;  5KCT A;  3ADS A;  3OMQ A;  5DV3 A;  4JYI A;  5DZH A;  3VSO A;  1ERR A;  3W0I A;  3VJT A;  2P1U A;  2GPP A;  3KBA A;  4DK7 A;  4OKT A;  2Q8S A;  2YAT A;  4OC7 A;  4RUO X;  4JL4 A;  3RLL A;  3ZRB A;  3MNO A;  3A2I A;  2QH6 A;  1NYX A;  4RMC A;  4UDD A;  5DRM A;  2B50 A;  2QMV A;  1P93 A;  1ILH A;  5AZV A;  4S0T A;  4QL8 A;  4ITE A;  5B41 A;  4JYH A;  4ZO1 B;  1N83 A;  1DB1 A;  4JAZ A;  2JFA B;  3UP3 A;  4NUF A;  5E0X A;  2PIT A;  2VV4 B;  1X7J A;  3VT8 A;  3KYT A;  4YNK A;  2VSR A;  2Q7L A;  4MG8 A;  2PIN A;  3V9V A;  3VT7 A;  4PP3 A;  2ZLC A;  2Q6R A;  1NAV A;  4REE A;  4OAR A;  2ATH A;  4E2J A;  2G44 A;  3KMR A;  2FAI A;  2XKW A;  3P0U A;  2JJ3 A;  5AWJ A;  2GPO A;  2QA8 A;  2ZL9 A;  3UP0 A;  4OIV A;  3DCT A;  4IA1 A;  5KCU A;  4G20 A;  2P54 A;  3EYB A;  3CTB A;  5DRJ A;  4ONI A;  2OVH A;  2IHQ A;  5FQP A;  2AX7 A;  1OT7 A;  2BJ4 B;  3AX8 A;  3VTB A;  1GWQ A;  2P4Y A;  3OOF A;  5DY8 A;  1T74 A;  4TUZ B;  5DKS A;  3W0J A;  3GYT A;  4J26 A;  3RVF A;  1YMT A;  1ZUC A;  2ZXN A;  3V3Q A;  1OSH A;  2GP7 A;  4J5X A;  2AA6 A;  3OGT A;  4OFU A;  5DKB A;  4NQA B;  1XJ7 A;  2ZLA A;  4MGD A;  3AFR A;  2GPU A;  2LBD A;  4X1F A;  1T79 A;  1NUO A;  1SQN A;  3A40 X;  5EHJ A;  2O4R A;  5DUG A;  4A4W A;  1H9U A;  1N4H A;  3TKC A;  1XDK B;  4E4Q A;  4N73 A;  4OEA A;  2QE4 A;  5DX3 B;  1SKX A;  4WLB A;  1NQ2 A;  3VT5 A;  1NAX A;  1FCX A;  4RWV A;  1PCG A;  5E0W A;  1QKT A;  3ET2 A;  3OSW A;  1X78 A;  1YYE A;  1YA3 A;  5KD9 A;  5DXR A;  4PPS A;  4E4K A;  3V9Y A;  1XP6 A;  1UPV A;  2P7A A;  5DZI A;  4BCR A;  2FVJ A;  3R2A A;  4RFW A;  1XB7 A;  1M2Z A;  4Q13 A;  5KR9 A;  3HQ5 A;  5G3J A;  2ZK6 A;  3SP6 A;  1T7R A;  2POB A;  4F9M A;  3CDP A;  2AA5 A;  3L1B A;  1T73 A;  4IQR A;  3V3E A;  3CDS A;  5DVC A;  3CS6 A;  5FQV A;  3DY6 A;  1UHL A;  3F7D A;  3B68 A;  1DKF B;  4OJB A;  4OKX A;  1L2J A;  3VT4 A;  5DWJ A;  1XNX A;  2PRG A;  2A3I A;  1OVL A;  4IV4 A;  1I38 A;  3FC6 B;  1R6G A;  3FLI A;  4MGA A;  4N8R A;  5DU5 A;  1WM0 X;  3ADT A;  1S19 A;  4MG6 A;  3VHV A;  5HYK A;  1FCZ A;  3IXP D;  3CQV A;  4OJ9 A;  4OKB A;  3NSP A;  2AM9 A;  5APJ A;  5I4V A;  5DZ3 A;  1T65 A;  4G21 A;  5KRJ A;  4REF A;  2AA2 A;  2QTU A;  1S9P A;  5DMC A;  5KCD A;  1RJK A;  1A28 A;  4QK4 A;  5JY3 A;  3L0E A;  5DXE A;  3A78 A;  5DZ0 A;  3RY9 A;  3KMZ A;  5CJ6 A;  3DCU A;  3AZ1 A;  4PLD A;  4NIE A;  5KRL A;  3GD2 A;  4QM0 A;  2Q6S A;  4RAK A;  5GIC A;  2VST A;  5DLR A;  4HEE X;  4ZNU A;  4WHG A;  3UU7 A;  4R2U A;  2ZMI A;  2R6W A;  2HWR A;  1YJE A;  5KRK A;  3F5C B;  2QGT A;  2PIU A;  4OLM A;  3W0G A;  2OAX A;  4MGD B;  1T7T A;  3VI8 A;  3BEJ A;  4POH A;  3FAL B;  5IZ0 A;  1PZL A;  3PO9 A;  4RZF A;  5KCC A;  3OSA A;  1T7M A;  2P1V A;  3L3Z A;  3W5T A;  2ACL B;  5AAU A;  3ET3 A;  2I4P A;  3B66 A;  2XYW A;  4J5W A;  4IA3 A;  2PIR A;  3ERD A;  5C4O A;  2HWQ A;  2OUZ A;  3ADV A;  4ZI1 A;  4A2J A;  1I7I A;  1QKM A;  3X36 A;  1LV2 A;  1QKU A;  3E7C A;  4KZM A;  2I4Z