5ICKA

A unique binding model of fxr lbd with feroline
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
229
structure length
229
Chain Sequence
ELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Novel Class of Natural FXR Modulators with a Unique Mode of Selective Co-regulator Assembly
pubmed doi rcsb
molecule keywords Bile acid receptor
molecule tags Transcription
source organism Homo sapiens
total genus 93
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5ickA00
5I4VA 1G50A 1XB7A 3OZ0A 3B0QA 4MG9B 3V49A 3UUAB 3BEJA 4NY9A 5AVLA 3IXPD 2ZNNA 1OSHA 1Z5XU 1NHZA 2YATA 1NAXA 5M96A 2JFAA 1T74A 2YLQA 2Q8SA 2YJDA 3CLDA 3CS8A 2JFAB 5DWJA 5HCVA 2I4ZA 5L7GA 1PZLA 2HB8A 2QXMA 5DP0A 2NW4A 4PP3A 3VJSA 5HZCA 3FURA 4KZMA 5KRJA 2ZLAA 1NQ7A 2AA7A 4K4JA 3VT4A 5DIGA 5HYRA 5JJMB 1UHLA 3A3ZX 3DZYA 2P15A 1XNNA 4OIUA 4RZGA 4S14A 5DXKA 4ZJRA 1UPVA 5DXMA 4IQRA 5KYAA 1KKQA 4LNWA 4ZNTA 4ZNVA 3BC5A 4OIVA 3AZ1A 3WFFA 5KCTA 3OS8C 3WT7A 3V9YA 3PRGA 1VJBA 1N83A 4MGBB 3UUDB 3VJHA 1M13A 3CQVA 3FC6A 3S9SA 5SYZA 1RDTA 4DOSA 5AYGA 2BAWA 5FQVA 4M8HA 4NUFA 5EI1A 2ZMIA 2NV7A 2P4YA 4IA7A 4MG5A 4UDCA 1Q4XA 2Q70A 1A28A 2HFPA 2VV0A 4QJRA 5F9BA 1NQ2A 3X1IA 5JY3A 4N73A 3D90A 5EITA 4ZNSA 5DXGA 1XAPA 3TX7B 3VT8A 3A2JA 2P7GA 4S0TA 2G0GA 1R1KD 3R8IA 4PPPA 3VTCA 2P7ZA 5KR9A 3AUQA 1NQ0A 3TY0A 1T79A 4JYGA 2JJ3A 2ZK6A 1I7GA 3D24A 2POBA 4FHHA 2PRGA 5KRHA 2I0JA 5ACCA 2A3IA 3N00A 1XLSE 3L3XA 2YFEA 5DI7A 4ZJWA 1XQ3A 4RFWA 5DXEA 3UU7A 4RMDA 1YIMA 1U3RA 4DM8A 4UDAA 5DYDA 3WTQA 2QTUA 4IUIA 4QK4A 3UU7B 1FCYA 1X76A 3OMKA 3RY9A 4TV1A 1XNXA 3G0WA 1XIUA 4OH6A 4YNKA 1G1UA 2GL8A 1YOKA 3L3ZA 4MG7A 2VV4A 3M7RA 1K4WA 1K7LA 1XP1A 5KCCA 3OKHA 4L96A 1PRGA 4MG7B 3VT7A 2Z4JA 5DV8A 1U9EA 2V7CA 4ZNWA 3OSWA 2GWXA 4FGYA 1QKNA 2AWHA 3FEJA 2OUZA 1X7BA 2ZNOA 5KROA 3GYUA 2B1VA 1FCZA 1RJKA 1ILHA 2HBHA 2AMBA 3KWYA 1XP9A 2QR9A 1DB1A 2OVHA 3HZFA 1Z5XE 1GWQA 4XLDA 3NSQA 4HEEX 1QKMA 2REWA 2ZXNA 3HQ5A 1DKFB 2P1UA 3E00A 2Q6RA 5DWIA 5DWLA 2ZK5A 3FS1A 3BQDA 4G21A 4IU7A 5APHA 4JL4A 4JYHA 5L7EA 1H9UA 3GN8A 2Q5PA 1U3QA 1XP6A 1S0ZA 5E7VA 3RUTA 3D57A 5B5BA 1U3SA 3SZ1A 1T73A 3PCUA 4WLBA 3OMOA 4YPQA 3L0EA 1XVPB 4OH5A 3V4AA 5KRKA 1RKHA 4A4WA 1PCGA 1XV9A 4RUJA 2ZMHA 4ITFA 2AA6A 4BCRA 4E4QA 5DLRA 3K8SA 3VTBA 2IOKA 3E94A 4ZNUA 3H0AA 4B7WA 2OM9A 3L0JA 3HODA 4FNEA 2VV2A 1TFCA 2ZMJA 3OS8A 4O8FA 1S9PA 4ZO1X 4OZRU 2B1ZA 3B67A 4NIEA 3G9EA 4LTWA 5E14A 2W8YA 3DCTA 3HC5A 4XT9A 3QT0A 5DIEA 4OZTU 2QZOA 3WGPA 1E3KA 1P93A 3OSIA 3B0WA 5FQRA 2VV1A 5DWGA 5IAWA 5E19A 1YY4A 3WJ5A 2QZOB 3GWXA 3ET1A 2ZFXA 1YJEA 3R8DA 2ZK4A 2VV1B 5G42A 3T03A 3WMHA 5DRMA 3KPZA 5DXQA 3ET2A 4A4VA 4MGCA 2OCFA 2O9IA 3GYTA 2GIUA 1WM0X 2ZNQA 5IZ0A 1TXIA 1L2IA 2AM9A 5DZIA 5G43A 5ICKA 3A40X 3ERTA 1SR7A 2AO6A 5AAVA 1FCXA 5E1CA 1T7FA 1NAVA 3HO0A 3DZUA 2QH6A 4DK7A 3A2IA 3CTBA 2AA2A 4PF3A 4DMAA 1T5ZA 4CSJA 1T65A 4OJ4A 5DZHA 2I4PA 4JGVA 3K23A 5C4SA 1GS4A 5DTVA 2GP7A 1K74D 2ZVTA 4REFA 3ZQTA 2Q1HA 4OILA 5DWEA 2FSZA 4R2UA 1N4HA 1FM6A 1EXAA 1S0XA 3ADTA 1ZGYA 4G1YA 4P6WA 1YMTA 2J4AA 2IOGA 3IXPA 5AZTA 5KYJA 4ZNHA 3Q95A 4OJBA 3PLZA 1UPWA 2Q60A 3SP6A 3RVFA 2AYRA 4OEZA 5GIEA 1UHLB 1YUCA 5KRMA 4CI4A 3Q95B 1G5YA 3ADVA 4S0SA 5DVCA 4OGHA 1FD0A 4POHA 2ZK0A 3ET0A 4REEA 3VHUA 3K6PA 3MNOA 4K6IA 2PKLA 2VV3A 4Q50A 3IA6A 1Y9RA 5DMFA 1RDTD 2ZL9A 3FC6B 4OEDA 5HJPA 5GIDA 4EM9A 2BJ4A 1XDKA 2Q59A 3B3KA 1NRLA 4ZOMA 3VT5A 5L11A 5LWPA 4K7AA 5DKSA 5A86A 3VRUA 3ZRAA 1QKUA 2J14A 2BJ4B 2H77A 3AN3A 4XUMA 5EC9A 2Q59B 4X1GA 4OKBA 4X1FA 5DZ3A 2AX7A 2POGA 1Y0SA 3AZ3A 2ZK3A 4RZEA 3ZR7A 5GICA 3X31A 1ERRA 2YJAB 3CWDA 1OVLA 2AMAA 2ZBSA 3VHVA 2PITA 4PVUA 2F4BA 5DZ0A 3MNEA 1ZKYA 4OZRE 3UUCA 2Q7IA 2QPYA 3AX8A 3F7DA 2FAIA 2J7XA 2ZXMA 5AWKA 1PK5A 4OKXA 4OZTE 4TV1B 3A2HA 4J24A 4E2JA 2QXSA 1T76A 4MG8A 5KRIA 2Q7KA 5AK2A 5E15A 1UOMA 3B0RA 3VJIA 1Z95A 2VV4B 3VT3A 4MG8B 4J5XC 3L1BA 2AX6A 5DVVA 3UP3A 1HJ1A 1X7RA 4Q0AC 1YA3A 2Q6JA 3H52A 4G1ZA 1ZH7A 3ADWA 1XJ7A 3CS6A 4OKWA 3VRVA 3VT6A 1YOWA 1FM9A 2ZKCA 3RLJA 2IHQA 3JZBA 4OFRA 1LV2A 4PWLA 2R6YA 2ZY0A 4MGDA 4YT1A 2XYXA 2VSTA 3VSPA 1L2JA 2QW4A 4MGDB 4ZI1A 3ILZA 1EREA 4RZFA 1R6GA 3AFRA 2H79A 3VI8A 3ET3A 3W5QA 1XZXX 4Q13A 5DV3A 2VSRA 3W0AA 3W0YA 3OS9A 5KCEA 1PQCA 2PIVA 3PO9A 4N1YA 4NB6A 3R29A 3D6DA 3CDSA 2JF9A 4N8RA 4QM0A 3V9VA 2PIWA 3VSOA 4YMQA 5KCFA 1SQNA 4FHIA 1XV9B 1X78A 3R5MA 1YP0A 4IWFA 5AZVA 1ZDTA 3H0AD 3OLLA 1LBDA 5K13A 2GTKA 5DXBA 1I38A 1P8DA 3AUNA 2B50A 3LMPA 3R8AA 3W0GA 4EMAA 4UDDA 3KFCA 1R20A 3D5FA 5DXBB 3KYTA 5DYBA 4PPSA 5H1EA 2QGWA 5CJ6A 2O4RA 3OMMA 5KCUA 4XI3A 2NXXA 5APKA 1MV9A 5AWJA 5HYKA 2HWRA 2P7AA 5DX3A 2ZASA 3DT3A 5B41A 5DL4A 3IPSA 4OHAA 4DQMA 2YHDA 1NYXA 2R40D 5GT4A 2YLYA 3FXVA 3KMGA 5DX3B 3SP9A 3OLSA 1XQCA 4PP6A 3W0JA 3O1DA 4E4KA 2OZ7A 4IA1A 5E0XA 3W5PA 1NQ1A 2QA8A 1IE8A 2G44A 5DUGA 1MVCA 5G5WA 5DY8A 3OGTA 4A2JA 4IA2A 5AAVB 3P88A 4MGAA 4PXMA 4J26A 2Q1VA 4QE6A 1I7IA 2Q5GA 4LNXA 3HVLA 4MGAB 5DUHA 3WFGA 3R2AA 1X7JA 5IXKA 5KCDA 2AB2A 4ONIA 4WPFA 2GPUA 3GD2A 3L0LA 2PIRA 1GWXA 1X7EA 4OARA 4XTAA 5DIDA 3W0IA 2QA6A 1PDUA 2QMVA 2AX9A 2HWQA 2V0VA 2YLPA 2ABIA 3DR1A 1RKGA 4J5XA 4N5GA 3WWRA 3B0TA 3EYBA 3NSPA 3FLIA 1FM6D 3GBKA 4OKTA 4OLMA 5KCWA 4R06A 1A52A 4L98A 4UDBA 1YINA 4OK1A 3OKIA 2Q61A 4R6SA 4ZN7A 1ILGA 3DCUA 3HLVA 4FN9A 3GZ9A 2ZK2A 3A78A 3OAPA 5HJSA 3ZRBA 5DKGA 5AAUA 3W0HA 3UP0A 3DZYD 3B65A 4IVWA 4IVYA 4LBDA 5KRAA 4G20A 4IV2A 1K74A 1PQ6A 1S19A 3OZJA 3WT6A 4POJA 2ZXZA 4G2IA 1ZAFA 3KMZA 2OVMA 5G3JA 5DV6A 1QKTA 3G8OA 5DSHA 2Q3YA 3FALA 4PLDA 2FVJA 5JJMA 1ZUCA 4F9MA 3W5TA 2ZK1A 3FALB 4ZO1B 5HJPB 4MDDA 5EJVA 1XLSA 1XDKB 4XHDA 2NPAA 2PNUA 5AVIA 2HCDA 4WVDA 3VN2A 4DK8A 2QE4A 4IWCA 4IA3A 4PP5A 3VTDA 4J5WC 1R5KA 5G46A 4OC7A 5KRFA 3UUDA 4MGBA 3AZ2A 2HB7A 3OLFA 5KD9A 2HVCA 5DZ1A 2PIOA 1XOWA 5DXPA 4RAKA 2GPPA 2HAMA 3IPQA 3V3QA 3X36A 2Z4BA 3RUUA 1OVLB 4LSJA 2EWPA 1MZNA 4IS8A 3CJWA 3IPUA 5DU5A 4RWVA 3V3EA 3W5RA 4IW6A 1R1KA 3FUGA 4QE8A 4QL8A 3ERDA 2G5OA 2QGTA 4NQAB 4OEAA 4JYIA 2XHSA 1T7MA 5L7HA 2J7YA 2XKWA 3JZCA 2Q6SA 4KZJA 4APUA 1HG4A 5EHJA 2P1VA 4OFUA 4RUPA 2P1TA 3B68A 4Y29A 3CS4A 3OMPA 1M7WA 2HC4A 2I4JA 5FQTA 1OSVA 4TUZA 5LGAA 3LBDA 3VHWA 4OJ9A 3PBAA 2R6WA 1EXXA 3ADSA 1FM9D 2GPVA 2QNVA 4TUZB 5C4UA 1T7RA 3MNPA 1BSXA 4IW8A 2ZLCA 1FBYA 1RK3A 3R5NA 5DRJA 3O1EA 2Q7JA 1I37A 4RUOX 4RMCA 3E00D 3HM1A 3TKCA 1YYEA 1NUOA 4PRGA 5DXRA 3NOAA 3B66A 4S15A 2GPOA 1T7TA 3UVVA 4ZN9A 1M2ZA 5G44A 2ACLA 3DY6A 3K22A 5FQSA 3UVVB 3GWSX 4IV4A 1N46A 2E2RA 3G8IA 5JI0D 1ZEOA 2ACLB 5E0WA 4WHFA 2QABA 5ETHA 3VRTA 4OEYA 2PJLA 3X1HA 2Q5SA 1DKFA 5DKBA 4RE8A 5DVSA 3E7CA 5C4OA 5FQPA 1GWRA 2PIXA 5KRLA 2ATHA 3KDUA 3HC6A 5DUEA 3P0UA 3V9TA 2QSEA 4G1DA 5EGVA 2PIUA 4ITEA 1E3GA 1ZDUA 3WT5A 3L03A 4M8EA 3TKMA 1R20D 4P6XA 2AA5A 3W0CA 5APJA 1XVPA 1KV6A 4RMEA 4MG6A 4JAZA 1SKXA 5DMCA 2HARA 3AN4A 3WJ4A 2PINA 5KRCA 3OMQA 4PLEA 4WHGA 3RLLA 1NDEA 3PEQA 3P89A 1KNUA 2XYJA 3A9EA 3OSAA 1SJ0A 4J5WA 2O4JA 3VT9A 3A9EB 4WQPA 4CI5A 3KBAA 3VJTA 2OAXA 4XUHA 4DORA 1T63A 2Q7LA 2ZNPA 3AURA 3P8XA 3ADUA 1OT7A 3KMRA 4HLWA 2AXAA 3B5RA 3IMYA 3KDTA 2AAXA 4KZIA 5C4TA 2XYWA 2QA8B 2HASA 3OOKA 4G2HA 3U9QA 3F5CA 5DK9A 5G45A 5DKEA 2LBDA 1G2NA 1IE9A 1S9QA 1PQ9A 3F5CB 3B1MA 2R40A 3FEIA 3OOFA 4XAOA 2AX8A 1Y0XX 2I0GA 3CDPA 3ADXA 2PIPL 2PIQA 2G0HA 2B23A 1XPCA 2NXXE 2P54A 4MG9A 4DM6A 2YLOA 3DZUD 3UUAA 3VRWA
