5DWEA

Crystal structure of the er-alpha ligand-binding domain in complex with a 2-chloro-substituted triaryl-imine analog 4,4'-[(2-chlorophenyl)carbonimidoyl]diphenol
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
248
structure length
236
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRLHAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Predictive features of ligand-specific signaling through the estrogen receptor.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Transcription
source organism Homo sapiens
total genus 88
structure length 236
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5dweA00
2G0GA 1YJEA 1MV9A 3R8IA 3VRUA 2ZK3A 2HB8A 2I4PA 4TV1B 2HWQA 3RY9A 4CI5A 1T73A 4XLDA 5KRMA 4N5GA 3R8DA 3P0UA 1I7GA 3GZ9A 5KCFA 3KBAA 4QM0A 3L1BA 5KRKA 2QA8A 2P1UA 1Y0SA 2Q1VA 4TUZB 2HCDA 5LGAA 4OEZA 5HZCA 2NPAA 4G1YA 1NAXA 4IV4A 4QJRA 4ZNTA 2GP7A 4RUPA 3M7RA 2PIRA 4MG6A 5DX3A 2PIXA 1N4HA 4ITEA 1XP6A 3QT0A 4B7WA 2Q6SA 3OGTA 3CTBA 3OLFA 1UHLA 2HC4A 5DZHA 5G3JA 2IOKA 3UU7A 2Z4JA 4J5WA 1KV6A 4MG9A 1PZLA 1Y0XX 1G1UA 3AFRA 4JL4A 4PVUA 3NSQA 3UUDA 4RMEA 3AZ1A 1LBDA 1TXIA 3DT3A 5CJ6A 3H52A 5FQVA 3VT4A 5DP0A 2B1ZA 3CDSA 5AVIA 2ZY0A 3B1MA 3B65A 3VHUA 3OKIA 3KYTA 4X1GA 2P7AA 2AWHA 3R29A 1P93A 2ZMHA 3W5PA 1I38A 3V3QA 1DB1A 5DK9A 4MGBA 1G50A 1PQ9A 4HEEX 4RE8A 4UDAA 4ZNVA 5DVVA 4NQAB 1XLSE 5KRAA 2GL8A 3WFFA 2HWRA 4PF3A 3PBAA 4ONIA 1XQ3A 4OKWA 1Q4XA 3VTDA 3A9EA 3G0WA 1I7IA 1YINA 3KPZA 2VV2A 1NQ2A 4ZNSA 1XAPA 3X36A 3HVLA 3MNEA 2PITA 1ZAFA 1M7WA 2ZKCA 1I37A 3SZ1A 3AURA 3OLSA 4BCRA 5EGVA 2AYRA 2NW4A 4MGCA 2Q5GA 3G8IA 2VSTA 2QE4A 1A28A 4FNEA 5FQPA 4K6IA 3FUGA 1YUCA 4N73A 4R06A 5AZTA 5DVCA 1T79A 1FCYA 4J5WC 5KRFA 2JF9A 4P6WA 5DIGA 5JY3A 3VT6A 2XYJA 3L03A 3OKHA 5DIEA 3ADTA 2ZXZA 5AAVA 4LNXA 3TKCA 3HC5A 3FC6B 3UUCA 2AAXA 2JFAA 1K4WA 3A2JA 3Q95A 2I4JA 3UUAB 2LBDA 4OZTU 2P7ZA 4PRGA 1GWRA 3ADWA 4G2IA 4PP6A 2Q70A 2VV1A 5DZIA 5KRHA 3IPQA 1PQCA 1WM0X 2XHSA 2OCFA 2AMAA 2ZLCA 2BJ4A 4ZJWA 1GWXA 4X1FA 2Q59B 1NUOA 2YLOA 5FQSA 3UP0A 3AZ2A 2QR9A 3BEJA 3NOAA 4MGAA 3NSPA 1Z5XU 4S0TA 3PCUA 2Q61A 4OARA 2J4AA 4XUHA 2QZOB 5IXKA 1YA3A 1S0XA 3FEJA 3B5RA 5DZ1A 5HJPB 3VJHA 1NQ7A 4IA2A 2Q7IA 3A40X 3KDTA 3GWXA 3HODA 5SYZA 4JYGA 2HASA 2VV4A 2O9IA 4YT1A 1Y9RA 3VSOA 2I4ZA 2OVMA 4FGYA 2QW4A 3FALA 3VT5A 1EREA 2ZLAA 1S19A 5E0XA 1K74D 1T7MA 2HARA 2VV3A 3E00D 2OUZA 3ET3A 1P8DA 3KMZA 4S15A 4LSJA 1RDTD 4WHGA 5DRMA 1RJKA 2ZK1A 1NYXA 4MGDB 5GIDA 4XTAA 1XV9A 5G44A 4WLBA 2GPUA 1ZKYA 1IE8A 5DRJA 5KRJA 1RDTA 4REFA 3DZUD 3B0RA 5AVLA 2IOGA 2R40D 4G2HA 4OH5A 4OLMA 2QNVA 5DYDA 4RUJA 4ZNUA 5B41A 3BC5A 3DR1A 4OJBA 4YMQA 3DZUA 4RZFA 1H9UA 2ZNQA 1T63A 4UDDA 1R1KA 2XYXA 1RK3A 1EXAA 4RMCA 4RZGA 1BSXA 4R2UA 4ZO1B 4PLEA 5KRLA 1YMTA 4G1DA 4LBDA 4XUMA 3TX7B 3O1DA 5KYAA 4OKXA 3VRVA 1XOWA 3P89A 3ZQTA 1U9EA 2O4JA 3FS1A 1FM6A 5APHA 1NHZA 1U3RA 2B50A 2AXAA 1QKNA 3IA6A 5G45A 3W0HA 1MVCA 5F9BA 2QABA 2NV7A 2QSEA 2AA2A 5GT4A 5EHJA 2QGWA 2Q7LA 2Q6JA 4JAZA 1XVPB 4TV1A 1OVLB 2Q7KA 3OAPA 4OEDA 3V49A 3CJWA 3ZRBA 1FD0A 4DM8A 1ILGA 2ATHA 2VSRA 5APKA 3R5MA 1N83A 1RKGA 1XNNA 1DKFA 3L0EA 3OLLA 2P7GA 1SQNA 4NIEA 1FCXA 4NB6A 4MG7B 4R6SA 3R2AA 2POBA 2J7XA 3ERTA 4TUZA 2PIUA 2AO6A 5DSHA 2NXXA 3IPUA 3RLJA 1EXXA 2PRGA 2NXXE 1FCZA 2ZK0A 1U3SA 1YY4A 1KNUA 5DU5A 4ZI1A 3ET0A 3WJ4A 5G43A 4KZIA 2G0HA 4NUFA 5JJMB 2Q7JA 5HYRA 5DUHA 2P1VA 4L98A 3HLVA 5DMFA 5DZ0A 5G5WA 1YYEA 5FQTA 4RZEA 1PK5A 5DMCA 5DWEA 4E4KA 1XIUA 4Q13A 2P4YA 4WHFA 3DCUA 4JYIA 4JGVA 5GIEA 5IAWA 3OOFA 3B3KA 4F9MA 4PLDA 5HJSA 3L3XA 4XAOA 2AM9A 3N00A 4PWLA 1TFCA 5DXEA 3X31A 1X7BA 3OZ0A 5ACCA 3B0TA 2FAIA 1NAVA 3IPSA 3OMOA 5DVSA 1M2ZA 2R6WA 3X1HA 4UDBA 1VJBA 5KCTA 3G9EA 2QXSA 3DZYA 2YJDA 4YNKA 4S14A 1ZDUA 5HYKA 4E4QA 3LBDA 1ZUCA 4IW8A 5E15A 4KZJA 3WTQA 4OEYA 3V4AA 1XP1A 4RWVA 5EI1A 1UPVA 3HO0A 4FHIA 5DWIA 3WFGA 3L3ZA 3VT8A 4MG8A 4O8FA 3VT3A 2GPPA 2JJ3A 2OAXA 3V9YA 4IWFA 3T03A 5KCUA 5KRIA 4N1YA 3W0AA 3F7DA 4WVDA 2A3IA 5AYGA 2B1VA 2AB2A 1NQ1A 1MZNA 2ZXNA 3WGPA 2V7CA 3CS8A 5A86A 5DXMA 4IVWA 5L7GA 3RUTA 4M8EA 2EWPA 3GD2A 3H0AD 4IV2A 4MDDA 3SP6A 1GWQA 1XZXX 3IXPD 4OZTE 4ZN9A 4OC7A 3W5QA 3A2HA 2Q5PA 3HZFA 4IA3A 5JI0D 3FC6A 4ZN7A 3K23A 3VRWA 3H0AA 5C4OA 3UUAA 3IXPA 3K6PA 3Q95B 5C4SA 2PKLA 1X7JA 2YFEA 2V0VA 1XJ7A 2HBHA 5C4UA 1S9QA 4IS8A 5KCCA 4HLWA 4IA7A 5DXBB 3PRGA 1G2NA 1Z5XE 2ACLB 2PIOA 3TY0A 1XDKB 2Q59A 1FM9D 4IA1A 4ZNWA 