A;  3Q95 B;  3UVV A;  3ZQT A;  4DK8 A;  1N46 A;  3DR1 A;  4OEY A;  1GS4 A;  2ZNO A;  3B5R A;  2HCD A;  3OMM A;  5ICK A;  2QZO A;  2R40 A;  4S15 A;  3KWY A;  1Y0X X;  2I0J A;  3A9E A;  4IS8 A;  4ITF A;  4LNW A;  4ZO1 X;  5E7V A;  2Q7J A;  5KRA A;  3UUD B;  1Y9R A;  4R06 A;  2Q59 B;  2HB7 A;  3K6P A;  3KPZ A;  3OLL A;  2QNV A;  3E00 A;  1I7G A;  1FD0 A;  2OCF A;  4KZJ A;  3X1I A;  4PRG A;  1Z5X U;  3OOK A;  5HJP A;  3B0T A;  3DZU A;  4ZNH A;  1HG4 A;  4MG7 A;  1XVP A;  4YMQ A;  2O9I A;  1XAP A;  2YLO A;  1U3S A;  2ZNQ A;  3GBK A;  1T63 A;  3N00 A;  4N1Y A;  1Q4X A;  3GN8 A;  1S0X A;  4OEZ A;  4WVD A; 
#chains in the Genus database with same CATH topology
 3WJ5 A;  2YLQ A;  3FEJ A;  3GWS X;  5DXM A;  4LSJ A;  1XPC A;  3W5R A;  2YFE A;  5AAV A;  3OKH A;  2PJL A;  2Q1H A;  1XQ3 A;  1S9Q A;  4FHH A;  3ET0 A;  4XAO A;  1M13 A;  1I37 A;  1KNU A;  2H79 A;  4OGH A;  4OZT U;  5ETH A;  5AVL A;  3V9T A;  4FHI A;  3D24 A;  2QXM A;  3OS8 C;  2ZNN A;  1PQ9 A;  1R20 A;  1RDT A;  2B23 A;  2NPA A;  2ZMH A;  4OFR A;  5DVV A;  2ZMJ A;  3HLV A;  1UOM A;  3A2J A;  4IW6 A;  1ERE A;  4XI3 A;  2REW A;  3VTC A;  3AN4 A;  3OKI A;  4P6X A;  1IE9 A;  2I4J A;  2Z4B A;  3B1M A;  5KCF A;  4TV1 B;  3U9Q A;  3PLZ A;  5C4T A;  1XZX X;  1ZH7 A;  3E00 D;  3P88 A;  3W0C A;  3DZU D;  2XYX A;  5LGA A;  2NW4 A;  4ZNW A;  2AX8 A;  5FQS A;  4L98 A;  2P7Z A;  5DXQ A;  1P8D A;  4M8H A;  3MNP A;  5AZT A;  5KRM A;  3D90 A;  4ZNV A;  1EXA A;  3OS9 A;  2YLY A;  1PQC A;  5E19 A;  5E15 A;  3G9E A;  3X31 A;  1FM6 D;  2R40 D;  1SR7 A;  2EWP A;  1PRG A;  3IMY A;  3HVL A;  2GTK A;  3IXP A;  2GL8 A;  4J24 A;  3WMH A;  5DSH A;  5FQR A;  1ILG A;  5G45 A;  3RLJ A;  5SYZ A;  4RMD A;  1MZN A;  2G0H A;  2Q5P A;  3VTD A;  5JJM A;  2VV1 A;  3VSP A;  4A4V A;  3KFC A;  3UVV B;  5AK2 A;  4DM6 A;  2HC4 A;  1R20 D;  1RDT D;  3K22 A;  5F9B A;  1G2N A;  3ILZ A;  3RUT A;  1X7R A;  1NHZ A;  3B67 A;  2OVM A;  2VV3 A;  3SP9 A;  3PEQ A;  3HOD A;  1X7E A;  4IA2 A;  2HVC A;  3AZ3 A;  4PXM A;  3OLS A;  4UDB A;  4WHF A;  2J7X A;  3R29 A;  5DP0 A;  4POJ A;  4ZN9 A;  3DZY A;  2AA7 A;  1Z95 A;  2G5O A;  4MGB A;  5DYD A;  3UUA A;  3WTQ A;  4MG8 B;  2VV2 A;  4ZJR A;  5DZ1 A;  3A2H A;  1NQ0 A;  1FCY A;  5HCV A;  3WT5 A;  5KRF A;  2IOG A;  1E3G A;  2PNU A;  1M7W A;  2I0G A;  5DKG A;  2VV0 A;  2AXA A;  4UDC A;  2AYR A;  4OZR E;  4PP5 A;  3HC6 A;  2J7Y A;  1ZGY A;  3NSQ A;  5DKE A;  5DVS A;  2QA8 B;  3FS1 A;  3SZ1 A;  2QR9 A;  5KCW A;  1X76 A;  2Q5G A;  5HJS A;  5GIE A;  3VHU A;  2PIO A;  1RKH A;  2R6Y A;  4S0S A;  4ZN7 A;  3P8X A;  4CI5 A;  5AYG A;  2JFA A;  3ZR7 A;  1YOK A;  5DMF A;  2VV4 A;  1YUC A;  2Q1V A;  5DXP A;  4OZR U;  3VJH A;  3WWR A;  3PRG A;  3IA6 A;  5KRC A;  2ZXZ A;  3HO0 A;  2V0V A;  4IVY A;  3TKM A;  2YJD A;  3DZY D;  4IVW A;  4P6W A;  2ZBS A;  3H52 A;  1YY4 A;  4RZE A;  3W5Q A;  3L0L A;  2AX9 A;  4R6S A;  4WQP A;  3ET1 A;  3ADX A;  4ZOM A;  5L7H A;  4PF3 A;  1VJB A;  2NXX E;  2FSZ A;  1MVC A;  3OMP A;  4IUI A;  3T03 A;  5KRO A;  3IPS A;  3FUG A;  5DL4 A;  2AWH A;  2PIQ A;  4KZI A;  2PIV A;  2ABI A;  2GWX A;  3E94 A;  2V7C A;  2ZK5 A;  4WPF A;  4DMA A;  2AB2 A;  1TFC A;  2NXX A;  2ZK0 A;  4OHA A;  4XUM A;  2G0G A;  1XV9 A;  2ZFX A;  4TUZ A;  1Z5X E;  3BC5 A;  3OZ0 A;  4L96 A;  5AWK A;  4JYG A;  5DUE A;  3V49 A;  3K23 A;  2PIP L;  3AUN A;  4JGV A;  5G5W A;  3X1H A;  5ACC A;  4K7A A;  4MG9 A;  2HB8 A;  2ZNP A;  2QXS A;  4XT9 A;  5DYB A;  3HZF A;  1E3K A;  1ZEO A;  4PLE A;  5E14 A;  3AUR A;  2HBH A;  5EC9 A;  5KYJ A;  1UHL B;  5DWL A;  4QE8 A;  3P89 A;  1XDK A;  2QGW A;  3IPU A;  5DX3 A;  1OVL B;  1ZKY A;  2XYJ A;  5APK A;  4OZT E;  4EM9 A;  2BAW A;  1UPW A;  5DWG A;  4MGA B;  1GWX A;  4OIU A;  4YPQ A;  3PBA A;  2J14 A;  4DOS A;  1FM6 A;  3FEI A;  3GZ9 A;  1XQC A;  2AX6 A;  3TX7 B;  1BSX A;  1XLS E;  1R1K A;  1Y0S A;  2H77 A;  2B1Z A;  2W8Y A;  3W0A A;  5EIT A;  1OSV A;  4XTA A;  4LBD A;  2ZXM A;  1G1U A;  4UDA A;  3JZC A;  5DIG A;  1K74 A;  5C4S A;  4Y29 A;  5DID A;  4YT1 A;  1XLS A;  3TY0 A;  1MV9 A;  4ZNT A;  1DKF A;  4K4J A;  5G44 A;  1NDE A;  4HLW A;  5DV6 A;  5AVI A;  5KRI A;  3UU7 B;  4DM8 A;  3CS8 A;  3FC6 A;  1FM9 A;  4G2H A;  1LBD A;  3R8I A;  3VRT A;  4N5G A;  3VT9 A;  4OH6 A;  4EMA A;  5DK9 A;  5H1E A;  4OKW A;  4G2I A;  2ZK4 A;  4J5X C;  2YLP A;  4O8F A;  4S14 A;  4PVU A;  2J4A A;  3V4A A;  5M96 A;  4XUH A;  1GWR A;  1KKQ A;  4ZJW A;  3G0W A;  1ZDU A;  3OS8 A;  5G43 A;  4APU A;  3B0W A;  3AN3 A;  2NV7 A;  3WJ4 A;  4MGC A;  5GID A;  1R1K D;  2YJA B;  2O4J A;  5DTV A;  4Q50 A;  5DUH A;  3VN2 A;  1XV9 B;  3RUU A;  3O1E A;  4XHD A;  3GWX A;  3HM1 A;  3PCU A;  3OAP A;  1XP1 A;  5DXB A;  2Q6J A;  3G8I A;  1K74 D;  5KCE A;  2Q61 A;  4MG9 B;  1PDU A;  3ADU A;  3CLD A;  3ZRA A;  3OMK A;  3F5C A;  2AO6 A;  1U3Q A;  2QA6 A;  2QZO B;  3B0Q A;  4IW8 A;  3LMP A;  3R5M A;  3A9E B;  5DIE A;  2ZY0 A;  4Q0A C;  4IU7 A;  2P15 A;  1FM9 D;  2IOK A;  3KDT A;  4PWL A;  3FAL A;  5DXK A;  5B5B A;  4G1Y A;  1XIU A;  3D57 A;  3BQD A;  4B7W A;  5HJP B;  4IWF A;  5KYA A;  4CSJ A;  1X7B A;  2ACL A;  3L0J A;  1FBY A;  5L7E A;  2Q60 A;  4QE6 A;  1U3R A;  1ZDT A;  4MG7 B;  1XVP B;  1T5Z A;  2HAM A;  3W5P A;  4MDD A;  5IAW A;  3G8O A;  4G1Z A;  1YIN A;  5A86 A;  3VJI A;  4OH5 A;  2AAX A;  2P7G A;  1RKG A;  3FXV A;  3WFF A;  3VRV A;  2P1T A;  3JZB A;  3Q95 A;  3W0Y A;  4PP6 A;  1XOW A;  4G1D A;  4IWC A;  5L7G A;  5AAV B;  3WT6 A;  3OZJ A;  1QKN A;  1S0Z A;  4OJ4 A;  4LNX A;  1PQ6 A;  1K7L A;  1TXI A;  2Q5S A;  3K8S A;  4OED A;  3WT7 A;  1IE8 A;  3D6D A;  4FNE A;  4DOR A;  5DXG A;  3UUD A;  2Q59 A;  2XHS A;  2Q3Y A;  2Z4J A;  3AZ2 A;  4OIL A;  5IXK A;  4LTW A;  3L03 A;  1T7F A;  3VRW A;  3R5N A;  3L3X A;  2HAR A;  2ZK1 A;  3KMG A;  1YP0 A;  5EI1 A;  1RK3 A;  5KRH A;  2QAB A;  2PIX A;  2QSE A;  2PKL A;  2QPY A;  2QW4 A;  2HFP A;  3FUR A;  5FQT A;  3B0R A;  5DWE A;  3WFG A;  3OSI A;  2Q70 A;  1R5K A;  3QT0 A;  