chains in the Genus database with same CATH superfamily
5I4VA 1G50A 1XB7A 3OZ0A 3B0QA 4MG9B 3V49A 3UUAB 3BEJA 4NY9A 5AVLA 3IXPD 2ZNNA 1OSHA 1Z5XU 1NHZA 2YATA 1NAXA 5M96A 2JFAA 1T74A 2YLQA 2Q8SA 2YJDA 3CLDA 3CS8A 2JFAB 5DWJA 5HCVA 2I4ZA 5L7GA 1PZLA 2HB8A 2QXMA 5DP0A 2NW4A 4PP3A 3VJSA 5HZCA 3FURA 4KZMA 5KRJA 2ZLAA 1NQ7A 2AA7A 4K4JA 3VT4A 5DIGA 5HYRA 5JJMB 1UHLA 3A3ZX 3DZYA 2P15A 1XNNA 4OIUA 4RZGA 4S14A 5DXKA 4ZJRA 1UPVA 5DXMA 4IQRA 5KYAA 1KKQA 4LNWA 4ZNTA 4ZNVA 3BC5A 4OIVA 3AZ1A 3WFFA 5KCTA 3OS8C 3WT7A 3V9YA 3PRGA 1VJBA 1N83A 4MGBB 3UUDB 3VJHA 1M13A 3CQVA 3FC6A 3S9SA 5SYZA 1RDTA 4DOSA 5AYGA 2BAWA 5FQVA 4M8HA 4NUFA 5EI1A 2ZMIA 2NV7A 2P4YA 4IA7A 4MG5A 4UDCA 1Q4XA 2Q70A 1A28A 2HFPA 2VV0A 4QJRA 5F9BA 1NQ2A 3X1IA 5JY3A 4N73A 3D90A 5EITA 4ZNSA 5DXGA 1XAPA 3TX7B 3VT8A 3A2JA 2P7GA 4S0TA 2G0GA 1R1KD 3R8IA 4PPPA 3VTCA 2P7ZA 5KR9A 3AUQA 1NQ0A 3TY0A 1T79A 4JYGA 2JJ3A 2ZK6A 1I7GA 3D24A 2POBA 4FHHA 2PRGA 5KRHA 2I0JA 5ACCA 2A3IA 3N00A 1XLSE 3L3XA 2YFEA 5DI7A 4ZJWA 1XQ3A 4RFWA 5DXEA 3UU7A 4RMDA 1YIMA 1U3RA 4DM8A 4UDAA 5DYDA 3WTQA 2QTUA 4IUIA 4QK4A 3UU7B 1FCYA 1X76A 3OMKA 3RY9A 4TV1A 1XNXA 3G0WA 1XIUA 4OH6A 4YNKA 1G1UA 2GL8A 1YOKA 3L3ZA 4MG7A 2VV4A 3M7RA 1K4WA 1K7LA 1XP1A 5KCCA 3OKHA 4L96A 1PRGA 4MG7B 3VT7A 2Z4JA 5DV8A 1U9EA 2V7CA 4ZNWA 3OSWA 2GWXA 4FGYA 1QKNA 2AWHA 3FEJA 2OUZA 1X7BA 2ZNOA 5KROA 3GYUA 2B1VA 1FCZA 1RJKA 1ILHA 2HBHA 2AMBA 3KWYA 1XP9A 2QR9A 1DB1A 2OVHA 3HZFA 1Z5XE 1GWQA 4XLDA 3NSQA 4HEEX 1QKMA 2REWA 2ZXNA 3HQ5A 1DKFB 2P1UA 3E00A 2Q6RA 5DWIA 5DWLA 2ZK5A 3FS1A 3BQDA 4G21A 4IU7A 5APHA 4JL4A 4JYHA 5L7EA 1H9UA 3GN8A 2Q5PA 1U3QA 1XP6A 1S0ZA 5E7VA 3RUTA 3D57A 5B5BA 1U3SA 3SZ1A 1T73A 3PCUA 4WLBA 3OMOA 4YPQA 3L0EA 1XVPB 4OH5A 3V4AA 5KRKA 1RKHA 4A4WA 1PCGA 1XV9A 4RUJA 2ZMHA 4ITFA 2AA6A 4BCRA 4E4QA 5DLRA 3K8SA 3VTBA 2IOKA 3E94A 4ZNUA 3H0AA 4B7WA 2OM9A 3L0JA 3HODA 4FNEA 2VV2A 1TFCA 2ZMJA 3OS8A 4O8FA 1S9PA 4ZO1X 4OZRU 2B1ZA 3B67A 4NIEA 3G9EA 4LTWA 5E14A 2W8YA 3DCTA 3HC5A 4XT9A 3QT0A 5DIEA 4OZTU 2QZOA 3WGPA 1E3KA 1P93A 3OSIA 3B0WA 5FQRA 2VV1A 5DWGA 5IAWA 5E19A 1YY4A 3WJ5A 2QZOB 3GWXA 3ET1A 2ZFXA 1YJEA 3R8DA 2ZK4A 2VV1B 5G42A 3T03A 3WMHA 5DRMA 3KPZA 5DXQA 3ET2A 4A4VA 4MGCA 2OCFA 2O9IA 3GYTA 2GIUA 1WM0X 2ZNQA 5IZ0A 1TXIA 1L2IA 2AM9A 5DZIA 5G43A 5ICKA 3A40X 3ERTA 1SR7A 2AO6A 5AAVA 1FCXA 5E1CA 1T7FA 1NAVA 3HO0A 3DZUA 2QH6A 4DK7A 3A2IA 3CTBA 2AA2A 4PF3A 4DMAA 1T5ZA 4CSJA 1T65A 4OJ4A 5DZHA 2I4PA 4JGVA 3K23A 5C4SA 1GS4A 5DTVA 2GP7A 1K74D 2ZVTA 4REFA 3ZQTA 2Q1HA 4OILA 5DWEA 2FSZA 4R2UA 1N4HA 1FM6A 1EXAA 1S0XA 3ADTA 1ZGYA 4G1YA 4P6WA 1YMTA 2J4AA 2IOGA 3IXPA 5AZTA 5KYJA 4ZNHA 3Q95A 4OJBA 3PLZA 1UPWA 2Q60A 3SP6A 3RVFA 2AYRA 4OEZA 5GIEA 1UHLB 1YUCA 5KRMA 4CI4A 3Q95B 1G5YA 3ADVA 4S0SA 5DVCA 4OGHA 1FD0A 4POHA 2ZK0A 3ET0A 4REEA 3VHUA 3K6PA 3MNOA 4K6IA 2PKLA 2VV3A 4Q50A 3IA6A 1Y9RA 5DMFA 1RDTD 2ZL9A 3FC6B 4OEDA 5HJPA 5GIDA 4EM9A 2BJ4A 1XDKA 2Q59A 3B3KA 1NRLA 4ZOMA 3VT5A 5L11A 5LWPA 4K7AA 5DKSA 5A86A 3VRUA 3ZRAA 1QKUA 2J14A 2BJ4B 2H77A 3AN3A 4XUMA 5EC9A 2Q59B 4X1GA 4OKBA 4X1FA 5DZ3A 2AX7A 2POGA 1Y0SA 3AZ3A 2ZK3A 4RZEA 3ZR7A 5GICA 3X31A 1ERRA 2YJAB 3CWDA 1OVLA 2AMAA 2ZBSA 3VHVA 2PITA 4PVUA 2F4BA 5DZ0A 3MNEA 1ZKYA 4OZRE 3UUCA 2Q7IA 2QPYA 3AX8A 3F7DA 2FAIA 2J7XA 2ZXMA 5AWKA 1PK5A 4OKXA 4OZTE 4TV1B 3A2HA 4J24A 4E2JA 2QXSA 1T76A 4MG8A 5KRIA 2Q7KA 5AK2A 5E15A 1UOMA 3B0RA 3VJIA 1Z95A 2VV4B 3VT3A 4MG8B 4J5XC 3L1BA 2AX6A 5DVVA 3UP3A 1HJ1A 1X7RA 4Q0AC 1YA3A 2Q6JA 3H52A 4G1ZA 1ZH7A 3ADWA 1XJ7A 3CS6A 4OKWA 3VRVA 3VT6A 1YOWA 1FM9A 2ZKCA 3RLJA 2IHQA 3JZBA 4OFRA 1LV2A 4PWLA 2R6YA 2ZY0A 4MGDA 4YT1A 2XYXA 2VSTA 3VSPA 1L2JA 2QW4A 4MGDB 4ZI1A 3ILZA 1EREA 4RZFA 1R6GA 3AFRA 2H79A 3VI8A 3ET3A 3W5QA 1XZXX 4Q13A 5DV3A 2VSRA 3W0AA 3W0YA 3OS9A 5KCEA 1PQCA 2PIVA 3PO9A 4N1YA 4NB6A 3R29A 3D6DA 3CDSA 2JF9A 4N8RA 4QM0A 3V9VA 2PIWA 3VSOA 4YMQA 5KCFA 1SQNA 4FHIA 1XV9B 1X78A 3R5MA 1YP0A 4IWFA 5AZVA 1ZDTA 3H0AD 3OLLA 1LBDA 5K13A 2GTKA 5DXBA 1I38A 1P8DA 3AUNA 2B50A 3LMPA 3R8AA 3W0GA 4EMAA 4UDDA 3KFCA 1R20A 3D5FA 5DXBB 3KYTA 5DYBA 4PPSA 5H1EA 2QGWA 5CJ6A 2O4RA 3OMMA 5KCUA 4XI3A 2NXXA 5APKA 1MV9A 5AWJA 5HYKA 2HWRA 2P7AA 5DX3A 2ZASA 3DT3A 5B41A 5DL4A 3IPSA 4OHAA 4DQMA 2YHDA 1NYXA 2R40D 5GT4A 2YLYA 3FXVA 3KMGA 5DX3B 3SP9A 3OLSA 1XQCA 4PP6A 3W0JA 3O1DA 4E4KA 2OZ7A 4IA1A 5E0XA 3W5PA 1NQ1A 2QA8A 1IE8A 2G44A 5DUGA 1MVCA 5G5WA 5DY8A 3OGTA 4A2JA 4IA2A 5AAVB 3P88A 4MGAA 4PXMA 4J26A 2Q1VA 4QE6A 1I7IA 2Q5GA 4LNXA 3HVLA 4MGAB 5DUHA 3WFGA 3R2AA 1X7JA 5IXKA 5KCDA 2AB2A 4ONIA 4WPFA 2GPUA 3GD2A 3L0LA 2PIRA 1GWXA 1X7EA 4OARA 4XTAA 5DIDA 3W0IA 2QA6A 1PDUA 2QMVA 2AX9A 2HWQA 2V0VA 2YLPA 2ABIA 3DR1A 1RKGA 4J5XA 4N5GA 3WWRA 3B0TA 3EYBA 3NSPA 3FLIA 1FM6D 3GBKA 4OKTA 4OLMA 5KCWA 4R06A 1A52A 4L98A 4UDBA 1YINA 4OK1A 3OKIA 2Q61A 4R6SA 4ZN7A 1ILGA 3DCUA 3HLVA 4FN9A 3GZ9A 2ZK2A 3A78A 3OAPA 5HJSA 3ZRBA 5DKGA 5AAUA 3W0HA 3UP0A 3DZYD 3B65A 4IVWA 4IVYA 4LBDA 5KRAA 4G20A 4IV2A 1K74A 1PQ6A 1S19A 3OZJA 3WT6A 4POJA 2ZXZA 4G2IA 1ZAFA 3KMZA 2OVMA 5G3JA 5DV6A 1QKTA 3G8OA 5DSHA 2Q3YA 3FALA 4PLDA 2FVJA 5JJMA 1ZUCA 4F9MA 3W5TA 2ZK1A 3FALB 4ZO1B 5HJPB 4MDDA 5EJVA 1XLSA 1XDKB 4XHDA 2NPAA 2PNUA 5AVIA 2HCDA 4WVDA 3VN2A 4DK8A 2QE4A 4IWCA 4IA3A 4PP5A 3VTDA 4J5WC 1R5KA 5G46A 4OC7A 5KRFA 3UUDA 4MGBA 3AZ2A 2HB7A 3OLFA 5KD9A 2HVCA 5DZ1A 2PIOA 1XOWA 5DXPA 4RAKA 2GPPA 2HAMA 3IPQA 3V3QA 3X36A 2Z4BA 3RUUA 1OVLB 4LSJA 2EWPA 1MZNA 4IS8A 3CJWA 3IPUA 5DU5A 4RWVA 3V3EA 3W5RA 4IW6A 1R1KA 3FUGA 4QE8A 4QL8A 3ERDA 2G5OA 2QGTA 4NQAB 4OEAA 4JYIA 2XHSA 1T7MA 5L7HA 2J7YA 2XKWA 3JZCA 2Q6SA 4KZJA 4APUA 1HG4A 5EHJA 2P1VA 4OFUA 4RUPA 2P1TA 3B68A 4Y29A 3CS4A 3OMPA 1M7WA 2HC4A 2I4JA 