4ITFA 1XPCA 2F4BA 1FBYA 4OZRU 1OT7A 3W0IA 2Z4BA 3WT6A 5DXKA 2GWXA 4E2JA 1T7FA 2QZOA 3P8XA 1FM9A 5DWLA 2YJAB 5AWJA 5HJPA 4YPQA 2YATA 5DIDA 3W0YA 4G1ZA 2PJLA 4RAKA 1KKQA 3UVVB 2YLQA 4OGHA 5DV8A 2J14A 3OSIA 4OK1A 2XKWA 4NY9A 5E0WA 3GYTA 2QPYA 5EITA 3JZBA 2Q3YA 3B67A 1X7EA 2YHDA 4OFRA 2B23A 2PIVA 1L2JA 1NDEA 4DMAA 1PQ6A 5E19A 5EJVA 4PP3A 1E3KA 1R1KD 4L96A 3W0GA 2GPVA 3W5RA 2QH6A 4REEA 1XNXA 3D90A 4MGDA 5DI7A 4P6XA 5DY8A 4J5XA 4OFUA 1ZDTA 3VJTA 2GIUA 1FM6D 4G21A 4DK8A 2AA5A 1HG4A 1XQCA 5IZ0A 2YLYA 3SP9A 3VHVA 5AAUA 2VV0A 4OILA 4WQPA 3PEQA 2REWA 4WPFA 2OZ7A 1K7LA 3RLLA 5DKGA 5DL4A 5B5BA 3ADXA 2ZFXA 4ZO1X 3F5CB 3OOKA 2HFPA 3HQ5A 4OH6A 5DV6A 5DWJA 4DQMA 4OJ9A 3GYUA 3VT7A 3RUUA 2AA7A 1Z95A 4IUIA 2AX7A 3CQVA 3VSPA 5DKEA 5KYJA 5K13A 2FVJA 3CS6A 5KROA 1U3QA 3VHWA 3VI8A 2O4RA 2PINA 1HJ1A 2PNUA 3O1EA 3X1IA 4IU7A 3DCTA 3AN4A 4ZJRA 3ET1A 5H1EA 2AX9A 1T65A 2ZK5A 3B68A 1T7RA 2QA8B 3FLIA 4J26A 1T5ZA 5C4TA 1ILHA 3D6DA 1XVPA 3JZCA 4APUA 1OVLA 3VN2A 5DXPA 2ZMIA 4IW6A 2GTKA 1S9PA 1DKFB 5DX3B 3CDPA 3B0WA 4MG7A 1RKHA 4POJA 4K7AA 1UPWA 1R5KA 2YLPA 3PO9A 4S0SA 3VTBA 3WT5A 2OVHA 3D5FA 2AX8A 3AX8A 1UHLB 3HC6A 3OZJA 4J5XC 2H77A 3TKMA 3V3EA 3UU7B 1T76A 5KR9A 3CWDA 4MG9B 3ET2A 5JJMA 3K22A 3KWYA 3IMYA 3UUDB 2AX6A 4Q50A 4A4WA 1N46A 5KCEA 1UOMA 3MNOA 4QK4A 3AUNA 2ZASA 4A4VA 3KFCA 4Q0AC 4XHDA 3DZYD 3ILZA 4OHAA 5DTVA 3OMKA 1LV2A 4EMAA 5GICA 3EYBA 2QXMA 4Y29A 4RMDA 1E3GA 3CLDA 1T74A 4MGBB 5DXRA 1NRLA 3ADUA 3MNPA 2H79A 4A2JA 5DWGA 4OKBA 1XP9A 4K4JA 2POGA 2G5OA 4IWCA 5DYBA 3P88A 2PIPL 4LTWA 4ZOMA 1SKXA 1ZEOA 3A9EB 3ADVA 5DUEA 3KMGA 2FSZA 1NQ0A 2ABIA 3VJIA 2I0JA 1R20D 1XLSA 1YOWA 3GN8A 5AZVA 1YIMA 1L2IA 4PXMA 2IHQA 2ZNPA 3AZ3A 3FURA 3WT7A 4OIUA 3R8AA 3E7CA 4UDCA 2W8YA 1R20A 4CSJA 4FHHA 1X78A 4JYHA 3B66A 3ZR7A 3ERDA 5AK2A 4IVYA 3FXVA 1QKTA 2ZK2A 5DXGA 5I4VA 1XB7A 1PCGA 1S0ZA 1PRGA 3K8SA 5DUGA 3E94A 3R5NA 4KZMA 4MG8B 4QE6A 5E7VA 3DY6A 3WJ5A 2QGTA 4J24A 4QL8A 4ZNHA 3OS8A 5EC9A 1T7TA 5KCDA 2AMBA 4OKTA 4RFWA 3A78A 5AAVB 5DKSA 4QE8A 3W0JA 3OSWA 2JFAB 4OIVA 4OEAA 2P1TA 3L0JA 4PPSA 5FQRA 2ZL9A 2VV1B 2QMVA 3WMHA 3OS9A 5APJA 1OSVA 3OMPA 2HVCA 2PIWA 2BAWA 2BJ4B 2PIQA 4FN9A 3D57A 1SR7A 3ADSA 5E1CA 5E14A 