2GIU A;  4X1G A;  3R8D A;  5G46 A;  3UUC A;  4ZNS A;  4DQM A;  3OLF A;  1A52 A;  4OK1 A;  5E1C A;  4K6I A;  3CWD A;  5DV8 A;  4MG5 A;  2ZVT A;  1XNN A;  1XP9 A;  3HC5 A;  3O1D A;  4NB6 A;  5EGV A;  1EXX A;  2JF9 A;  2YHD A;  2ZK3 A;  4RE8 A;  3H0A A;  4IA7 A;  1HJ1 A;  3R8A A;  2ZAS A;  3IPQ A;  4CI4 A;  1G50 A;  1NQ7 A;  2BJ4 A;  3MNE A;  1SJ0 A;  5DI7 A;  1NRL A;  3KDU A;  3M7R A;  4FGY A;  4RUJ A;  3AUQ A;  2VV1 B;  3ERT A;  5HZC A;  5JJM B;  1YOW A;  5HYR A;  4J5W C;  5JI0 D;  5DXB B;  1KV6 A;  3B3K A;  5LWP A;  2ZKC A;  5C4U A;  3DT3 A;  2HAS A;  4RUP A;  3B65 A;  3WGP A;  2OZ7 A;  1ZAF A;  4IV2 A;  5K13 A;  4TV1 A;  3A3Z X;  1L2I A;  2PIW A;  2POG A;  4XLD A;  2GPV A;  3VJS A;  3ADW A;  2OM9 A;  1K4W A;  5L11 A;  5G42 A;  1G5Y A;  2Q7I A;  3S9S A;  5APH A;  2B1V A;  4FN9 A;  3NOA A;  1U9E A;  4NY9 A;  2AMA A;  3CS4 A;  1NQ1 A;  4QJR A;  1T76 A;  3VHW A;  5EJV A;  5DWI A;  4MGB B;  3CJW A;  2AMB A;  4M8E A;  5GT4 A;  4PPP A;  3UUA B;  3VT3 A;  4RZG A;  3W0H A;  2ZK2 A;  3GYU A;  3VT6 A;  4RME A;  1PK5 A;  2Q7K A;  2F4B A;  3H0A D;  3D5F A;  3LBD A;  1YIM A;  2E2R A;  3VRU A;  3OMO A;  5KCT A;  3ADS A;  3OMQ A;  5DV3 A;  4JYI A;  5DZH A;  3VSO A;  1ERR A;  3W0I A;  3VJT A;  2P1U A;  2GPP A;  3KBA A;  4DK7 A;  4OKT A;  2Q8S A;  2YAT A;  4OC7 A;  4RUO X;  4JL4 A;  3RLL A;  3ZRB A;  3MNO A;  3A2I A;  2QH6 A;  1NYX A;  4RMC A;  4UDD A;  5DRM A;  2B50 A;  2QMV A;  1P93 A;  1ILH A;  5AZV A;  4S0T A;  4QL8 A;  4ITE A;  5B41 A;  4JYH A;  4ZO1 B;  1N83 A;  1DB1 A;  4JAZ A;  2JFA B;  3UP3 A;  4NUF A;  5E0X A;  2PIT A;  2VV4 B;  1X7J A;  3VT8 A;  3KYT A;  4YNK A;  2VSR A;  2Q7L A;  4MG8 A;  2PIN A;  3V9V A;  3VT7 A;  4PP3 A;  2ZLC A;  2Q6R A;  1NAV A;  4REE A;  4OAR A;  2ATH A;  4E2J A;  2G44 A;  3KMR A;  2FAI A;  2XKW A;  3P0U A;  2JJ3 A;  5AWJ A;  2GPO A;  2QA8 A;  2ZL9 A;  3UP0 A;  4OIV A;  3DCT A;  4IA1 A;  5KCU A;  4G20 A;  2P54 A;  3EYB A;  3CTB A;  5DRJ A;  4ONI A;  2OVH A;  2IHQ A;  5FQP A;  2AX7 A;  1OT7 A;  2BJ4 B;  3AX8 A;  3VTB A;  1GWQ A;  2P4Y A;  3OOF A;  5DY8 A;  1T74 A;  4TUZ B;  5DKS A;  3W0J A;  3GYT A;  4J26 A;  3RVF A;  1YMT A;  1ZUC A;  2ZXN A;  3V3Q A;  1OSH A;  2GP7 A;  4J5X A;  2AA6 A;  3OGT A;  4OFU A;  5DKB A;  4NQA B;  1XJ7 A;  2ZLA A;  4MGD A;  3AFR A;  2GPU A;  2LBD A;  4X1F A;  1T79 A;  1NUO A;  1SQN A;  3A40 X;  5EHJ A;  2O4R A;  5DUG A;  4A4W A;  1H9U A;  1N4H A;  3TKC A;  1XDK B;  4E4Q A;  4N73 A;  4OEA A;  2QE4 A;  5DX3 B;  1SKX A;  4WLB A;  1NQ2 A;  3VT5 A;  1NAX A;  1FCX A;  4RWV A;  1PCG A;  5E0W A;  1QKT A;  3ET2 A;  3OSW A;  1X78 A;  1YYE A;  1YA3 A;  5KD9 A;  5DXR A;  4PPS A;  4E4K A;  3V9Y A;  1XP6 A;  1UPV A;  2P7A A;  5DZI A;  4BCR A;  2FVJ A;  3R2A A;  4RFW A;  1XB7 A;  1M2Z A;  4Q13 A;  5KR9 A;  3HQ5 A;  5G3J A;  2ZK6 A;  3SP6 A;  1T7R A;  2POB A;  4F9M A;  3CDP A;  2AA5 A;  3L1B A;  1T73 A;  4IQR A;  3V3E A;  3CDS A;  5DVC A;  3CS6 A;  5FQV A;  3DY6 A;  1UHL A;  3F7D A;  