5FQTA 1OSVA 4TUZA 5LGAA 3LBDA 3VHWA 4OJ9A 3PBAA 2R6WA 1EXXA 3ADSA 1FM9D 2GPVA 2QNVA 4TUZB 5C4UA 1T7RA 3MNPA 1BSXA 4IW8A 2ZLCA 1FBYA 1RK3A 3R5NA 5DRJA 3O1EA 2Q7JA 1I37A 4RUOX 4RMCA 3E00D 3HM1A 3TKCA 1YYEA 1NUOA 4PRGA 5DXRA 3NOAA 3B66A 4S15A 2GPOA 1T7TA 3UVVA 4ZN9A 1M2ZA 5G44A 2ACLA 3DY6A 3K22A 5FQSA 3UVVB 3GWSX 4IV4A 1N46A 2E2RA 3G8IA 5JI0D 1ZEOA 2ACLB 5E0WA 4WHFA 2QABA 5ETHA 3VRTA 4OEYA 2PJLA 3X1HA 2Q5SA 1DKFA 5DKBA 4RE8A 5DVSA 3E7CA 5C4OA 5FQPA 1GWRA 2PIXA 5KRLA 2ATHA 3KDUA 3HC6A 5DUEA 3P0UA 3V9TA 2QSEA 4G1DA 5EGVA 2PIUA 4ITEA 1E3GA 1ZDUA 3WT5A 3L03A 4M8EA 3TKMA 1R20D 4P6XA 2AA5A 3W0CA 5APJA 1XVPA 1KV6A 4RMEA 4MG6A 4JAZA 1SKXA 5DMCA 2HARA 3AN4A 3WJ4A 2PINA 5KRCA 3OMQA 4PLEA 4WHGA 3RLLA 1NDEA 3PEQA 3P89A 1KNUA 2XYJA 3A9EA 3OSAA 1SJ0A 4J5WA 2O4JA 3VT9A 3A9EB 4WQPA 4CI5A 3KBAA 3VJTA 2OAXA 4XUHA 4DORA 1T63A 2Q7LA 2ZNPA 3AURA 3P8XA 3ADUA 1OT7A 3KMRA 4HLWA 2AXAA 3B5RA 3IMYA 3KDTA 2AAXA 4KZIA 5C4TA 2XYWA 2QA8B 2HASA 3OOKA 4G2HA 3U9QA 3F5CA 5DK9A 5G45A 5DKEA 2LBDA 1G2NA 1IE9A 1S9QA 1PQ9A 3F5CB 3B1MA 2R40A 3FEIA 3OOFA 4XAOA 2AX8A 1Y0XX 2I0GA 3CDPA 3ADXA 2PIPL 2PIQA 2G0HA 2B23A 1XPCA 2NXXE 2P54A 4MG9A 4DM6A 2YLOA 3DZUD 3UUAA 3VRWA
chains in the Genus database with same CATH topology
5I4VA 1G50A 1XB7A 3OZ0A 3B0QA 4MG9B 3V49A 3UUAB 3BEJA 4NY9A 5AVLA 3IXPD 2ZNNA 1OSHA 1Z5XU 1NHZA 2YATA 1NAXA 5M96A 2JFAA 1T74A 2YLQA 2Q8SA 2YJDA 3CLDA 3CS8A 2JFAB 5DWJA 5HCVA 2I4ZA 5L7GA 1PZLA 2HB8A 2QXMA 5DP0A 2NW4A 4PP3A 3VJSA 5HZCA 3FURA 4KZMA 5KRJA 2ZLAA 1NQ7A 2AA7A 4K4JA 3VT4A 5DIGA 5HYRA 5JJMB 1UHLA 3A3ZX 3DZYA 2P15A 1XNNA 4OIUA 4RZGA 4S14A 5DXKA 4ZJRA 1UPVA 5DXMA 4IQRA 5KYAA 1KKQA 4LNWA 4ZNTA 4ZNVA 3BC5A 4OIVA 3AZ1A 3WFFA 5KCTA 3OS8C 3WT7A 3V9YA 3PRGA 1VJBA 1N83A 4MGBB 3UUDB 3VJHA 1M13A 3CQVA 3FC6A 3S9SA 5SYZA 1RDTA 4DOSA 5AYGA 2BAWA 5FQVA 4M8HA 4NUFA 5EI1A 2ZMIA 2NV7A 2P4YA 4IA7A 4MG5A 4UDCA 1Q4XA 2Q70A 1A28A 2HFPA 2VV0A 4QJRA 5F9BA 1NQ2A 3X1IA 5JY3A 4N73A 3D90A 5EITA 4ZNSA 5DXGA 1XAPA 3TX7B 3VT8A 3A2JA 2P7GA 4S0TA 2G0GA 1R1KD 3R8IA 4PPPA 3VTCA 2P7ZA 5KR9A 3AUQA 1NQ0A 3TY0A 1T79A 4JYGA 2JJ3A 2ZK6A 1I7GA 3D24A 2POBA 4FHHA 2PRGA 5KRHA 2I0JA 5ACCA 2A3IA 3N00A 1XLSE 3L3XA 2YFEA 5DI7A 4ZJWA 1XQ3A 4RFWA 5DXEA 3UU7A 4RMDA 1YIMA 1U3RA 4DM8A 4UDAA 5DYDA 3WTQA 2QTUA 4IUIA 4QK4A 3UU7B 1FCYA 1X76A 3OMKA 3RY9A 4TV1A 1XNXA 3G0WA 1XIUA 4OH6A 4YNKA 1G1UA 2GL8A 1YOKA 3L3ZA 4MG7A 2VV4A 3M7RA 1K4WA 1K7LA 1XP1A 5KCCA 3OKHA 4L96A 1PRGA 4MG7B 3VT7A 2Z4JA 5DV8A 1U9EA 2V7CA 4ZNWA 3OSWA 2GWXA 4FGYA 1QKNA 2AWHA 3FEJA 2OUZA 1X7BA 2ZNOA 5KROA 3GYUA 2B1VA 1FCZA 1RJKA 1ILHA 2HBHA 2AMBA 3KWYA 1XP9A 2QR9A 1DB1A 2OVHA 3HZFA 1Z5XE 1GWQA 4XLDA 3NSQA 4HEEX 1QKMA 2REWA 2ZXNA 3HQ5A 1DKFB 2P1UA 3E00A 2Q6RA 5DWIA 5DWLA 2ZK5A 3FS1A 3BQDA 4G21A 4IU7A 5APHA 4JL4A 4JYHA 5L7EA 1H9UA 3GN8A 2Q5PA 1U3QA 1XP6A 1S0ZA 5E7VA 3RUTA 3D57A 5B5BA 1U3SA 3SZ1A 1T73A 3PCUA 4WLBA 3OMOA 4YPQA 3L0EA 1XVPB 4OH5A 3V4AA 5KRKA 1RKHA 4A4WA 1PCGA 1XV9A 4RUJA 2ZMHA 4ITFA 2AA6A 4BCRA 4E4QA 5DLRA 3K8SA 3VTBA 2IOKA 3E94A 4ZNUA 3H0AA 4B7WA 2OM9A 3L0JA 3HODA 4FNEA 2VV2A 1TFCA 2ZMJA 3OS8A 4O8FA 1S9PA 4ZO1X 4OZRU 2B1ZA 3B67A 4NIEA 3G9EA 4LTWA 5E14A 2W8YA 3DCTA 3HC5A 4XT9A 3QT0A 5DIEA 4OZTU 2QZOA 3WGPA 1E3KA 1P93A 3OSIA 3B0WA 5FQRA 2VV1A 5DWGA 5IAWA 5E19A 1YY4A 3WJ5A 2QZOB 3GWXA 3ET1A 2ZFXA 1YJEA 3R8DA 2ZK4A 2VV1B 5G42A 3T03A 3WMHA 5DRMA 3KPZA 5DXQA 3ET2A 4A4VA 4MGCA 2OCFA 2O9IA 3GYTA 2GIUA 1WM0X 2ZNQA 5IZ0A 1TXIA 1L2IA 2AM9A 5DZIA 5G43A 5ICKA 3A40X 3ERTA 1SR7A 2AO6A 5AAVA 1FCXA 5E1CA 1T7FA 1NAVA 3HO0A 3DZUA 2QH6A 4DK7A 3A2IA 3CTBA 2AA2A 4PF3A 4DMAA 1T5ZA 4CSJA 1T65A 4OJ4A 5DZHA 2I4PA 4JGVA 3K23A 5C4SA 1GS4A 5DTVA 2GP7A 1K74D 2ZVTA 4REFA 3ZQTA 2Q1HA 4OILA 5DWEA 2FSZA 4R2UA 1N4HA 1FM6A 1EXAA 1S0XA 3ADTA 1ZGYA 4G1YA 4P6WA 1YMTA 2J4AA 2IOGA 3IXPA 5AZTA 5KYJA 4ZNHA 3Q95A 4OJBA 3PLZA 1UPWA 2Q60A 3SP6A 3RVFA 2AYRA 4OEZA 5GIEA 1UHLB 1YUCA 5KRMA 4CI4A 3Q95B 1G5YA 3ADVA 4S0SA 5DVCA 4OGHA 1FD0A 4POHA 2ZK0A 3ET0A 4REEA 3VHUA 3K6PA 3MNOA 4K6IA 2PKLA 2VV3A 4Q50A 3IA6A 1Y9RA 5DMFA 1RDTD 2ZL9A 3FC6B 4OEDA 5HJPA 5GIDA 4EM9A 2BJ4A 1XDKA 2Q59A 3B3KA 1NRLA 4ZOMA 3VT5A 5L11A 5LWPA 4K7AA 5DKSA 5A86A 3VRUA 3ZRAA 1QKUA 2J14A 2BJ4B 2H77A 3AN3A 4XUMA 5EC9A 2Q59B 4X1GA 4OKBA 4X1FA 5DZ3A 2AX7A 2POGA 1Y0SA 3AZ3A 2ZK3A 4RZEA 3ZR7A 5GICA 3X31A 1ERRA 2YJAB 3CWDA 1OVLA 2AMAA 2ZBSA 3VHVA 2PITA 4PVUA 2F4BA 5DZ0A 3MNEA 1ZKYA 4OZRE 3UUCA 2Q7IA 2QPYA 3AX8A 3F7DA 2FAIA 2J7XA 2ZXMA 5AWKA 1PK5A 4OKXA 4OZTE 4TV1B 3A2HA 4J24A 4E2JA 2QXSA 1T76A 4MG8A 5KRIA 2Q7KA 5AK2A 5E15A 1UOMA 3B0RA 3VJIA 1Z95A 2VV4B 3VT3A 4MG8B 4J5XC 3L1BA 2AX6A 5DVVA 3UP3A 1HJ1A 1X7RA 4Q0AC 1YA3A 2Q6JA 3H52A 4G1ZA 1ZH7A 3ADWA 1XJ7A 3CS6A 4OKWA 3VRVA 3VT6A 1YOWA 1FM9A 2ZKCA 3RLJA 2IHQA 3JZBA 4OFRA 1LV2A 4PWLA 2R6YA 2ZY0A 4MGDA 4YT1A 2XYXA 2VSTA 3VSPA 1L2JA 2QW4A 4MGDB 4ZI1A 3ILZA 1EREA 4RZFA 1R6GA 3AFRA 2H79A 3VI8A 3ET3A 3W5QA 1XZXX 4Q13A 5DV3A 2VSRA 3W0AA 3W0YA 3OS9A 5KCEA 1PQCA 2PIVA 3PO9A 4N1YA 4NB6A 3R29A 3D6DA 3CDSA 2JF9A 4N8RA 4QM0A 3V9VA 2PIWA 3VSOA 4YMQA 5KCFA 1SQNA 4FHIA 1XV9B 1X78A 3R5MA 1YP0A 4IWFA 5AZVA 1ZDTA 3H0AD 3OLLA 1LBDA 5K13A 2GTKA 5DXBA 1I38A 1P8DA 3AUNA 2B50A 3LMPA 3R8AA 3W0GA 4EMAA 4UDDA 3KFCA 1R20A 3D5FA 5DXBB 3KYTA 5DYBA 4PPSA 5H1EA 2QGWA 5CJ6A 2O4RA 3OMMA 5KCUA 4XI3A 2NXXA 5APKA 1MV9A 5AWJA 5HYKA 2HWRA 2P7AA 5DX3A 2ZASA 3DT3A 5B41A 5DL4A 3IPSA 4OHAA 4DQMA 2YHDA 1NYXA 2R40D 5GT4A 2YLYA 3FXVA 3KMGA 5DX3B 3SP9A 3OLSA 1XQCA 4PP6A 3W0JA 3O1DA 4E4KA 2OZ7A 4IA1A 5E0XA 3W5PA 1NQ1A 2QA8A 1IE8A 2G44A 5DUGA 1MVCA 5G5WA 5DY8A 3OGTA 4A2JA 4IA2A 5AAVB 3P88A 4MGAA 4PXMA 4J26A 2Q1VA 4QE6A 1I7IA 2Q5GA 4LNXA 3HVLA 4MGAB 5DUHA 3WFGA 3R2AA 1X7JA 5IXKA 5KCDA 2AB2A 4ONIA 4WPFA 2GPUA 3GD2A 3L0LA 2PIRA 1GWXA 1X7EA 4OARA 4XTAA 5DIDA 3W0IA 2QA6A 1PDUA 2QMVA 2AX9A 2HWQA 2V0VA 2YLPA 2ABIA 3DR1A 1RKGA 4J5XA 4N5GA 3WWRA 3B0TA 3EYBA 3NSPA 3FLIA 1FM6D 3GBKA 4OKTA 4OLMA 5KCWA 4R06A 1A52A 4L98A 4UDBA 1YINA 4OK1A 3OKIA 2Q61A 4R6SA 4ZN7A 1ILGA 3DCUA 3HLVA 4FN9A 3GZ9A 2ZK2A 3A78A 3OAPA 5HJSA 3ZRBA 5DKGA 5AAUA 3W0HA 3UP0A 3DZYD 3B65A 4IVWA 4IVYA 4LBDA 5KRAA 4G20A 4IV2A 1K74A 1PQ6A 1S19A 3OZJA 3WT6A 4POJA 2ZXZA 4G2IA 1ZAFA 3KMZA 2OVMA 5G3JA 5DV6A 1QKTA 3G8OA 5DSHA 2Q3YA 3FALA 4PLDA 2FVJA 5JJMA 1ZUCA 4F9MA 3W5TA 2ZK1A 3FALB 4ZO1B 5HJPB 4MDDA 5EJVA 1XLSA 1XDKB 4XHDA 2NPAA 2PNUA 5AVIA 2HCDA 4WVDA 3VN2A 4DK8A 2QE4A 4IWCA 4IA3A 4PP5A 3VTDA 4J5WC 1R5KA 5G46A 4OC7A 5KRFA 3UUDA 4MGBA 3AZ2A 2HB7A 