2ZBSA 3PLZA 4MGAB 5DKBA 3A3ZX 4MG5A 1SJ0A 1A52A 2ZNOA 4OZRE 5DXBA 2ZVTA 2Q1HA 2ACLA 4XI3A 4XT9A 1XDKA 1G5YA 5HCVA 2R6YA 3S9SA 1YP0A 3VJSA 2G44A 1ERRA 2I0GA 2VV4B 3VRTA 5L7EA 4PP5A 1PDUA 3WWRA 4OJ4A 4POHA 3ZRAA 3VTCA 3AN3A 2ZK6A 3HM1A 1QKMA 2Q60A 3FALB 4PPPA 4EM9A 3KMRA 3KDUA 2XYWA 3G8OA 5DZ3A 3UVVA 5M96A 3D24A 3BQDA 3W5TA 4DK7A 2P54A 4N8RA 1ZGYA 2QTUA 4LNWA 1X76A 3OS8C 3OSAA 3B0QA 4DORA 2HB7A 2ZNNA 2E2RA 2P15A 2Q8SA 5AWKA 3AUQA 1XV9B 1X7RA 1GS4A 2GPOA 2Q5SA 2ZK4A 4DOSA 2ZMJA 5KD9A 3V9TA 2ZXMA 4M8HA 4DM6A 3GWSX 5DXQA 2AA6A 3A2IA 3V9VA 1M13A 3CS4A 5L11A 3FEIA 5G42A 3UP3A 5DLRA 1K74A 3RVFA 3E00A 2Q6RA 3U9QA 3W0CA 5KRCA 5KCWA 1QKUA 1R6GA 3LMPA 1OSHA 3OMQA 1ZH7A 1IE9A 5G46A 3L0LA 3VT9A 4IQRA 3OMMA 2HAMA 3GBKA 4G20A 5L7HA 3F5CA 4CI4A 5LWPA 2R40A 2QA6A 2OM9A 4RUOX 5ICKA 5ETHA 5DV3A 1YOKA 2J7YA
chains in the Genus database with same CATH superfamily
2G0GA 1YJEA 1MV9A 3R8IA 3VRUA 2ZK3A 2HB8A 2I4PA 4TV1B 2HWQA 3RY9A 4CI5A 1T73A 4XLDA 5KRMA 4N5GA 3R8DA 3P0UA 1I7GA 3GZ9A 5KCFA 3KBAA 4QM0A 3L1BA 5KRKA 2QA8A 2P1UA 1Y0SA 2Q1VA 4TUZB 2HCDA 5LGAA 4OEZA 5HZCA 2NPAA 4G1YA 1NAXA 4IV4A 4QJRA 4ZNTA 2GP7A 4RUPA 3M7RA 2PIRA 4MG6A 5DX3A 2PIXA 1N4HA 4ITEA 1XP6A 3QT0A 4B7WA 2Q6SA 3OGTA 3CTBA 3OLFA 1UHLA 2HC4A 5DZHA 5G3JA 2IOKA 3UU7A 2Z4JA 4J5WA 1KV6A 4MG9A 1PZLA 1Y0XX 1G1UA 3AFRA 4JL4A 4PVUA 3NSQA 3UUDA 4RMEA 3AZ1A 1LBDA 1TXIA 3DT3A 5CJ6A 3H52A 5FQVA 3VT4A 5DP0A 2B1ZA 3CDSA 5AVIA 2ZY0A 3B1MA 3B65A 3VHUA 3OKIA 3KYTA 4X1GA 2P7AA 2AWHA 3R29A 1P93A 2ZMHA 3W5PA 1I38A 3V3QA 1DB1A 5DK9A 4MGBA 1G50A 1PQ9A 4HEEX 4RE8A 4UDAA 4ZNVA 5DVVA 4NQAB 1XLSE 5KRAA 2GL8A 3WFFA 2HWRA 4PF3A 3PBAA 4ONIA 1XQ3A 4OKWA 1Q4XA 3VTDA 3A9EA 3G0WA 1I7IA 1YINA 3KPZA 2VV2A 1NQ2A 4ZNSA 1XAPA 3X36A 3HVLA 3MNEA 2PITA 1ZAFA 1M7WA 2ZKCA 1I37A 3SZ1A 3AURA 3OLSA 4BCRA 5EGVA 2AYRA 2NW4A 4MGCA 2Q5GA 3G8IA 2VSTA 2QE4A 1A28A 4FNEA 5FQPA 4K6IA 3FUGA 1YUCA 4N73A 4R06A 5AZTA 5DVCA 1T79A 1FCYA 4J5WC 5KRFA 2JF9A 4P6WA 5DIGA 5JY3A 3VT6A 2XYJA 3L03A 3OKHA 5DIEA 3ADTA 2ZXZA 5AAVA 4LNXA 3TKCA 3HC5A 3FC6B 3UUCA 2AAXA 2JFAA 1K4WA 3A2JA 3Q95A 2I4JA 3UUAB 2LBDA 4OZTU 2P7ZA 4PRGA 1GWRA 3ADWA 4G2IA 4PP6A 2Q70A 2VV1A 5DZIA 5KRHA 