3B68 A;  1DKF B;  4OJB A;  4OKX A;  1L2J A;  3VT4 A;  5DWJ A;  1XNX A;  2PRG A;  2A3I A;  1OVL A;  4IV4 A;  1I38 A;  3FC6 B;  1R6G A;  3FLI A;  4MGA A;  4N8R A;  5DU5 A;  1WM0 X;  3ADT A;  1S19 A;  4MG6 A;  3VHV A;  5HYK A;  1FCZ A;  3IXP D;  3CQV A;  4OJ9 A;  4OKB A;  3NSP A;  2AM9 A;  5APJ A;  5I4V A;  5DZ3 A;  1T65 A;  4G21 A;  5KRJ A;  4REF A;  2AA2 A;  2QTU A;  1S9P A;  5DMC A;  5KCD A;  1RJK A;  1A28 A;  4QK4 A;  5JY3 A;  3L0E A;  5DXE A;  3A78 A;  5DZ0 A;  3RY9 A;  3KMZ A;  5CJ6 A;  3DCU A;  3AZ1 A;  4PLD A;  4NIE A;  5KRL A;  3GD2 A;  4QM0 A;  2Q6S A;  4RAK A;  5GIC A;  2VST A;  5DLR A;  4HEE X;  4ZNU A;  4WHG A;  3UU7 A;  4R2U A;  2ZMI A;  2R6W A;  2HWR A;  1YJE A;  5KRK A;  3F5C B;  2QGT A;  2PIU A;  4OLM A;  3W0G A;  2OAX A;  4MGD B;  1T7T A;  3VI8 A;  3BEJ A;  4POH A;  3FAL B;  5IZ0 A;  1PZL A;  3PO9 A;  4RZF A;  5KCC A;  3OSA A;  1T7M A;  2P1V A;  3L3Z A;  3W5T A;  2ACL B;  5AAU A;  3ET3 A;  2I4P A;  3B66 A;  2XYW A;  4J5W A;  4IA3 A;  2PIR A;  3ERD A;  5C4O A;  2HWQ A;  2OUZ A;  3ADV A;  4ZI1 A;  4A2J A;  1I7I A;  1QKM A;  3X36 A;  1LV2 A;  1QKU A;  3E7C A;  4KZM A;  2I4Z A;  3Q95 B;  3UVV A;  3ZQT A;  4DK8 A;  1N46 A;  3DR1 A;  4OEY A;  1GS4 A;  2ZNO A;  3B5R A;  2HCD A;  3OMM A;  5ICK A;  2QZO A;  2R40 A;  4S15 A;  3KWY A;  1Y0X X;  2I0J A;  3A9E A;  4IS8 A;  4ITF A;  4LNW A;  4ZO1 X;  5E7V A;  2Q7J A;  5KRA A;  3UUD B;  1Y9R A;  4R06 A;  2Q59 B;  2HB7 A;  3K6P A;  3KPZ A;  3OLL A;  2QNV A;  3E00 A;  1I7G A;  1FD0 A;  2OCF A;  4KZJ A;  3X1I A;  4PRG A;  1Z5X U;  3OOK A;  5HJP A;  3B0T A;  3DZU A;  4ZNH A;  1HG4 A;  4MG7 A;  1XVP A;  4YMQ A;  2O9I A;  1XAP A;  2YLO A;  1U3S A;  2ZNQ A;  3GBK A;  1T63 A;  3N00 A;  4N1Y A;  1Q4X A;  3GN8 A;  1S0X A;  4OEZ A;  4WVD A; 
#chains in the Genus database with same CATH homology
 3WJ5 A;  2YLQ A;  3FEJ A;  3GWS X;  5DXM A;  4LSJ A;  1XPC A;  3W5R A;  2YFE A;  5AAV A;  3OKH A;  2PJL A;  2Q1H A;  1XQ3 A;  1S9Q A;  4FHH A;  3ET0 A;  4XAO A;  1M13 A;  1I37 A;  1KNU A;  2H79 A;  4OGH A;  4OZT U;  5ETH A;  5AVL A;  3V9T A;  4FHI A;  3D24 A;  2QXM A;  3OS8 C;  2ZNN A;  1PQ9 A;  1R20 A;  1RDT A;  2B23 A;  2NPA A;  2ZMH A;  4OFR A;  5DVV A;  2ZMJ A;  3HLV A;  1UOM A;  3A2J A;  4IW6 A;  1ERE A;  4XI3 A;  2REW A;  3VTC A;  3AN4 A;  3OKI A;  4P6X A;  1IE9 A;  2I4J A;  2Z4B A;  3B1M A;  5KCF A;  4TV1 B;  3U9Q A;  3PLZ A;  5C4T A;  1XZX X;  1ZH7 A;  3E00 D;  3P88 A;  3W0C A;  3DZU D;  2XYX A;  5LGA A;  2NW4 A;  4ZNW A;  2AX8 A;  5FQS A;  4L98 A;  2P7Z A;  5DXQ A;  1P8D A;  4M8H A;  3MNP A;  5AZT A;  5KRM A;  3D90 A;  4ZNV A;  1EXA A;  3OS9 A;  2YLY A;  1PQC A;  5E19 A;  5E15 A;  3G9E A;  3X31 A;  1FM6 D;  2R40 D;  1SR7 A;  2EWP A;  1PRG A;  3IMY A;  3HVL A;  2GTK A;  3IXP A;  2GL8 A;  4J24 A;  3WMH A;  5DSH A;  5FQR A;  1ILG A;  5G45 A;  3RLJ A;  5SYZ A;  4RMD A;  1MZN A;  2G0H A;  2Q5P A;  3VTD A;  5JJM A;  2VV1 A;  3VSP A;  4A4V A;  3KFC A;  3UVV B;  5AK2 A;  4DM6 A;  