3OLFA 5KD9A 2HVCA 5DZ1A 2PIOA 1XOWA 5DXPA 4RAKA 2GPPA 2HAMA 3IPQA 3V3QA 3X36A 2Z4BA 3RUUA 1OVLB 4LSJA 2EWPA 1MZNA 4IS8A 3CJWA 3IPUA 5DU5A 4RWVA 3V3EA 3W5RA 4IW6A 1R1KA 3FUGA 4QE8A 4QL8A 3ERDA 2G5OA 2QGTA 4NQAB 4OEAA 4JYIA 2XHSA 1T7MA 5L7HA 2J7YA 2XKWA 3JZCA 2Q6SA 4KZJA 4APUA 1HG4A 5EHJA 2P1VA 4OFUA 4RUPA 2P1TA 3B68A 4Y29A 3CS4A 3OMPA 1M7WA 2HC4A 2I4JA 5FQTA 1OSVA 4TUZA 5LGAA 3LBDA 3VHWA 4OJ9A 3PBAA 2R6WA 1EXXA 3ADSA 1FM9D 2GPVA 2QNVA 4TUZB 5C4UA 1T7RA 3MNPA 1BSXA 4IW8A 2ZLCA 1FBYA 1RK3A 3R5NA 5DRJA 3O1EA 2Q7JA 1I37A 4RUOX 4RMCA 3E00D 3HM1A 3TKCA 1YYEA 1NUOA 4PRGA 5DXRA 3NOAA 3B66A 4S15A 2GPOA 1T7TA 3UVVA 4ZN9A 1M2ZA 5G44A 2ACLA 3DY6A 3K22A 5FQSA 3UVVB 3GWSX 4IV4A 1N46A 2E2RA 3G8IA 5JI0D 1ZEOA 2ACLB 5E0WA 4WHFA 2QABA 5ETHA 3VRTA 4OEYA 2PJLA 3X1HA 2Q5SA 1DKFA 5DKBA 4RE8A 5DVSA 3E7CA 5C4OA 5FQPA 1GWRA 2PIXA 5KRLA 2ATHA 3KDUA 3HC6A 5DUEA 3P0UA 3V9TA 2QSEA 4G1DA 5EGVA 2PIUA 4ITEA 1E3GA 1ZDUA 3WT5A 3L03A 4M8EA 3TKMA 1R20D 4P6XA 2AA5A 3W0CA 5APJA 1XVPA 1KV6A 4RMEA 4MG6A 4JAZA 1SKXA 5DMCA 2HARA 3AN4A 3WJ4A 2PINA 5KRCA 3OMQA 4PLEA 4WHGA 3RLLA 1NDEA 3PEQA 3P89A 1KNUA 2XYJA 3A9EA 3OSAA 1SJ0A 4J5WA 2O4JA 3VT9A 3A9EB 4WQPA 4CI5A 3KBAA 3VJTA 2OAXA 4XUHA 4DORA 1T63A 2Q7LA 2ZNPA 3AURA 3P8XA 3ADUA 1OT7A 3KMRA 4HLWA 2AXAA 3B5RA 3IMYA 3KDTA 2AAXA 4KZIA 5C4TA 2XYWA 2QA8B 2HASA 3OOKA 4G2HA 3U9QA 3F5CA 5DK9A 5G45A 5DKEA 2LBDA 1G2NA 1IE9A 1S9QA 1PQ9A 3F5CB 3B1MA 2R40A 3FEIA 3OOFA 4XAOA 2AX8A 1Y0XX 2I0GA 3CDPA 3ADXA 2PIPL 2PIQA 2G0HA 2B23A 1XPCA 2NXXE 2P54A 4MG9A 4DM6A 2YLOA 3DZUD 3UUAA 3VRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I4V A;  1G50 A;  1XB7 A;  3OZ0 A;  3B0Q A;  4MG9 B;  3V49 A;  3UUA B;  3BEJ A;  4NY9 A;  5AVL A;  3IXP D;  2ZNN A;  1OSH A;  1Z5X U;  1NHZ A;  2YAT A;  1NAX A;  5M96 A;  2JFA A;  1T74 A;  2YLQ A;  2Q8S A;  2YJD A;  3CLD A;  3CS8 A;  2JFA B;  5DWJ A;  5HCV A;  2I4Z A;  5L7G A;  1PZL A;  2HB8 A;  2QXM A;  5DP0 A;  2NW4 A;  4PP3 A;  3VJS A;  5HZC A;  3FUR A;  4KZM A;  5KRJ A;  2ZLA A;  1NQ7 A;  2AA7 A;  4K4J A;  3VT4 A;  5DIG A;  5HYR A;  5JJM B;  1UHL A;  3A3Z X;  3DZY A;  2P15 A;  1XNN A;  4OIU A;  4RZG A;  4S14 A;  5DXK A;  4ZJR A;  1UPV A;  5DXM A;  4IQR A;  5KYA A;  1KKQ A;  4LNW A;  4ZNT A;  4ZNV A;  3BC5 A;  4OIV A;  3AZ1 A;  3WFF A;  5KCT A;  3OS8 C;  3WT7 A;  3V9Y A;  3PRG A;  1VJB A;  1N83 A;  4MGB B;  3UUD B;  3VJH A;  1M13 A;  3CQV A;  3FC6 A;  3S9S A;  5SYZ A;  1RDT A;  4DOS A;  5AYG A;  2BAW A;  5FQV A;  4M8H A;  4NUF A;  5EI1 A;  2ZMI A;  2NV7 A;  2P4Y A;  4IA7 A;  4MG5 A;  4UDC A;  1Q4X A;  2Q70 A;  1A28 A;  2HFP A;  2VV0 A;  4QJR A;  5F9B A;  1NQ2 A;  3X1I A;  5JY3 A;  4N73 A;  3D90 A;  5EIT A;  4ZNS A;  5DXG A;  1XAP A;  3TX7 B;  3VT8 A;  3A2J A;  2P7G A;  4S0T A;  2G0G A;  1R1K D;  3R8I A;  4PPP A;  3VTC A;  2P7Z A;  5KR9 A;  3AUQ A;  1NQ0 A;  3TY0 A;  1T79 A;  4JYG A;  2JJ3 A;  2ZK6 A;  1I7G A;  3D24 A;  2POB A;  4FHH A;  2PRG A;  5KRH A;  2I0J A;  5ACC A;  2A3I A;  3N00 A;  1XLS E;  3L3X A;  2YFE A;  5DI7 A;  4ZJW A;  1XQ3 A;  4RFW A;  5DXE A;  3UU7 A;  4RMD A;  1YIM A;  1U3R A;  4DM8 A;  4UDA A;  5DYD A;  3WTQ A;  2QTU A;  4IUI A;  4QK4 A;  3UU7 B;  1FCY A;  1X76 A;  3OMK A;  3RY9 A;  4TV1 A;  1XNX A;  3G0W A;  1XIU A;  4OH6 A;  4YNK A;  1G1U A;  2GL8 A;  1YOK A;  3L3Z A;  4MG7 A;  2VV4 A;  3M7R A;  1K4W A;  1K7L A;  1XP1 A;  5KCC A;  3OKH A;  4L96 A;  1PRG A;  4MG7 B;  3VT7 A;  2Z4J A;  5DV8 A;  1U9E A;  2V7C A;  4ZNW A;  3OSW A;  2GWX A;  4FGY A;  1QKN A;  2AWH A;  3FEJ A;  2OUZ A;  1X7B A;  2ZNO A;  5KRO A;  3GYU A;  2B1V A;  1FCZ A;  1RJK A;  1ILH A;  2HBH A;  2AMB A;  3KWY A;  1XP9 A;  2QR9 A;  1DB1 A;  2OVH A;  3HZF A;  1Z5X E;  1GWQ A;  4XLD A;  3NSQ A;  4HEE X;  1QKM A;  2REW A;  2ZXN A;  3HQ5 A;  1DKF B;  2P1U A;  3E00 A;  2Q6R A;  5DWI A;  5DWL A;  2ZK5 A;  3FS1 A;  3BQD A;  4G21 A;  4IU7 A;  5APH A;  4JL4 A;  4JYH A;  5L7E A;  1H9U A;  3GN8 A;  2Q5P A;  1U3Q A;  1XP6 A;  1S0Z A;  5E7V A;  3RUT A;  3D57 A;  5B5B A;  1U3S A;  3SZ1 A;  1T73 A;  3PCU A;  4WLB A;  3OMO A;  4YPQ A;  3L0E A;  1XVP B;  4OH5 A;  3V4A A;  5KRK A;  1RKH A;  4A4W A;  1PCG A;  1XV9 A;  4RUJ A;  2ZMH A;  4ITF A;  2AA6 A;  4BCR A;  4E4Q A;  5DLR A;  3K8S A;  3VTB A;  2IOK A;  3E94 A;  4ZNU A;  3H0A A;  4B7W A;  2OM9 A;  3L0J A;  3HOD A;  4FNE A;  2VV2 A;  1TFC A;  2ZMJ A;  3OS8 A;  4O8F A;  1S9P A;  4ZO1 X;  4OZR U;  2B1Z A;  3B67 A;  4NIE A;  3G9E A;  4LTW A;  5E14 A;  2W8Y A;  3DCT A;  3HC5 A;  4XT9 A;  3QT0 A;  5DIE A;  4OZT U;  2QZO A;  3WGP A;  1E3K A;  1P93 A;  3OSI A;  3B0W A;  5FQR A;  2VV1 A;  5DWG A;  5IAW A;  5E19 A;  1YY4 A;  3WJ5 A;  2QZO B;  3GWX A;  3ET1 A;  2ZFX A;  1YJE A;  3R8D A;  2ZK4 A;  2VV1 B;  5G42 A;  3T03 A;  3WMH A;  5DRM A;  3KPZ A;  5DXQ A;  3ET2 A;  4A4V A;  4MGC A;  2OCF A;  2O9I A;  3GYT A;  2GIU A;  1WM0 X;  2ZNQ A;  5IZ0 A;  1TXI A;  1L2I A;  2AM9 A;  5DZI A;  5G43 A;  5ICK A;  3A40 X;  3ERT A;  1SR7 A;  2AO6 A;  5AAV A;  1FCX A;  5E1C A;  1T7F A;  1NAV A;  3HO0 A;  3DZU A;  2QH6 A;  4DK7 A;  3A2I A;  3CTB A;  2AA2 A;  4PF3 A;  4DMA A;  1T5Z A;  4CSJ A;  1T65 A;  4OJ4 A;  5DZH A;  2I4P A;  4JGV A;  3K23 A;  5C4S A;  1GS4 A;  5DTV A;  2GP7 A;  1K74 D;  2ZVT A;  4REF A;  3ZQT A;  2Q1H A;  4OIL A;  5DWE A;  2FSZ A;  4R2U A;  1N4H A;  1FM6 A;  1EXA A;  1S0X A;  3ADT A;  1ZGY A;  4G1Y A;  4P6W A;  1YMT A;  2J4A A;  2IOG A;  3IXP A;  5AZT A;  5KYJ A;  4ZNH A;  3Q95 A;  4OJB A;  3PLZ A;  1UPW A;  2Q60 A;  3SP6 A;  3RVF A;  2AYR A;  4OEZ A;  5GIE A;  1UHL B;  1YUC A;  5KRM A;  4CI4 A;  3Q95 B;  1G5Y A;  3ADV A;  4S0S A;  5DVC A;  4OGH A;  1FD0 A;  4POH A;  2ZK0 A;  3ET0 A;  4REE A;  3VHU A;  3K6P A;  3MNO A;  4K6I A;  2PKL A;  2VV3 A;  4Q50 A;  3IA6 A;  1Y9R A;  5DMF A;  1RDT D;  2ZL9 A;  3FC6 B;  4OED A;  5HJP A;  5GID A;  4EM9 A;  2BJ4 A;  1XDK A;  2Q59 A;  3B3K A;  1NRL A;  4ZOM A;  3VT5 A;  5L11 A;  5LWP A;  4K7A A;  5DKS A;  5A86 A;  3VRU A;  3ZRA A;  1QKU A;  2J14 A;  2BJ4 B;  2H77 A;  3AN3 A;  4XUM A;  5EC9 A;  2Q59 B;  4X1G A;  4OKB A;  4X1F A;  5DZ3 A;  2AX7 A;  2POG A;  1Y0S A;  3AZ3 A;  2ZK3 A;  4RZE A;  3ZR7 A;  5GIC A;  3X31 A;  1ERR A;  2YJA B;  3CWD A;  1OVL A;  2AMA A;  2ZBS A;  3VHV A;  2PIT A;  4PVU A;  2F4B A;  5DZ0 A;  3MNE A;  1ZKY A;  4OZR E;  3UUC A;  2Q7I A;  2QPY A;  3AX8 A;  3F7D A;  2FAI A;  2J7X A;  2ZXM A;  5AWK A;  1PK5 A;  4OKX A;  4OZT