3IPQA 1PQCA 1WM0X 2XHSA 2OCFA 2AMAA 2ZLCA 2BJ4A 4ZJWA 1GWXA 4X1FA 2Q59B 1NUOA 2YLOA 5FQSA 3UP0A 3AZ2A 2QR9A 3BEJA 3NOAA 4MGAA 3NSPA 1Z5XU 4S0TA 3PCUA 2Q61A 4OARA 2J4AA 4XUHA 2QZOB 5IXKA 1YA3A 1S0XA 3FEJA 3B5RA 5DZ1A 5HJPB 3VJHA 1NQ7A 4IA2A 2Q7IA 3A40X 3KDTA 3GWXA 3HODA 5SYZA 4JYGA 2HASA 2VV4A 2O9IA 4YT1A 1Y9RA 3VSOA 2I4ZA 2OVMA 4FGYA 2QW4A 3FALA 3VT5A 1EREA 2ZLAA 1S19A 5E0XA 1K74D 1T7MA 2HARA 2VV3A 3E00D 2OUZA 3ET3A 1P8DA 3KMZA 4S15A 4LSJA 1RDTD 4WHGA 5DRMA 1RJKA 2ZK1A 1NYXA 4MGDB 5GIDA 4XTAA 1XV9A 5G44A 4WLBA 2GPUA 1ZKYA 1IE8A 5DRJA 5KRJA 1RDTA 4REFA 3DZUD 3B0RA 5AVLA 2IOGA 2R40D 4G2HA 4OH5A 4OLMA 2QNVA 5DYDA 4RUJA 4ZNUA 5B41A 3BC5A 3DR1A 4OJBA 4YMQA 3DZUA 4RZFA 1H9UA 2ZNQA 1T63A 4UDDA 1R1KA 2XYXA 1RK3A 1EXAA 4RMCA 4RZGA 1BSXA 4R2UA 4ZO1B 4PLEA 5KRLA 1YMTA 4G1DA 4LBDA 4XUMA 3TX7B 3O1DA 5KYAA 4OKXA 3VRVA 1XOWA 3P89A 3ZQTA 1U9EA 2O4JA 3FS1A 1FM6A 5APHA 1NHZA 1U3RA 2B50A 2AXAA 1QKNA 3IA6A 5G45A 3W0HA 1MVCA 5F9BA 2QABA 2NV7A 2QSEA 2AA2A 5GT4A 5EHJA 2QGWA 2Q7LA 2Q6JA 4JAZA 1XVPB 4TV1A 1OVLB 2Q7KA 3OAPA 4OEDA 3V49A 3CJWA 3ZRBA 1FD0A 4DM8A 1ILGA 2ATHA 2VSRA 5APKA 3R5MA 1N83A 1RKGA 1XNNA 1DKFA 3L0EA 3OLLA 2P7GA 1SQNA 4NIEA 1FCXA 4NB6A 4MG7B 4R6SA 3R2AA 2POBA 2J7XA 3ERTA 4TUZA 2PIUA 2AO6A 5DSHA 2NXXA 3IPUA 3RLJA 1EXXA 2PRGA 2NXXE 1FCZA 2ZK0A 1U3SA 1YY4A 1KNUA 5DU5A 4ZI1A 3ET0A 3WJ4A 5G43A 4KZIA 2G0HA 4NUFA 5JJMB 2Q7JA 5HYRA 5DUHA 2P1VA 4L98A 3HLVA 5DMFA 5DZ0A 5G5WA 1YYEA 5FQTA 4RZEA 1PK5A 5DMCA 5DWEA 4E4KA 1XIUA 4Q13A 2P4YA 4WHFA 3DCUA 4JYIA 4JGVA 5GIEA 5IAWA 3OOFA 3B3KA 4F9MA 4PLDA 5HJSA 3L3XA 4XAOA 2AM9A 3N00A 4PWLA 1TFCA 5DXEA 3X31A 1X7BA 3OZ0A 5ACCA 3B0TA 2FAIA 1NAVA 3IPSA 3OMOA 5DVSA 1M2ZA 2R6WA 3X1HA 4UDBA 1VJBA 5KCTA 3G9EA 2QXSA 3DZYA 2YJDA 4YNKA 4S14A 1ZDUA 5HYKA 4E4QA 3LBDA 1ZUCA 4IW8A 5E15A 4KZJA 3WTQA 4OEYA 3V4AA 1XP1A 4RWVA 5EI1A 1UPVA 3HO0A 4FHIA 5DWIA 3WFGA 3L3ZA 3VT8A 4MG8A 4O8FA 3VT3A 2GPPA 2JJ3A 2OAXA 3V9YA 4IWFA 3T03A 5KCUA 5KRIA 4N1YA 3W0AA 3F7DA 4WVDA 2A3IA 5AYGA 2B1VA 2AB2A 1NQ1A 1MZNA 2ZXNA 3WGPA 2V7CA 3CS8A 5A86A 5DXMA 4IVWA 5L7GA 3RUTA 4M8EA 2EWPA 3GD2A 3H0AD 4IV2A 4MDDA 3SP6A 1GWQA 1XZXX 3IXPD 4OZTE 4ZN9A 4OC7A 3W5QA 3A2HA 2Q5PA 3HZFA 