2HC4 A;  1R20 D;  1RDT D;  3K22 A;  5F9B A;  1G2N A;  3ILZ A;  3RUT A;  1X7R A;  1NHZ A;  3B67 A;  2OVM A;  2VV3 A;  3SP9 A;  3PEQ A;  3HOD A;  1X7E A;  4IA2 A;  2HVC A;  3AZ3 A;  4PXM A;  3OLS A;  4UDB A;  4WHF A;  2J7X A;  3R29 A;  5DP0 A;  4POJ A;  4ZN9 A;  3DZY A;  2AA7 A;  1Z95 A;  2G5O A;  4MGB A;  5DYD A;  3UUA A;  3WTQ A;  4MG8 B;  2VV2 A;  4ZJR A;  5DZ1 A;  3A2H A;  1NQ0 A;  1FCY A;  5HCV A;  3WT5 A;  5KRF A;  2IOG A;  1E3G A;  2PNU A;  1M7W A;  2I0G A;  5DKG A;  2VV0 A;  2AXA A;  4UDC A;  2AYR A;  4OZR E;  4PP5 A;  3HC6 A;  2J7Y A;  1ZGY A;  3NSQ A;  5DKE A;  5DVS A;  2QA8 B;  3FS1 A;  3SZ1 A;  2QR9 A;  5KCW A;  1X76 A;  2Q5G A;  5HJS A;  5GIE A;  3VHU A;  2PIO A;  1RKH A;  2R6Y A;  4S0S A;  4ZN7 A;  3P8X A;  4CI5 A;  5AYG A;  2JFA A;  3ZR7 A;  1YOK A;  5DMF A;  2VV4 A;  1YUC A;  2Q1V A;  5DXP A;  4OZR U;  3VJH A;  3WWR A;  3PRG A;  3IA6 A;  5KRC A;  2ZXZ A;  3HO0 A;  2V0V A;  4IVY A;  3TKM A;  2YJD A;  3DZY D;  4IVW A;  4P6W A;  2ZBS A;  3H52 A;  1YY4 A;  4RZE A;  3W5Q A;  3L0L A;  2AX9 A;  4R6S A;  4WQP A;  3ET1 A;  3ADX A;  4ZOM A;  5L7H A;  4PF3 A;  1VJB A;  2NXX E;  2FSZ A;  1MVC A;  3OMP A;  4IUI A;  3T03 A;  5KRO A;  3IPS A;  3FUG A;  5DL4 A;  2AWH A;  2PIQ A;  4KZI A;  2PIV A;  2ABI A;  2GWX A;  3E94 A;  2V7C A;  2ZK5 A;  4WPF A;  4DMA A;  2AB2 A;  1TFC A;  2NXX A;  2ZK0 A;  4OHA A;  4XUM A;  2G0G A;  1XV9 A;  2ZFX A;  4TUZ A;  1Z5X E;  3BC5 A;  3OZ0 A;  4L96 A;  5AWK A;  4JYG A;  5DUE A;  3V49 A;  3K23 A;  2PIP L;  3AUN A;  4JGV A;  5G5W A;  3X1H A;  5ACC A;  4K7A A;  4MG9 A;  2HB8 A;  2ZNP A;  2QXS A;  4XT9 A;  5DYB A;  3HZF A;  1E3K A;  1ZEO A;  4PLE A;  5E14 A;  3AUR A;  2HBH A;  5EC9 A;  5KYJ A;  1UHL B;  5DWL A;  4QE8 A;  3P89 A;  1XDK A;  2QGW A;  3IPU A;  5DX3 A;  1OVL B;  1ZKY A;  2XYJ A;  5APK A;  4OZT E;  4EM9 A;  2BAW A;  1UPW A;  5DWG A;  4MGA B;  1GWX A;  4OIU A;  4YPQ A;  3PBA A;  2J14 A;  4DOS A;  1FM6 A;  3FEI A;  3GZ9 A;  1XQC A;  2AX6 A;  3TX7 B;  1BSX A;  1XLS E;  1R1K A;  1Y0S A;  2H77 A;  2B1Z A;  2W8Y A;  3W0A A;  5EIT A;  1OSV A;  4XTA A;  4LBD A;  2ZXM A;  1G1U A;  4UDA A;  3JZC A;  5DIG A;  1K74 A;  5C4S A;  4Y29 A;  5DID A;  4YT1 A;  1XLS A;  3TY0 A;  1MV9 A;  4ZNT A;  1DKF A;  4K4J A;  5G44 A;  1NDE A;  4HLW A;  5DV6 A;  5AVI A;  5KRI A;  3UU7 B;  4DM8 A;  3CS8 A;  3FC6 A;  1FM9 A;  4G2H A;  1LBD A;  3R8I A;  3VRT A;  4N5G A;  3VT9 A;  4OH6 A;  4EMA A;  5DK9 A;  5H1E A;  4OKW A;  4G2I A;  2ZK4 A;  4J5X C;  2YLP A;  4O8F A;  4S14 A;  4PVU A;  2J4A A;  3V4A A;  5M96 A;  4XUH A;  1GWR A;  1KKQ A;  4ZJW A;  3G0W A;  1ZDU A;  3OS8 A;  5G43 A;  4APU A;  3B0W A;  3AN3 A;  2NV7 A;  3WJ4 A;  4MGC A;  5GID A;  1R1K D;  2YJA B;  2O4J A;  5DTV A;  4Q50 A;  5DUH A;  3VN2 A;  1XV9 B;  3RUU A;  3O1E A;  4XHD A;  3GWX A;  3HM1 A;  3PCU A;  3OAP A;  1XP1 A;  5DXB A;  2Q6J A;  3G8I A;  1K74 D;  5KCE A;  2Q61 A;  4MG9 B;  1PDU A;  3ADU A;  3CLD A;  3ZRA A;  3OMK A;  3F5C A;  2AO6 