E;  4TV1 B;  3A2H A;  4J24 A;  4E2J A;  2QXS A;  1T76 A;  4MG8 A;  5KRI A;  2Q7K A;  5AK2 A;  5E15 A;  1UOM A;  3B0R A;  3VJI A;  1Z95 A;  2VV4 B;  3VT3 A;  4MG8 B;  4J5X C;  3L1B A;  2AX6 A;  5DVV A;  3UP3 A;  1HJ1 A;  1X7R A;  4Q0A C;  1YA3 A;  2Q6J A;  3H52 A;  4G1Z A;  1ZH7 A;  3ADW A;  1XJ7 A;  3CS6 A;  4OKW A;  3VRV A;  3VT6 A;  1YOW A;  1FM9 A;  2ZKC A;  3RLJ A;  2IHQ A;  3JZB A;  4OFR A;  1LV2 A;  4PWL A;  2R6Y A;  2ZY0 A;  4MGD A;  4YT1 A;  2XYX A;  2VST A;  3VSP A;  1L2J A;  2QW4 A;  4MGD B;  4ZI1 A;  3ILZ A;  1ERE A;  4RZF A;  1R6G A;  3AFR A;  2H79 A;  3VI8 A;  3ET3 A;  3W5Q A;  1XZX X;  4Q13 A;  5DV3 A;  2VSR A;  3W0A A;  3W0Y A;  3OS9 A;  5KCE A;  1PQC A;  2PIV A;  3PO9 A;  4N1Y A;  4NB6 A;  3R29 A;  3D6D A;  3CDS A;  2JF9 A;  4N8R A;  4QM0 A;  3V9V A;  2PIW A;  3VSO A;  4YMQ A;  5KCF A;  1SQN A;  4FHI A;  1XV9 B;  1X78 A;  3R5M A;  1YP0 A;  4IWF A;  5AZV A;  1ZDT A;  3H0A D;  3OLL A;  1LBD A;  5K13 A;  2GTK A;  5DXB A;  1I38 A;  1P8D A;  3AUN A;  2B50 A;  3LMP A;  3R8A A;  3W0G A;  4EMA A;  4UDD A;  3KFC A;  1R20 A;  3D5F A;  5DXB B;  3KYT A;  5DYB A;  4PPS A;  5H1E A;  2QGW A;  5CJ6 A;  2O4R A;  3OMM A;  5KCU A;  4XI3 A;  2NXX A;  5APK A;  1MV9 A;  5AWJ A;  5HYK A;  2HWR A;  2P7A A;  5DX3 A;  2ZAS A;  3DT3 A;  5B41 A;  5DL4 A;  3IPS A;  4OHA A;  4DQM A;  2YHD A;  1NYX A;  2R40 D;  5GT4 A;  2YLY A;  3FXV A;  3KMG A;  5DX3 B;  3SP9 A;  3OLS A;  1XQC A;  4PP6 A;  3W0J A;  3O1D A;  4E4K A;  2OZ7 A;  4IA1 A;  5E0X A;  3W5P A;  1NQ1 A;  2QA8 A;  1IE8 A;  2G44 A;  5DUG A;  1MVC A;  5G5W A;  5DY8 A;  3OGT A;  4A2J A;  4IA2 A;  5AAV B;  3P88 A;  4MGA A;  4PXM A;  4J26 A;  2Q1V A;  4QE6 A;  1I7I A;  2Q5G A;  4LNX A;  3HVL A;  4MGA B;  5DUH A;  3WFG A;  3R2A A;  1X7J A;  5IXK A;  5KCD A;  2AB2 A;  4ONI A;  4WPF A;  2GPU A;  3GD2 A;  3L0L A;  2PIR A;  1GWX A;  1X7E A;  4OAR A;  4XTA A;  5DID A;  3W0I A;  2QA6 A;  1PDU A;  2QMV A;  2AX9 A;  2HWQ A;  2V0V A;  2YLP A;  2ABI A;  3DR1 A;  1RKG A;  4J5X A;  4N5G A;  3WWR A;  3B0T A;  3EYB A;  3NSP A;  3FLI A;  1FM6 D;  3GBK A;  4OKT A;  4OLM A;  5KCW A;  4R06 A;  1A52 A;  4L98 A;  4UDB A;  1YIN A;  4OK1 A;  3OKI A;  2Q61 A;  4R6S A;  4ZN7 A;  1ILG A;  3DCU A;  3HLV A;  4FN9 A;  3GZ9 A;  2ZK2 A;  3A78 A;  3OAP A;  5HJS A;  3ZRB A;  5DKG A;  5AAU A;  3W0H A;  3UP0 A;  3DZY D;  3B65 A;  4IVW A;  4IVY A;  4LBD A;  5KRA A;  4G20 A;  4IV2 A;  1K74 A;  1PQ6 A;  1S19 A;  3OZJ A;  3WT6 A;  4POJ A;  2ZXZ A;  4G2I A;  1ZAF A;  3KMZ A;  2OVM A;  5G3J A;  5DV6 A;  1QKT A;  3G8O A;  5DSH A;  2Q3Y A;  3FAL A;  4PLD A;  2FVJ A;  5JJM A;  1ZUC A;  4F9M A;  3W5T A;  2ZK1 A;  3FAL B;  4ZO1 B;  5HJP B;  4MDD A;  5EJV A;  1XLS A;  1XDK B;  4XHD A;  2NPA A;  2PNU A;  5AVI A;  2HCD A;  4WVD A;  3VN2 A;  4DK8 A;  2QE4 A;  4IWC A;  4IA3 A;  4PP5 A;  3VTD A;  4J5W C;  1R5K A;  5G46 A;  4OC7 A;  5KRF A;  3UUD A;  4MGB A;  3AZ2 A;  2HB7 A;  3OLF A;  5KD9 A;  2HVC A;  5DZ1 A;  2PIO A;  1XOW A;  5DXP A;  4RAK A;  2GPP A;  2HAM A;  3IPQ A;  3V3Q A;  3X36 A;  2Z4B A;  3RUU A;  1OVL B;  4LSJ A;  2EWP A;  1MZN A;  4IS8 A;  3CJW A;  3IPU A;  5DU5 A;  4RWV A;  3V3E A;  3W5R A;  4IW6 A;  1R1K A;  3FUG A;  4QE8 A;  4QL8 A;  3ERD A;  2G5O A;  2QGT A;  4NQA B;  4OEA A;  4JYI A;  2XHS A;  1T7M A;  5L7H A;  2J7Y A;  2XKW A;  3JZC A;  2Q6S A;  4KZJ A;  4APU A;  1HG4 A;  5EHJ A;  2P1V A;  4OFU A;  4RUP A;  2P1T A;  3B68 A;  4Y29 A;  3CS4 A;  3OMP A;  1M7W A;  2HC4 A;  2I4J A;  5FQT A;  1OSV A;  4TUZ A;  5LGA A;  3LBD A;  3VHW A;  4OJ9 A;  3PBA A;  2R6W A;  1EXX A;  3ADS A;  1FM9 D;  2GPV A;  2QNV A;  4TUZ B;  5C4U A;  1T7R A;  3MNP A;  1BSX A;  4IW8 A;  2ZLC A;  1FBY A;  1RK3 A;  3R5N A;  5DRJ A;  3O1E A;  2Q7J A;  1I37 A;  4RUO X;  4RMC A;  3E00 D;  3HM1 A;  3TKC A;  1YYE A;  1NUO A;  4PRG A;  5DXR A;  3NOA A;  3B66 A;  4S15 A;  2GPO A;  1T7T A;  3UVV A;  4ZN9 A;  1M2Z A;  5G44 A;  2ACL A;  3DY6 A;  3K22 A;  5FQS A;  3UVV B;  3GWS X;  4IV4 A;  1N46 A;  2E2R A;  3G8I A;  5JI0 D;  1ZEO A;  2ACL B;  5E0W A;  4WHF A;  2QAB A;  5ETH A;  3VRT A;  4OEY A;  2PJL A;  3X1H A;  2Q5S A;  1DKF A;  5DKB A;  4RE8 A;  5DVS A;  3E7C A;  5C4O A;  5FQP A;  1GWR A;  2PIX A;  5KRL A;  2ATH A;  3KDU A;  3HC6 A;  5DUE A;  3P0U A;  3V9T A;  2QSE A;  4G1D A;  5EGV A;  2PIU A;  4ITE A;  1E3G A;  1ZDU A;  3WT5 A;  3L03 A;  4M8E A;  3TKM A;  1R20 D;  4P6X A;  2AA5 A;  3W0C A;  5APJ A;  1XVP A;  1KV6 A;  4RME A;  4MG6 A;  4JAZ A;  1SKX A;  5DMC A;  2HAR A;  3AN4 A;  3WJ4 A;  2PIN A;  5KRC A;  3OMQ A;  4PLE A;  4WHG A;  3RLL A;  1NDE A;  3PEQ A;  3P89 A;  1KNU A;  2XYJ A;  3A9E A;  3OSA A;  1SJ0 A;  4J5W A;  2O4J A;  3VT9 A;  3A9E B;  4WQP A;  4CI5 A;  3KBA A;  3VJT A;  2OAX A;  4XUH A;  4DOR A;  1T63 A;  2Q7L A;  2ZNP A;  3AUR A;  3P8X A;  3ADU A;  1OT7 A;  3KMR A;  4HLW A;  2AXA A;  3B5R A;  3IMY A;  3KDT A;  2AAX A;  4KZI A;  5C4T A;  2XYW A;  2QA8 B;  2HAS A;  3OOK A;  4G2H A;  3U9Q A;  3F5C A;  5DK9 A;  5G45 A;  5DKE A;  2LBD A;  1G2N A;  1IE9 A;  1S9Q A;  1PQ9 A;  3F5C B;  3B1M A;  2R40 A;  3FEI A;  3OOF A;  4XAO A;  2AX8 A;  1Y0X X;  2I0G A;  3CDP A;  3ADX A;  2PIP L;  2PIQ A;  2G0H A;  2B23 A;  1XPC A;  2NXX E;  2P54 A;  4MG9 A;  4DM6 A;  2YLO A;  3DZU D;  3UUA A;  3VRW A; 
#chains in the Genus database with same CATH topology
 5I4V A;  1G50 A;  1XB7 A;  3OZ0 A;  3B0Q A;  4MG9 B;  3V49 A;  3UUA B;  3BEJ A;  4NY9 A;  5AVL A;  3IXP D;  2ZNN A;  1OSH A;  1Z5X U;  1NHZ A;  2YAT A;  1NAX A;  5M96 A;  2JFA A;  1T74 A;  2YLQ A;  2Q8S A;  2YJD A;  3CLD A;  3CS8 A;  2JFA B;  5DWJ A;  5HCV A;  2I4Z A;  5L7G A;  1PZL A;  2HB8 A;  2QXM A;  5DP0 A;  2NW4 A;  4PP3 A;  3VJS A;  5HZC A;  3FUR A;  4KZM A;  5KRJ A;  2ZLA A;  1NQ7 A;  2AA7 A;  4K4J A;  3VT4 A;  5DIG A;  5HYR A;  5JJM B;  1UHL A;  3A3Z X;  3DZY A;  2P15 A;  1XNN A;  4OIU A;  4RZG A;  4S14 A;  5DXK A;  4ZJR A;  1UPV A;  5DXM A;  4IQR A;  5KYA A;  1KKQ A;  4LNW A;  4ZNT A;  4ZNV A;  3BC5 A;  4OIV A;  3AZ1 A;  3WFF A;  5KCT A;  3OS8 C;  3WT7 A;  3V9Y A;  3PRG A;  1VJB A;  1N83 A;  4MGB B;  3UUD B;  3VJH A;  1M13 A;  3CQV A;  3FC6 A;  3S9S A;  5SYZ A;  1RDT A;  4DOS A;  5AYG A;  2BAW A;  5FQV A;  4M8H A;  4NUF A;  5EI1 A;  2ZMI A;  2NV7 A;  2P4Y A;  4IA7 A;  4MG5 A;  4UDC A;  1Q4X A;  2Q70 A;  1A28 A;  2HFP A;  2VV0 A;  4QJR A;  5F9B A;  1NQ2 A;  3X1I A;  5JY3 A;  4N73 A;  