4IA3A 5JI0D 3FC6A 4ZN7A 3K23A 3VRWA 3H0AA 5C4OA 3UUAA 3IXPA 3K6PA 3Q95B 5C4SA 2PKLA 1X7JA 2YFEA 2V0VA 1XJ7A 2HBHA 5C4UA 1S9QA 4IS8A 5KCCA 4HLWA 4IA7A 5DXBB 3PRGA 1G2NA 1Z5XE 2ACLB 2PIOA 3TY0A 1XDKB 2Q59A 1FM9D 4IA1A 4ZNWA 4ITFA 1XPCA 2F4BA 1FBYA 4OZRU 1OT7A 3W0IA 2Z4BA 3WT6A 5DXKA 2GWXA 4E2JA 1T7FA 2QZOA 3P8XA 1FM9A 5DWLA 2YJAB 5AWJA 5HJPA 4YPQA 2YATA 5DIDA 3W0YA 4G1ZA 2PJLA 4RAKA 1KKQA 3UVVB 2YLQA 4OGHA 5DV8A 2J14A 3OSIA 4OK1A 2XKWA 4NY9A 5E0WA 3GYTA 2QPYA 5EITA 3JZBA 2Q3YA 3B67A 1X7EA 2YHDA 4OFRA 2B23A 2PIVA 1L2JA 1NDEA 4DMAA 1PQ6A 5E19A 5EJVA 4PP3A 1E3KA 1R1KD 4L96A 3W0GA 2GPVA 3W5RA 2QH6A 4REEA 1XNXA 3D90A 4MGDA 5DI7A 4P6XA 5DY8A 4J5XA 4OFUA 1ZDTA 3VJTA 2GIUA 1FM6D 4G21A 4DK8A 2AA5A 1HG4A 1XQCA 5IZ0A 2YLYA 3SP9A 3VHVA 5AAUA 2VV0A 4OILA 4WQPA 3PEQA 2REWA 4WPFA 2OZ7A 1K7LA 3RLLA 5DKGA 5DL4A 5B5BA 3ADXA 2ZFXA 4ZO1X 3F5CB 3OOKA 2HFPA 3HQ5A 4OH6A 5DV6A 5DWJA 4DQMA 4OJ9A 3GYUA 3VT7A 3RUUA 2AA7A 1Z95A 4IUIA 2AX7A 3CQVA 3VSPA 5DKEA 5KYJA 5K13A 2FVJA 3CS6A 5KROA 1U3QA 3VHWA 3VI8A 2O4RA 2PINA 1HJ1A 2PNUA 3O1EA 3X1IA 4IU7A 3DCTA 3AN4A 4ZJRA 3ET1A 5H1EA 2AX9A 1T65A 2ZK5A 3B68A 1T7RA 2QA8B 3FLIA 4J26A 1T5ZA 5C4TA 1ILHA 3D6DA 1XVPA 3JZCA 4APUA 1OVLA 3VN2A 5DXPA 2ZMIA 4IW6A 2GTKA 1S9PA 1DKFB 5DX3B 3CDPA 3B0WA 4MG7A 1RKHA 4POJA 4K7AA 1UPWA 1R5KA 2YLPA 3PO9A 4S0SA 3VTBA 3WT5A 2OVHA 3D5FA 2AX8A 3AX8A 1UHLB 3HC6A 3OZJA 4J5XC 2H77A 3TKMA 3V3EA 3UU7B 1T76A 5KR9A 3CWDA 4MG9B 3ET2A 5JJMA 3K22A 3KWYA 3IMYA 3UUDB 2AX6A 4Q50A 4A4WA 1N46A 5KCEA 1UOMA 3MNOA 4QK4A 3AUNA 2ZASA 4A4VA 3KFCA 4Q0AC 4XHDA 3DZYD 3ILZA 4OHAA 5DTVA 3OMKA 1LV2A 4EMAA 5GICA 3EYBA 2QXMA 4Y29A 4RMDA 1E3GA 3CLDA 1T74A 4MGBB 5DXRA 1NRLA 3ADUA 3MNPA 2H79A 4A2JA 5DWGA 4OKBA 1XP9A 4K4JA 2POGA 2G5OA 4IWCA 5DYBA 3P88A 2PIPL 4LTWA 4ZOMA 1SKXA 1ZEOA 3A9EB 3ADVA 5DUEA 3KMGA 2FSZA 1NQ0A 2ABIA 3VJIA 2I0JA 1R20D 1XLSA 1YOWA 3GN8A 5AZVA 1YIMA 1L2IA 4PXMA 2IHQA 2ZNPA 3AZ3A 3FURA 3WT7A 4OIUA 3R8AA 3E7CA 4UDCA 2W8YA 1R20A 4CSJA 4FHHA 1X78A 4JYHA 3B66A 3ZR7A 3ERDA 5AK2A 4IVYA 3FXVA 1QKTA 2ZK2A 5DXGA 5I4VA 1XB7A 1PCGA 1S0ZA 1PRGA 3K8SA 5DUGA 3E94A 3R5NA 4KZMA 4MG8B 4QE6A 5E7VA 3DY6A 3WJ5A 2QGTA 4J24A 4QL8A 4ZNHA 3OS8A 