A;  1U3Q A;  2QA6 A;  2QZO B;  3B0Q A;  4IW8 A;  3LMP A;  3R5M A;  3A9E B;  5DIE A;  2ZY0 A;  4Q0A C;  4IU7 A;  2P15 A;  1FM9 D;  2IOK A;  3KDT A;  4PWL A;  3FAL A;  5DXK A;  5B5B A;  4G1Y A;  1XIU A;  3D57 A;  3BQD A;  4B7W A;  5HJP B;  4IWF A;  5KYA A;  4CSJ A;  1X7B A;  2ACL A;  3L0J A;  1FBY A;  5L7E A;  2Q60 A;  4QE6 A;  1U3R A;  1ZDT A;  4MG7 B;  1XVP B;  1T5Z A;  2HAM A;  3W5P A;  4MDD A;  5IAW A;  3G8O A;  4G1Z A;  1YIN A;  5A86 A;  3VJI A;  4OH5 A;  2AAX A;  2P7G A;  1RKG A;  3FXV A;  3WFF A;  3VRV A;  2P1T A;  3JZB A;  3Q95 A;  3W0Y A;  4PP6 A;  1XOW A;  4G1D A;  4IWC A;  5L7G A;  5AAV B;  3WT6 A;  3OZJ A;  1QKN A;  1S0Z A;  4OJ4 A;  4LNX A;  1PQ6 A;  1K7L A;  1TXI A;  2Q5S A;  3K8S A;  4OED A;  3WT7 A;  1IE8 A;  3D6D A;  4FNE A;  4DOR A;  5DXG A;  3UUD A;  2Q59 A;  2XHS A;  2Q3Y A;  2Z4J A;  3AZ2 A;  4OIL A;  5IXK A;  4LTW A;  3L03 A;  1T7F A;  3VRW A;  3R5N A;  3L3X A;  2HAR A;  2ZK1 A;  3KMG A;  1YP0 A;  5EI1 A;  1RK3 A;  5KRH A;  2QAB A;  2PIX A;  2QSE A;  2PKL A;  2QPY A;  2QW4 A;  2HFP A;  3FUR A;  5FQT A;  3B0R A;  5DWE A;  3WFG A;  3OSI A;  2Q70 A;  1R5K A;  3QT0 A;  2GIU A;  4X1G A;  3R8D A;  5G46 A;  3UUC A;  4ZNS A;  4DQM A;  3OLF A;  1A52 A;  4OK1 A;  5E1C A;  4K6I A;  3CWD A;  5DV8 A;  4MG5 A;  2ZVT A;  1XNN A;  1XP9 A;  3HC5 A;  3O1D A;  4NB6 A;  5EGV A;  1EXX A;  2JF9 A;  2YHD A;  2ZK3 A;  4RE8 A;  3H0A A;  4IA7 A;  1HJ1 A;  3R8A A;  2ZAS A;  3IPQ A;  4CI4 A;  1G50 A;  1NQ7 A;  2BJ4 A;  3MNE A;  1SJ0 A;  5DI7 A;  1NRL A;  3KDU A;  3M7R A;  4FGY A;  4RUJ A;  3AUQ A;  2VV1 B;  3ERT A;  5HZC A;  5JJM B;  1YOW A;  5HYR A;  4J5W C;  5JI0 D;  5DXB B;  1KV6 A;  3B3K A;  5LWP A;  2ZKC A;  5C4U A;  3DT3 A;  2HAS A;  4RUP A;  3B65 A;  3WGP A;  2OZ7 A;  1ZAF A;  4IV2 A;  5K13 A;  4TV1 A;  3A3Z X;  1L2I A;  2PIW A;  2POG A;  4XLD A;  2GPV A;  3VJS A;  3ADW A;  2OM9 A;  1K4W A;  5L11 A;  5G42 A;  1G5Y A;  2Q7I A;  3S9S A;  5APH A;  2B1V A;  4FN9 A;  3NOA A;  1U9E A;  4NY9 A;  2AMA A;  3CS4 A;  1NQ1 A;  4QJR A;  1T76 A;  3VHW A;  5EJV A;  5DWI A;  4MGB B;  3CJW A;  2AMB A;  4M8E A;  5GT4 A;  4PPP A;  3UUA B;  3VT3 A;  4RZG A;  3W0H A;  2ZK2 A;  3GYU A;  3VT6 A;  4RME A;  1PK5 A;  2Q7K A;  2F4B A;  3H0A D;  3D5F A;  3LBD A;  1YIM A;  2E2R A;  3VRU A;  3OMO A;  5KCT A;  3ADS A;  3OMQ A;  5DV3 A;  4JYI A;  5DZH A;  3VSO A;  1ERR A;  3W0I A;  3VJT A;  2P1U A;  2GPP A;  3KBA A;  4DK7 A;  4OKT A;  2Q8S A;  2YAT A;  4OC7 A;  4RUO X;  4JL4 A;  3RLL A;  3ZRB A;  3MNO A;  3A2I A;  2QH6 A;  1NYX A;  4RMC A;  4UDD A;  5DRM A;  2B50 A;  2QMV A;  1P93 A;  1ILH A;  5AZV A;  4S0T A;  4QL8 A;  4ITE A;  5B41 A;  4JYH A;  4ZO1 B;  1N83 A;  1DB1 A;  4JAZ A;  2JFA B;  3UP3 A;  4NUF A;  5E0X A;  2PIT A;  2VV4 B;  1X7J A;  3VT8 A;  3KYT A;  4YNK A;  2VSR A;  2Q7L A;  4MG8 A;  2PIN A;  3V9V A;  3VT7 A;  4PP3 A;  2ZLC A;  2Q6R A;  1NAV A;  4REE A;  4OAR A;  2ATH A;  4E2J A;  2G44 A;  3KMR A;  2FAI A;  2XKW A;  3P0U A;  2JJ3 