3D90 A;  5EIT A;  4ZNS A;  5DXG A;  1XAP A;  3TX7 B;  3VT8 A;  3A2J A;  2P7G A;  4S0T A;  2G0G A;  1R1K D;  3R8I A;  4PPP A;  3VTC A;  2P7Z A;  5KR9 A;  3AUQ A;  1NQ0 A;  3TY0 A;  1T79 A;  4JYG A;  2JJ3 A;  2ZK6 A;  1I7G A;  3D24 A;  2POB A;  4FHH A;  2PRG A;  5KRH A;  2I0J A;  5ACC A;  2A3I A;  3N00 A;  1XLS E;  3L3X A;  2YFE A;  5DI7 A;  4ZJW A;  1XQ3 A;  4RFW A;  5DXE A;  3UU7 A;  4RMD A;  1YIM A;  1U3R A;  4DM8 A;  4UDA A;  5DYD A;  3WTQ A;  2QTU A;  4IUI A;  4QK4 A;  3UU7 B;  1FCY A;  1X76 A;  3OMK A;  3RY9 A;  4TV1 A;  1XNX A;  3G0W A;  1XIU A;  4OH6 A;  4YNK A;  1G1U A;  2GL8 A;  1YOK A;  3L3Z A;  4MG7 A;  2VV4 A;  3M7R A;  1K4W A;  1K7L A;  1XP1 A;  5KCC A;  3OKH A;  4L96 A;  1PRG A;  4MG7 B;  3VT7 A;  2Z4J A;  5DV8 A;  1U9E A;  2V7C A;  4ZNW A;  3OSW A;  2GWX A;  4FGY A;  1QKN A;  2AWH A;  3FEJ A;  2OUZ A;  1X7B A;  2ZNO A;  5KRO A;  3GYU A;  2B1V A;  1FCZ A;  1RJK A;  1ILH A;  2HBH A;  2AMB A;  3KWY A;  1XP9 A;  2QR9 A;  1DB1 A;  2OVH A;  3HZF A;  1Z5X E;  1GWQ A;  4XLD A;  3NSQ A;  4HEE X;  1QKM A;  2REW A;  2ZXN A;  3HQ5 A;  1DKF B;  2P1U A;  3E00 A;  2Q6R A;  5DWI A;  5DWL A;  2ZK5 A;  3FS1 A;  3BQD A;  4G21 A;  4IU7 A;  5APH A;  4JL4 A;  4JYH A;  5L7E A;  1H9U A;  3GN8 A;  2Q5P A;  1U3Q A;  1XP6 A;  1S0Z A;  5E7V A;  3RUT A;  3D57 A;  5B5B A;  1U3S A;  3SZ1 A;  1T73 A;  3PCU A;  4WLB A;  3OMO A;  4YPQ A;  3L0E A;  1XVP B;  4OH5 A;  3V4A A;  5KRK A;  1RKH A;  4A4W A;  1PCG A;  1XV9 A;  4RUJ A;  2ZMH A;  4ITF A;  2AA6 A;  4BCR A;  4E4Q A;  5DLR A;  3K8S A;  3VTB A;  2IOK A;  3E94 A;  4ZNU A;  3H0A A;  4B7W A;  2OM9 A;  3L0J A;  3HOD A;  4FNE A;  2VV2 A;  1TFC A;  2ZMJ A;  3OS8 A;  4O8F A;  1S9P A;  4ZO1 X;  4OZR U;  2B1Z A;  3B67 A;  4NIE A;  3G9E A;  4LTW A;  5E14 A;  2W8Y A;  3DCT A;  3HC5 A;  4XT9 A;  3QT0 A;  5DIE A;  4OZT U;  2QZO A;  3WGP A;  1E3K A;  1P93 A;  3OSI A;  3B0W A;  5FQR A;  2VV1 A;  5DWG A;  5IAW A;  5E19 A;  1YY4 A;  3WJ5 A;  2QZO B;  3GWX A;  3ET1 A;  2ZFX A;  1YJE A;  3R8D A;  2ZK4 A;  2VV1 B;  5G42 A;  3T03 A;  3WMH A;  5DRM A;  3KPZ A;  5DXQ A;  3ET2 A;  4A4V A;  4MGC A;  2OCF A;  2O9I A;  3GYT A;  2GIU A;  1WM0 X;  2ZNQ A;  5IZ0 A;  1TXI A;  1L2I A;  2AM9 A;  5DZI A;  5G43 A;  5ICK A;  3A40 X;  3ERT A;  1SR7 A;  2AO6 A;  5AAV A;  1FCX A;  5E1C A;  1T7F A;  1NAV A;  3HO0 A;  3DZU A;  2QH6 A;  4DK7 A;  3A2I A;  3CTB A;  2AA2 A;  4PF3 A;  4DMA A;  1T5Z A;  4CSJ A;  1T65 A;  4OJ4 A;  5DZH A;  2I4P A;  4JGV A;  3K23 A;  5C4S A;  1GS4 A;  5DTV A;  2GP7 A;  1K74 D;  2ZVT A;  4REF A;  3ZQT A;  2Q1H A;  4OIL A;  5DWE A;  2FSZ A;  4R2U A;  1N4H A;  1FM6 A;  1EXA A;  1S0X A;  3ADT A;  1ZGY A;  4G1Y A;  4P6W A;  1YMT A;  2J4A A;  2IOG A;  3IXP A;  5AZT A;  5KYJ A;  4ZNH A;  3Q95 A;  4OJB A;  3PLZ A;  1UPW A;  2Q60 A;  3SP6 A;  3RVF A;  2AYR A;  4OEZ A;  5GIE A;  1UHL B;  1YUC A;  5KRM A;  4CI4 A;  3Q95 B;  1G5Y A;  3ADV A;  4S0S A;  5DVC A;  4OGH A;  1FD0 A;  4POH A;  2ZK0 A;  3ET0 A;  4REE A;  3VHU A;  3K6P A;  3MNO A;  4K6I A;  2PKL A;  2VV3 A;  4Q50 A;  3IA6 A;  1Y9R A;  5DMF A;  1RDT D;  2ZL9 A;  3FC6 B;  4OED A;  5HJP A;  5GID A;  4EM9 A;  2BJ4 A;  1XDK A;  2Q59 A;  3B3K A;  1NRL A;  4ZOM A;  3VT5 A;  5L11 A;  5LWP A;  4K7A A;  5DKS A;  5A86 A;  3VRU A;  3ZRA A;  1QKU A;  2J14 A;  2BJ4 B;  2H77 A;  3AN3 A;  4XUM A;  5EC9 A;  2Q59 B;  4X1G A;  4OKB A;  4X1F A;  5DZ3 A;  2AX7 A;  2POG A;  1Y0S A;  3AZ3 A;  2ZK3 A;  4RZE A;  3ZR7 A;  5GIC A;  3X31 A;  1ERR A;  2YJA B;  3CWD A;  1OVL A;  2AMA A;  2ZBS A;  3VHV A;  2PIT A;  4PVU A;  2F4B A;  5DZ0 A;  3MNE A;  1ZKY A;  4OZR E;  3UUC A;  2Q7I A;  2QPY A;  3AX8 A;  3F7D A;  2FAI A;  2J7X A;  2ZXM A;  5AWK A;  1PK5 A;  4OKX A;  4OZT E;  4TV1 B;  3A2H A;  4J24 A;  4E2J A;  2QXS A;  1T76 A;  4MG8 A;  5KRI A;  2Q7K A;  5AK2 A;  5E15 A;  1UOM A;  3B0R A;  3VJI A;  1Z95 A;  2VV4 B;  3VT3 A;  4MG8 B;  4J5X C;  3L1B A;  2AX6 A;  5DVV A;  3UP3 A;  1HJ1 A;  1X7R A;  4Q0A C;  1YA3 A;  2Q6J A;  3H52 A;  4G1Z A;  1ZH7 A;  3ADW A;  1XJ7 A;  3CS6 A;  4OKW A;  3VRV A;  3VT6 A;  1YOW A;  1FM9 A;  2ZKC A;  3RLJ A;  2IHQ A;  3JZB A;  4OFR A;  1LV2 A;  4PWL A;  2R6Y A;  2ZY0 A;  4MGD A;  4YT1 A;  2XYX A;  2VST A;  3VSP A;  1L2J A;  2QW4 A;  4MGD B;  4ZI1 A;  3ILZ A;  1ERE A;  4RZF A;  1R6G A;  3AFR A;  2H79 A;  3VI8 A;  3ET3 A;  3W5Q A;  1XZX X;  4Q13 A;  5DV3 A;  2VSR A;  3W0A A;  3W0Y A;  3OS9 A;  5KCE A;  1PQC A;  2PIV A;  3PO9 A;  4N1Y A;  4NB6 A;  3R29 A;  3D6D A;  3CDS A;  2JF9 A;  4N8R A;  4QM0 A;  3V9V A;  2PIW A;  3VSO A;  4YMQ A;  5KCF A;  1SQN A;  4FHI A;  1XV9 B;  1X78 A;  3R5M A;  1YP0 A;  4IWF A;  5AZV A;  1ZDT A;  3H0A D;  3OLL A;  1LBD A;  5K13 A;  2GTK A;  5DXB A;  1I38 A;  1P8D A;  3AUN A;  2B50 A;  3LMP A;  3R8A A;  3W0G A;  4EMA A;  4UDD A;  3KFC A;  1R20 A;  3D5F A;  5DXB B;  3KYT A;  5DYB A;  4PPS A;  5H1E A;  2QGW A;  5CJ6 A;  2O4R A;  3OMM A;  5KCU A;  4XI3 A;  2NXX A;  5APK A;  1MV9 A;  5AWJ A;  5HYK A;  2HWR A;  2P7A A;  5DX3 A;  2ZAS A;  3DT3 A;  5B41 A;  5DL4 A;  3IPS A;  4OHA A;  4DQM A;  2YHD A;  1NYX A;  2R40 D;  5GT4 A;  2YLY A;  3FXV A;  3KMG A;  5DX3 B;  3SP9 A;  3OLS A;  1XQC A;  4PP6 A;  3W0J A;  3O1D A;  4E4K A;  2OZ7 A;  4IA1 A;  5E0X A;  3W5P A;  1NQ1 A;  2QA8 A;  1IE8 A;  2G44 A;  5DUG A;  1MVC A;  5G5W A;  5DY8 A;  3OGT A;  4A2J A;  4IA2 A;  5AAV B;  3P88 A;  4MGA A;  4PXM A;  4J26 A;  2Q1V A;  4QE6 A;  1I7I A;  2Q5G A;  4LNX A;  3HVL A;  4MGA B;  5DUH A;  3WFG A;  3R2A A;  1X7J A;  5IXK A;  5KCD A;  2AB2 A;  4ONI A;  4WPF A;  2GPU A;  3GD2 A;  3L0L A;  2PIR A;  1GWX A;  1X7E A;  4OAR A;  4XTA A;  5DID A;  3W0I A;  2QA6 A;  1PDU A;  2QMV A;  2AX9 A;  2HWQ A;  2V0V A;  2YLP A;  2ABI A;  3DR1 A;  1RKG A;  4J5X A;  4N5G A;  3WWR A;  3B0T A;  3EYB A;  3NSP A;  3FLI A;  1FM6 D;  3GBK A;  4OKT A;  4OLM A;  5KCW A;  4R06 A;  1A52 A;  4L98 A;  4UDB A;  1YIN A;  4OK1 A;  3OKI A;  2Q61 A;  4R6S A;  4ZN7 A;  1ILG A;  3DCU A;  3HLV A;  4FN9 A;  3GZ9 A;  2ZK2 A;  3A78 A;  3OAP A;  5HJS A;  3ZRB A;  5DKG A;  5AAU A;  3W0H A;  3UP0 A;  3DZY D;  3B65 A;  4IVW A;  4IVY A;  4LBD A;  5KRA A;  4G20 A;  4IV2 A;  1K74 A;  1PQ6 A;  1S19 A;  3OZJ A;  3WT6 A;  4POJ A;  2ZXZ A;  4G2I A;  1ZAF A;  3KMZ A;  2OVM A;  5G3J A;  5DV6 A;  1QKT A;  3G8O A;  5DSH A;  2Q3Y A;  3FAL A;  4PLD A;  2FVJ A;  5JJM A;  1ZUC A;  4F9M A;  3W5T A;  2ZK1 A;  