5EC9A 1T7TA 5KCDA 2AMBA 4OKTA 4RFWA 3A78A 5AAVB 5DKSA 4QE8A 3W0JA 3OSWA 2JFAB 4OIVA 4OEAA 2P1TA 3L0JA 4PPSA 5FQRA 2ZL9A 2VV1B 2QMVA 3WMHA 3OS9A 5APJA 1OSVA 3OMPA 2HVCA 2PIWA 2BAWA 2BJ4B 2PIQA 4FN9A 3D57A 1SR7A 3ADSA 5E1CA 5E14A 2ZBSA 3PLZA 4MGAB 5DKBA 3A3ZX 4MG5A 1SJ0A 1A52A 2ZNOA 4OZRE 5DXBA 2ZVTA 2Q1HA 2ACLA 4XI3A 4XT9A 1XDKA 1G5YA 5HCVA 2R6YA 3S9SA 1YP0A 3VJSA 2G44A 1ERRA 2I0GA 2VV4B 3VRTA 5L7EA 4PP5A 1PDUA 3WWRA 4OJ4A 4POHA 3ZRAA 3VTCA 3AN3A 2ZK6A 3HM1A 1QKMA 2Q60A 3FALB 4PPPA 4EM9A 3KMRA 3KDUA 2XYWA 3G8OA 5DZ3A 3UVVA 5M96A 3D24A 3BQDA 3W5TA 4DK7A 2P54A 4N8RA 1ZGYA 2QTUA 4LNWA 1X76A 3OS8C 3OSAA 3B0QA 4DORA 2HB7A 2ZNNA 2E2RA 2P15A 2Q8SA 5AWKA 3AUQA 1XV9B 1X7RA 1GS4A 2GPOA 2Q5SA 2ZK4A 4DOSA 2ZMJA 5KD9A 3V9TA 2ZXMA 4M8HA 4DM6A 3GWSX 5DXQA 2AA6A 3A2IA 3V9VA 1M13A 3CS4A 5L11A 3FEIA 5G42A 3UP3A 5DLRA 1K74A 3RVFA 3E00A 2Q6RA 3U9QA 3W0CA 5KRCA 5KCWA 1QKUA 1R6GA 3LMPA 1OSHA 3OMQA 1ZH7A 1IE9A 5G46A 3L0LA 3VT9A 4IQRA 3OMMA 2HAMA 3GBKA 4G20A 5L7HA 3F5CA 4CI4A 5LWPA 2R40A 2QA6A 2OM9A 4RUOX 5ICKA 5ETHA 5DV3A 1YOKA 2J7YA
chains in the Genus database with same CATH topology
2G0GA 1YJEA 1MV9A 3R8IA 3VRUA 2ZK3A 2HB8A 2I4PA 4TV1B 2HWQA 3RY9A 4CI5A 1T73A 4XLDA 5KRMA 4N5GA 3R8DA 3P0UA 1I7GA 3GZ9A 5KCFA 3KBAA 4QM0A 3L1BA 5KRKA 2QA8A 2P1UA 1Y0SA 2Q1VA 4TUZB 2HCDA 5LGAA 4OEZA 5HZCA 2NPAA 4G1YA 1NAXA 4IV4A 4QJRA 4ZNTA 2GP7A 4RUPA 3M7RA 2PIRA 4MG6A 5DX3A 2PIXA 1N4HA 4ITEA 1XP6A 3QT0A 4B7WA 2Q6SA 3OGTA 3CTBA 3OLFA 1UHLA 2HC4A 5DZHA 5G3JA 2IOKA 3UU7A 2Z4JA 4J5WA 1KV6A 4MG9A 1PZLA 1Y0XX 1G1UA 3AFRA 4JL4A 4PVUA 3NSQA 3UUDA 4RMEA 3AZ1A 1LBDA 1TXIA 3DT3A 5CJ6A 3H52A 5FQVA 3VT4A 5DP0A 2B1ZA 3CDSA 5AVIA 2ZY0A 3B1MA 3B65A 3VHUA 3OKIA 3KYTA 4X1GA 2P7AA 2AWHA 3R29A 1P93A 2ZMHA 3W5PA 1I38A 3V3QA 1DB1A 5DK9A 4MGBA 1G50A 1PQ9A 4HEEX 4RE8A 4UDAA 4ZNVA 5DVVA 4NQAB 1XLSE 5KRAA 2GL8A 3WFFA 2HWRA 4PF3A 3PBAA 4ONIA 1XQ3A 4OKWA 1Q4XA 3VTDA 3A9EA 3G0WA 1I7IA 1YINA 3KPZA 2VV2A 1NQ2A 4ZNSA 1XAPA 3X36A 3HVLA 3MNEA 2PITA 1ZAFA 1M7WA 2ZKCA 1I37A 3SZ1A 3AURA 3OLSA 4BCRA 5EGVA 2AYRA 2NW4A 4MGCA 2Q5GA 3G8IA 2VSTA 2QE4A 1A28A 4FNEA 5FQPA 4K6IA 3FUGA 1YUCA 4N73A 4R06A 5AZTA 5DVCA 1T79A 1FCYA 4J5WC 