A;  5AWJ A;  2GPO A;  2QA8 A;  2ZL9 A;  3UP0 A;  4OIV A;  3DCT A;  4IA1 A;  5KCU A;  4G20 A;  2P54 A;  3EYB A;  3CTB A;  5DRJ A;  4ONI A;  2OVH A;  2IHQ A;  5FQP A;  2AX7 A;  1OT7 A;  2BJ4 B;  3AX8 A;  3VTB A;  1GWQ A;  2P4Y A;  3OOF A;  5DY8 A;  1T74 A;  4TUZ B;  5DKS A;  3W0J A;  3GYT A;  4J26 A;  3RVF A;  1YMT A;  1ZUC A;  2ZXN A;  3V3Q A;  1OSH A;  2GP7 A;  4J5X A;  2AA6 A;  3OGT A;  4OFU A;  5DKB A;  4NQA B;  1XJ7 A;  2ZLA A;  4MGD A;  3AFR A;  2GPU A;  2LBD A;  4X1F A;  1T79 A;  1NUO A;  1SQN A;  3A40 X;  5EHJ A;  2O4R A;  5DUG A;  4A4W A;  1H9U A;  1N4H A;  3TKC A;  1XDK B;  4E4Q A;  4N73 A;  4OEA A;  2QE4 A;  5DX3 B;  1SKX A;  4WLB A;  1NQ2 A;  3VT5 A;  1NAX A;  1FCX A;  4RWV A;  1PCG A;  5E0W A;  1QKT A;  3ET2 A;  3OSW A;  1X78 A;  1YYE A;  1YA3 A;  5KD9 A;  5DXR A;  4PPS A;  4E4K A;  3V9Y A;  1XP6 A;  1UPV A;  2P7A A;  5DZI A;  4BCR A;  2FVJ A;  3R2A A;  4RFW A;  1XB7 A;  1M2Z A;  4Q13 A;  5KR9 A;  3HQ5 A;  5G3J A;  2ZK6 A;  3SP6 A;  1T7R A;  2POB A;  4F9M A;  3CDP A;  2AA5 A;  3L1B A;  1T73 A;  4IQR A;  3V3E A;  3CDS A;  5DVC A;  3CS6 A;  5FQV A;  3DY6 A;  1UHL A;  3F7D A;  3B68 A;  1DKF B;  4OJB A;  4OKX A;  1L2J A;  3VT4 A;  5DWJ A;  1XNX A;  2PRG A;  2A3I A;  1OVL A;  4IV4 A;  1I38 A;  3FC6 B;  1R6G A;  3FLI A;  4MGA A;  4N8R A;  5DU5 A;  1WM0 X;  3ADT A;  1S19 A;  4MG6 A;  3VHV A;  5HYK A;  1FCZ A;  3IXP D;  3CQV A;  4OJ9 A;  4OKB A;  3NSP A;  2AM9 A;  5APJ A;  5I4V A;  5DZ3 A;  1T65 A;  4G21 A;  5KRJ A;  4REF A;  2AA2 A;  2QTU A;  1S9P A;  5DMC A;  5KCD A;  1RJK A;  1A28 A;  4QK4 A;  5JY3 A;  3L0E A;  5DXE A;  3A78 A;  5DZ0 A;  3RY9 A;  3KMZ A;  5CJ6 A;  3DCU A;  3AZ1 A;  4PLD A;  4NIE A;  5KRL A;  3GD2 A;  4QM0 A;  2Q6S A;  4RAK A;  5GIC A;  2VST A;  5DLR A;  4HEE X;  4ZNU A;  4WHG A;  3UU7 A;  4R2U A;  2ZMI A;  2R6W A;  2HWR A;  1YJE A;  5KRK A;  3F5C B;  2QGT A;  2PIU A;  4OLM A;  3W0G A;  2OAX A;  4MGD B;  1T7T A;  3VI8 A;  3BEJ A;  4POH A;  3FAL B;  5IZ0 A;  1PZL A;  3PO9 A;  4RZF A;  5KCC A;  3OSA A;  1T7M A;  2P1V A;  3L3Z A;  3W5T A;  2ACL B;  5AAU A;  3ET3 A;  2I4P A;  3B66 A;  2XYW A;  4J5W A;  4IA3 A;  2PIR A;  3ERD A;  5C4O A;  2HWQ A;  2OUZ A;  3ADV A;  4ZI1 A;  4A2J A;  1I7I A;  1QKM A;  3X36 A;  1LV2 A;  1QKU A;  3E7C A;  4KZM A;  2I4Z A;  3Q95 B;  3UVV A;  3ZQT A;  4DK8 A;  1N46 A;  3DR1 A;  4OEY A;  1GS4 A;  2ZNO A;  3B5R A;  2HCD A;  3OMM A;  5ICK A;  2QZO A;  2R40 A;  4S15 A;  3KWY A;  1Y0X X;  2I0J A;  3A9E A;  4IS8 A;  4ITF A;  4LNW A;  4ZO1 X;  5E7V A;  2Q7J A;  5KRA A;  3UUD B;  1Y9R A;  4R06 A;  2Q59 B;  2HB7 A;  3K6P A;  3KPZ A;  3OLL A;  2QNV A;  3E00 A;  1I7G A;  1FD0 A;  2OCF A;  4KZJ A;  3X1I A;  4PRG A;  1Z5X U;  3OOK A;  5HJP A;  3B0T A;  3DZU A;  4ZNH A;  1HG4 A;  4MG7 A;  1XVP A;  4YMQ A;  2O9I A;  1XAP A;  2YLO A;  1U3S A;  2ZNQ A;  3GBK A;  1T63 A;  3N00 A;  4N1Y A;  1Q4X A;  3GN8 A;  1S0X A;  4OEZ A;  4WVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...