3FAL B;  4ZO1 B;  5HJP B;  4MDD A;  5EJV A;  1XLS A;  1XDK B;  4XHD A;  2NPA A;  2PNU A;  5AVI A;  2HCD A;  4WVD A;  3VN2 A;  4DK8 A;  2QE4 A;  4IWC A;  4IA3 A;  4PP5 A;  3VTD A;  4J5W C;  1R5K A;  5G46 A;  4OC7 A;  5KRF A;  3UUD A;  4MGB A;  3AZ2 A;  2HB7 A;  3OLF A;  5KD9 A;  2HVC A;  5DZ1 A;  2PIO A;  1XOW A;  5DXP A;  4RAK A;  2GPP A;  2HAM A;  3IPQ A;  3V3Q A;  3X36 A;  2Z4B A;  3RUU A;  1OVL B;  4LSJ A;  2EWP A;  1MZN A;  4IS8 A;  3CJW A;  3IPU A;  5DU5 A;  4RWV A;  3V3E A;  3W5R A;  4IW6 A;  1R1K A;  3FUG A;  4QE8 A;  4QL8 A;  3ERD A;  2G5O A;  2QGT A;  4NQA B;  4OEA A;  4JYI A;  2XHS A;  1T7M A;  5L7H A;  2J7Y A;  2XKW A;  3JZC A;  2Q6S A;  4KZJ A;  4APU A;  1HG4 A;  5EHJ A;  2P1V A;  4OFU A;  4RUP A;  2P1T A;  3B68 A;  4Y29 A;  3CS4 A;  3OMP A;  1M7W A;  2HC4 A;  2I4J A;  5FQT A;  1OSV A;  4TUZ A;  5LGA A;  3LBD A;  3VHW A;  4OJ9 A;  3PBA A;  2R6W A;  1EXX A;  3ADS A;  1FM9 D;  2GPV A;  2QNV A;  4TUZ B;  5C4U A;  1T7R A;  3MNP A;  1BSX A;  4IW8 A;  2ZLC A;  1FBY A;  1RK3 A;  3R5N A;  5DRJ A;  3O1E A;  2Q7J A;  1I37 A;  4RUO X;  4RMC A;  3E00 D;  3HM1 A;  3TKC A;  1YYE A;  1NUO A;  4PRG A;  5DXR A;  3NOA A;  3B66 A;  4S15 A;  2GPO A;  1T7T A;  3UVV A;  4ZN9 A;  1M2Z A;  5G44 A;  2ACL A;  3DY6 A;  3K22 A;  5FQS A;  3UVV B;  3GWS X;  4IV4 A;  1N46 A;  2E2R A;  3G8I A;  5JI0 D;  1ZEO A;  2ACL B;  5E0W A;  4WHF A;  2QAB A;  5ETH A;  3VRT A;  4OEY A;  2PJL A;  3X1H A;  2Q5S A;  1DKF A;  5DKB A;  4RE8 A;  5DVS A;  3E7C A;  5C4O A;  5FQP A;  1GWR A;  2PIX A;  5KRL A;  2ATH A;  3KDU A;  3HC6 A;  5DUE A;  3P0U A;  3V9T A;  2QSE A;  4G1D A;  5EGV A;  2PIU A;  4ITE A;  1E3G A;  1ZDU A;  3WT5 A;  3L03 A;  4M8E A;  3TKM A;  1R20 D;  4P6X A;  2AA5 A;  3W0C A;  5APJ A;  1XVP A;  1KV6 A;  4RME A;  4MG6 A;  4JAZ A;  1SKX A;  5DMC A;  2HAR A;  3AN4 A;  3WJ4 A;  2PIN A;  5KRC A;  3OMQ A;  4PLE A;  4WHG A;  3RLL A;  1NDE A;  3PEQ A;  3P89 A;  1KNU A;  2XYJ A;  3A9E A;  3OSA A;  1SJ0 A;  4J5W A;  2O4J A;  3VT9 A;  3A9E B;  4WQP A;  4CI5 A;  3KBA A;  3VJT A;  2OAX A;  4XUH A;  4DOR A;  1T63 A;  2Q7L A;  2ZNP A;  3AUR A;  3P8X A;  3ADU A;  1OT7 A;  3KMR A;  4HLW A;  2AXA A;  3B5R A;  3IMY A;  3KDT A;  2AAX A;  4KZI A;  5C4T A;  2XYW A;  2QA8 B;  2HAS A;  3OOK A;  4G2H A;  3U9Q A;  3F5C A;  5DK9 A;  5G45 A;  5DKE A;  2LBD A;  1G2N A;  1IE9 A;  1S9Q A;  1PQ9 A;  3F5C B;  3B1M A;  2R40 A;  3FEI A;  3OOF A;  4XAO A;  2AX8 A;  1Y0X X;  2I0G A;  3CDP A;  3ADX A;  2PIP L;  2PIQ A;  2G0H A;  2B23 A;  1XPC A;  2NXX E;  2P54 A;  4MG9 A;  4DM6 A;  2YLO A;  3DZU D;  3UUA A;  3VRW A; 
#chains in the Genus database with same CATH homology
 5I4V A;  1G50 A;  1XB7 A;  3OZ0 A;  3B0Q A;  4MG9 B;  3V49 A;  3UUA B;  3BEJ A;  4NY9 A;  5AVL A;  3IXP D;  2ZNN A;  1OSH A;  1Z5X U;  1NHZ A;  2YAT A;  1NAX A;  5M96 A;  2JFA A;  1T74 A;  2YLQ A;  2Q8S A;  2YJD A;  3CLD A;  3CS8 A;  2JFA B;  5DWJ A;  5HCV A;  2I4Z A;  5L7G A;  1PZL A;  2HB8 A;  2QXM A;  5DP0 A;  2NW4 A;  4PP3 A;  3VJS A;  5HZC A;  3FUR A;  4KZM A;  5KRJ A;  2ZLA A;  1NQ7 A;  2AA7 A;  4K4J A;  3VT4 A;  5DIG A;  5HYR A;  5JJM B;  1UHL A;  3A3Z X;  3DZY A;  2P15 A;  1XNN A;  4OIU A;  4RZG A;  4S14 A;  5DXK A;  4ZJR A;  1UPV A;  5DXM A;  4IQR A;  5KYA A;  1KKQ A;  4LNW A;  4ZNT A;  4ZNV A;  3BC5 A;  4OIV A;  3AZ1 A;  3WFF A;  5KCT A;  3OS8 C;  3WT7 A;  3V9Y A;  3PRG A;  1VJB A;  1N83 A;  4MGB B;  3UUD B;  3VJH A;  1M13 A;  3CQV A;  3FC6 A;  3S9S A;  5SYZ A;  1RDT A;  4DOS A;  5AYG A;  2BAW A;  5FQV A;  4M8H A;  4NUF A;  5EI1 A;  2ZMI A;  2NV7 A;  2P4Y A;  4IA7 A;  4MG5 A;  4UDC A;  1Q4X A;  2Q70 A;  1A28 A;  2HFP A;  2VV0 A;  4QJR A;  5F9B A;  1NQ2 A;  3X1I A;  5JY3 A;  4N73 A;  3D90 A;  5EIT A;  4ZNS A;  5DXG A;  1XAP A;  3TX7 B;  3VT8 A;  3A2J A;  2P7G A;  4S0T A;  2G0G A;  1R1K D;  3R8I A;  4PPP A;  3VTC A;  2P7Z A;  5KR9 A;  3AUQ A;  1NQ0 A;  3TY0 A;  1T79 A;  4JYG A;  2JJ3 A;  2ZK6 A;  1I7G A;  3D24 A;  2POB A;  4FHH A;  2PRG A;  5KRH A;  2I0J A;  5ACC A;  2A3I A;  3N00 A;  1XLS E;  3L3X A;  2YFE A;  5DI7 A;  4ZJW A;  1XQ3 A;  4RFW A;  5DXE A;  3UU7 A;  4RMD A;  1YIM A;  1U3R A;  4DM8 A;  4UDA A;  5DYD A;  3WTQ A;  2QTU A;  4IUI A;  4QK4 A;  3UU7 B;  1FCY A;  1X76 A;  3OMK A;  3RY9 A;  4TV1 A;  1XNX A;  3G0W A;  1XIU A;  4OH6 A;  4YNK A;  1G1U A;  2GL8 A;  1YOK A;  3L3Z A;  4MG7 A;  2VV4 A;  3M7R A;  1K4W A;  1K7L A;  1XP1 A;  5KCC A;  3OKH A;  4L96 A;  1PRG A;  4MG7 B;  3VT7 A;  2Z4J A;  5DV8 A;  1U9E A;  2V7C A;  4ZNW A;  3OSW A;  2GWX A;  4FGY A;  1QKN A;  2AWH A;  3FEJ A;  2OUZ A;  1X7B A;  2ZNO A;  5KRO A;  3GYU A;  2B1V A;  1FCZ A;  1RJK A;  1ILH A;  2HBH A;  2AMB A;  3KWY A;  1XP9 A;  2QR9 A;  1DB1 A;  2OVH A;  3HZF A;  1Z5X E;  1GWQ A;  4XLD A;  3NSQ A;  4HEE X;  1QKM A;  2REW A;  2ZXN A;  3HQ5 A;  1DKF B;  2P1U A;  3E00 A;  2Q6R A;  5DWI A;  5DWL A;  2ZK5 A;  3FS1 A;  3BQD A;  4G21 A;  4IU7 A;  5APH A;  4JL4 A;  4JYH A;  5L7E A;  1H9U A;  3GN8 A;  2Q5P A;  1U3Q A;  1XP6 A;  1S0Z A;  5E7V A;  3RUT A;  3D57 A;  5B5B A;  1U3S A;  3SZ1 A;  1T73 A;  3PCU A;  4WLB A;  3OMO A;  4YPQ A;  3L0E A;  1XVP B;  4OH5 A;  3V4A A;  5KRK A;  1RKH A;  4A4W A;  1PCG A;  1XV9 A;  4RUJ A;  2ZMH A;  4ITF A;  2AA6 A;  4BCR A;  4E4Q A;  5DLR A;  3K8S A;  3VTB A;  2IOK A;  3E94 A;  4ZNU A;  3H0A A;  4B7W A;  2OM9 A;  3L0J A;  3HOD A;  4FNE A;  2VV2 A;  1TFC A;  2ZMJ A;  3OS8 A;  4O8F A;  1S9P A;  4ZO1 X;  4OZR U;  2B1Z A;  3B67 A;  4NIE A;  3G9E A;  4LTW A;  5E14 A;  2W8Y A;  3DCT A;  3HC5 A;  4XT9 A;  3QT0 A;  5DIE A;  4OZT U;  2QZO A;  3WGP A;  1E3K A;  1P93 A;  3OSI A;  3B0W A;  5FQR A;  2VV1 A;  5DWG A;  5IAW A;  5E19 A;  1YY4 A;  3WJ5 A;  2QZO B;  3GWX A;  3ET1 A;  2ZFX A;  1YJE A;  3R8D A;  2ZK4 A;  2VV1 B;  5G42 A;  3T03 A;  3WMH A;  5DRM A;  3KPZ A;  5DXQ A;  3ET2 A;  4A4V A;  4MGC A;  2OCF A;  2O9I A;  3GYT A;  2GIU A;  1WM0 X;  2ZNQ A;  5IZ0 A;  1TXI A;  1L2I A;  2AM9 A;  5DZI A;  5G43 A;  5ICK A;  3A40 X;  3ERT A;  1SR7 A;  2AO6 A;  5AAV A;  1FCX A;  5E1C A;  1T7F A;  1NAV A;  3HO0 A;  3DZU A;  2QH6 A;  4DK7 A;  3A2I A;  3CTB A;  2AA2 A;  4PF3 A;  4DMA A;  1T5Z A;  4CSJ A;  1T65 A;  4OJ4 A;  5DZH A;  2I4P A;  4JGV A;  3K23 A;  5C4S A;  1GS4 A;  5DTV A;  2GP7 A;  1K74 D;  2ZVT A;  4REF A;  3ZQT A;  2Q1H A;  4OIL A;  5DWE A;  2FSZ A;  4R2U A;  1N4H A;  1FM6 A;  1EXA A;  1S0X A;  3ADT A;  1ZGY A;  4G1Y A;  4P6W A;  1YMT A;  2J4A A;  2IOG A;  3IXP A;  5AZT A;  5KYJ A;  4ZNH A;  3Q95 A;  4OJB A;  3PLZ A;  1UPW A;  2Q60 A;  3SP6 A;  3RVF A;  2AYR A;  4OEZ A;  5GIE A;  1UHL B;  1YUC A;  5KRM A;  4CI4 A;  3Q95 B;  1G5Y A;  3ADV A;  4S0S A;  5DVC A;  4OGH A;  1FD0 A;  4POH A;  2ZK0 A;  3ET0 A;  4REE A;  3VHU A;  3K6P A;  3MNO A;  4K6I A;  2PKL A;  2VV3 A;  4Q50 A;  3IA6 A;  1Y9R A;  5DMF A;  1RDT D;  2ZL9 A;  3FC6 B;  4OED A;  5HJP A;  5GID A;  4EM9 A;  2BJ4 A;  1XDK A;  2Q59 A;  3B3K A;  1NRL A;  4ZOM A;  3VT5 A;  5L11 A;  5LWP A;  4K7A A;  5DKS A;  5A86 A;  3VRU A;  3ZRA A;  1QKU A;  2J14 A;  2BJ4 B;  2H77 A;  3AN3 A;  4XUM A;  5EC9 A;  2Q59 B;  4X1G A;  4OKB A;  4X1F A;  5DZ3 A;  2AX7 A;  2POG A;  1Y0S A;  3AZ3 A;  2ZK3 A;  4RZE A;  3ZR7 A;  5GIC A;  3X31 A;  1ERR A;  2YJA B;  3CWD A;  1OVL A;  2AMA A;  2ZBS A;  3VHV A;  2PIT A;  4PVU A;  2F4B A;  5DZ0 A;  3MNE A;  1ZKY A;  4OZR E;  3UUC A;  2Q7I A;  2QPY A;  3AX8 A;  3F7D A;  2FAI A;  2J7X A;  2ZXM A;  5AWK A;  1PK5 A;  4OKX A;  4OZT E;  4TV1 B;  3A2H A;  4J24 A;  4E2J A;  2QXS A;  1T76 A;  4MG8 A;  5KRI A;  2Q7K A;  5AK2 A;  5E15 A;  1UOM A;  3B0R A;  3VJI A;  1Z95 A;  2VV4 B;  3VT3 A;  4MG8 B;  4J5X C;  3L1B A;  2AX6 A;  5DVV A;  3UP3 A;  1HJ1 A;  1X7R A;  4Q0A C;  1YA3 A;  2Q6J A;  3H52 A;  4G1Z A;  1ZH7 A;  3ADW A;  1XJ7 A;  3CS6 A;  4OKW A;  3VRV A;  3VT6 A;  1YOW A;  1FM9 A;  2ZKC A;  3RLJ A;  2IHQ A;  3JZB A;  4OFR A;  1LV2 A;  4PWL A;  2R6Y A;  2ZY0 A;  4MGD A;  4YT1 A;  2XYX A;  2VST A;  3VSP A;  1L2J A;  2QW4 A;  4MGD B;  4ZI1 A;  3ILZ A;  1ERE A;  4RZF A;  1R6G A;  3AFR A;  2H79 A;  3VI8 A;  3ET3 A;  3W5Q A;  1XZX X;  4Q13 A;  5DV3 A;  2VSR A;  3W0A A;  3W0Y A;  3OS9 A;  5KCE A;  1PQC A;  2PIV A;  3PO9 A;  4N1Y A;  4NB6 A;  3R29 A;  3D6D A;  3CDS A;  2JF9 A;  4N8R A;  4QM0 A;  3V9V A;  2PIW A;  3VSO A;  4YMQ A;  5KCF A;  1SQN A;  4FHI A;  1XV9 B;  1X78 A;  3R5M A;  1YP0 A;  4IWF A;  5AZV A;  1ZDT A;  3H0A D;  3OLL A;  1LBD A;  5K13 A;  2GTK A;  5DXB A;  1I38 A;  1P8D A;  3AUN A;  2B50 A;  3LMP A;  3R8A A;  3W0G A;  4EMA A;  4UDD A;  3KFC A;  1R20 A;  3D5F A;  5DXB B;  3KYT A;  5DYB A;  4PPS A;  5H1E A;  2QGW A;  5CJ6 A;  2O4R A;  3OMM A;  5KCU A;  4XI3 A;  2NXX A;  5APK A;  1MV9 A;  5AWJ A;  5HYK A;  2HWR A;  2P7A A;  5DX3 A;  2ZAS A;  3DT3 A;  5B41 A;  5DL4 A;  3IPS A;  4OHA A;  4DQM A;  2YHD A;  1NYX A;  2R40 D;  5GT4 A;  2YLY A;  3FXV A;  3KMG A;  5DX3 B;  3SP9 A;  3OLS A;  1XQC A;  4PP6 A;  3W0J A;  3O1D A;  4E4K A;  2OZ7 A;  4IA1 A;  5E0X A;  3W5P A;  1NQ1 A;  2QA8 A;  1IE8 A;  2G44 A;  5DUG A;  1MVC A;  5G5W A;  5DY8 A;  3OGT A;  4A2J A;  4IA2 A;  5AAV B;  3P88 A;  4MGA A;  4PXM A;  4J26 A;  2Q1V A;  4QE6 A;  1I7I A;  2Q5G A;  4LNX A;  3HVL A;  4MGA B;  5DUH A;  3WFG A;  3R2A A;  1X7J A;  5IXK A;  5KCD A;  2AB2 A;  4ONI A;  4WPF A;  2GPU A;  3GD2 A;  3L0L A;  2PIR A;  1GWX A;  1X7E A;  4OAR A;  4XTA A;  5DID A;  3W0I A;  2QA6 A;  1PDU A;  2QMV A;  2AX9 A;  2HWQ A;  2V0V A;  2YLP A;  2ABI A;  3DR1 A;  1RKG A;  4J5X A;  4N5G A;  3WWR A;  3B0T A;  3EYB A;  3NSP A;  3FLI A;  1FM6 D;  3GBK A;  4OKT A;  4OLM A;  5KCW A;  4R06 A;  1A52 A;  4L98 A;  4UDB A;  1YIN A;  4OK1 A;  3OKI A;  2Q61 A;  4R6S A;  4ZN7 A;  1ILG A;  3DCU A;  3HLV A;  4FN9 A;  3GZ9 A;  2ZK2 A;  3A78 A;  3OAP A;  5HJS A;  3ZRB A;  5DKG A;  5AAU A;  3W0H A;  3UP0 A;  3DZY D;  3B65 A;  4IVW A;  4IVY A;  4LBD A;  5KRA A;  4G20 A;  4IV2 A;  1K74 A;  1PQ6 A;  1S19 A;  3OZJ A;  3WT6 A;  4POJ A;  2ZXZ A;  4G2I A;  1ZAF A;  3KMZ A;  2OVM A;  5G3J A;  5DV6 A;  1QKT A;  3G8O A;  5DSH A;  2Q3Y A;  3FAL A;  4PLD A;  2FVJ A;  5JJM A;  1ZUC A;  4F9M A;  3W5T A;  2ZK1 A;  3FAL B;  4ZO1 B;  5HJP B;  4MDD A;  5EJV A;  1XLS A;  1XDK B;  4XHD A;  2NPA A;  2PNU A;  5AVI A;  2HCD A;  4WVD A;  3VN2 A;  4DK8 A;  2QE4 A;  4IWC A;  4IA3 A;  4PP5 A;  3VTD A;  4J5W C;  1R5K A;  5G46 A;  4OC7 A;  5KRF A;  3UUD A;  4MGB A;  3AZ2 A;  2HB7 A;  3OLF A;  5KD9 A;  2HVC A;  5DZ1 A;  2PIO A;  1XOW A;  5DXP A;  4RAK A;  2GPP A;  2HAM A;  3IPQ A;  3V3Q A;  3X36 A;  2Z4B A;  3RUU A;  1OVL B;  4LSJ A;  2EWP A;  1MZN A;  4IS8 A;  3CJW A;  3IPU A;  5DU5 A;  4RWV A;  3V3E A;  3W5R A;  4IW6 A;  1R1K A;  3FUG A;  4QE8 A;  4QL8 A;  3ERD A;  2G5O A;  2QGT A;  4NQA B;  4OEA A;  4JYI A;  2XHS A;  1T7M A;  5L7H A;  2J7Y A;  2XKW A;  3JZC A;  2Q6S A;  4KZJ A;  4APU A;  1HG4 A;  5EHJ A;  2P1V A;  4OFU A;  4RUP A;  2P1T A;  3B68 A;  4Y29 A;  3CS4 A;  3OMP A;  1M7W A;  2HC4 A;  2I4J A;  5FQT A;  1OSV A;  4TUZ A;  5LGA A;  3LBD A;  3VHW A;  4OJ9 A;  3PBA A;  2R6W A;  1EXX A;  3ADS A;  1FM9 D;  2GPV A;  2QNV A;  4TUZ B;  5C4U A;  1T7R A;  3MNP A;  1BSX A;  4IW8 A;  2ZLC A;  1FBY A;  1RK3 A;  3R5N A;  5DRJ A;  3O1E A;  2Q7J A;  1I37 A;  4RUO X;  4RMC A;  3E00 D;  3HM1 A;  3TKC A;  1YYE A;  1NUO A;  4PRG A;  5DXR A;  3NOA A;  3B66 A;  4S15 A;  2GPO A;  1T7T A;  3UVV A;  4ZN9 A;  1M2Z A;  5G44 A;  2ACL A;  3DY6 A;  3K22 A;  5FQS A;  3UVV B;  3GWS X;  4IV4 A;  1N46 A;  2E2R A;  3G8I A;  5JI0 D;  1ZEO A;  2ACL B;  5E0W A;  4WHF A;  2QAB A;  5ETH A;  3VRT A;  4OEY A;  2PJL A;  3X1H A;  2Q5S A;  1DKF A;  5DKB A;  4RE8 A;  5DVS A;  3E7C A;  5C4O A;  5FQP A;  1GWR A;  2PIX A;  5KRL A;  2ATH A;  3KDU A;  3HC6 A;  5DUE A;  3P0U A;  3V9T A;  2QSE A;  4G1D A;  5EGV A;  2PIU A;  4ITE A;  1E3G A;  1ZDU A;  3WT5 A;  3L03 A;  4M8E A;  3TKM A;  1R20 D;  4P6X A;  2AA5 A;  3W0C A;  5APJ A;  1XVP A;  1KV6 A;  4RME A;  4MG6 A;  4JAZ A;  1SKX A;  5DMC A;  2HAR A;  3AN4 A;  3WJ4 A;  2PIN A;  5KRC A;  3OMQ A;  4PLE A;  4WHG A;  3RLL A;  1NDE A;  3PEQ A;  3P89 A;  1KNU A;  2XYJ A;  3A9E A;  3OSA A;  1SJ0 A;  4J5W A;  2O4J A;  3VT9 A;  3A9E B;  4WQP A;  4CI5 A;  3KBA A;  3VJT A;  2OAX A;  4XUH A;  4DOR A;  1T63 A;  2Q7L A;  2ZNP A;  3AUR A;  3P8X A;  3ADU A;  1OT7 A;  3KMR A;  4HLW A;  2AXA A;  3B5R A;  3IMY A;  3KDT A;  2AAX A;  4KZI A;  5C4T A;  2XYW A;  2QA8 B;  2HAS A;  3OOK A;  4G2H A;  3U9Q A;  3F5C A;  5DK9 A;  5G45 A;  5DKE A;  2LBD A;  1G2N A;  1IE9 A;  1S9Q A;  1PQ9 A;  3F5C B;  3B1M A;  2R40 A;  3FEI A;  3OOF A;  4XAO A;  2AX8 A;  1Y0X X;  2I0G A;  3CDP A;  3ADX A;  2PIP L;  2PIQ A;  2G0H A;  2B23 A;  1XPC A;  2NXX E;  2P54 A;  4MG9 A;  4DM6 A;  2YLO A;  3DZU D;  3UUA A;  3VRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...