5KRFA 2JF9A 4P6WA 5DIGA 5JY3A 3VT6A 2XYJA 3L03A 3OKHA 5DIEA 3ADTA 2ZXZA 5AAVA 4LNXA 3TKCA 3HC5A 3FC6B 3UUCA 2AAXA 2JFAA 1K4WA 3A2JA 3Q95A 2I4JA 3UUAB 2LBDA 4OZTU 2P7ZA 4PRGA 1GWRA 3ADWA 4G2IA 4PP6A 2Q70A 2VV1A 5DZIA 5KRHA 3IPQA 1PQCA 1WM0X 2XHSA 2OCFA 2AMAA 2ZLCA 2BJ4A 4ZJWA 1GWXA 4X1FA 2Q59B 1NUOA 2YLOA 5FQSA 3UP0A 3AZ2A 2QR9A 3BEJA 3NOAA 4MGAA 3NSPA 1Z5XU 4S0TA 3PCUA 2Q61A 4OARA 2J4AA 4XUHA 2QZOB 5IXKA 1YA3A 1S0XA 3FEJA 3B5RA 5DZ1A 5HJPB 3VJHA 1NQ7A 4IA2A 2Q7IA 3A40X 3KDTA 3GWXA 3HODA 5SYZA 4JYGA 2HASA 2VV4A 2O9IA 4YT1A 1Y9RA 3VSOA 2I4ZA 2OVMA 4FGYA 2QW4A 3FALA 3VT5A 1EREA 2ZLAA 1S19A 5E0XA 1K74D 1T7MA 2HARA 2VV3A 3E00D 2OUZA 3ET3A 1P8DA 3KMZA 4S15A 4LSJA 1RDTD 4WHGA 5DRMA 1RJKA 2ZK1A 1NYXA 4MGDB 5GIDA 4XTAA 1XV9A 5G44A 4WLBA 2GPUA 1ZKYA 1IE8A 5DRJA 5KRJA 1RDTA 4REFA 3DZUD 3B0RA 5AVLA 2IOGA 2R40D 4G2HA 4OH5A 4OLMA 2QNVA 5DYDA 4RUJA 4ZNUA 5B41A 3BC5A 3DR1A 4OJBA 4YMQA 3DZUA 4RZFA 1H9UA 2ZNQA 1T63A 4UDDA 1R1KA 2XYXA 1RK3A 1EXAA 4RMCA 4RZGA 1BSXA 4R2UA 4ZO1B 4PLEA 5KRLA 1YMTA 4G1DA 4LBDA 4XUMA 3TX7B 3O1DA 5KYAA 4OKXA 3VRVA 1XOWA 3P89A 3ZQTA 1U9EA 2O4JA 3FS1A 1FM6A 5APHA 1NHZA 1U3RA 2B50A 2AXAA 1QKNA 3IA6A 5G45A 3W0HA 1MVCA 5F9BA 2QABA 2NV7A 2QSEA 2AA2A 5GT4A 5EHJA 2QGWA 2Q7LA 2Q6JA 4JAZA 1XVPB 4TV1A 1OVLB 2Q7KA 3OAPA 4OEDA 3V49A 3CJWA 3ZRBA 1FD0A 4DM8A 1ILGA 2ATHA 2VSRA 5APKA 3R5MA 1N83A 1RKGA 1XNNA 1DKFA 3L0EA 3OLLA 2P7GA 1SQNA 4NIEA 1FCXA 4NB6A 4MG7B 4R6SA 3R2AA 2POBA 2J7XA 3ERTA 4TUZA 2PIUA 2AO6A 5DSHA 2NXXA 3IPUA 3RLJA 1EXXA 2PRGA 2NXXE 1FCZA 2ZK0A 1U3SA 1YY4A 1KNUA 5DU5A 4ZI1A 3ET0A 3WJ4A 5G43A 4KZIA 2G0HA 4NUFA 5JJMB 2Q7JA 5HYRA 5DUHA 2P1VA 4L98A 3HLVA 5DMFA 5DZ0A 5G5WA 1YYEA 5FQTA 4RZEA 1PK5A 5DMCA 5DWEA 4E4KA 1XIUA 4Q13A 2P4YA 4WHFA 3DCUA 4JYIA 4JGVA 5GIEA 5IAWA 3OOFA 3B3KA 4F9MA 4PLDA 5HJSA 3L3XA 4XAOA 2AM9A 3N00A 4PWLA 1TFCA 5DXEA 3X31A 1X7BA 3OZ0A 5ACCA 3B0TA 2FAIA 1NAVA 3IPSA 3OMOA 5DVSA 1M2ZA 2R6WA 3X1HA 4UDBA 1VJBA 5KCTA 3G9EA 2QXSA 3DZYA 2YJDA 4YNKA 4S14A 1ZDUA 5HYKA 4E4QA 3LBDA 1ZUCA 4IW8A 5E15A 4KZJA 3WTQA 4OEYA 3V4AA 1XP1A 4RWVA 5EI1A 1UPVA 3HO0A 4FHIA 5DWIA 3WFGA 3L3ZA 3VT8A 4MG8A 4O8FA 3VT3A 2GPPA 2JJ3A 2OAXA 3V9YA 4IWFA 3T03A 5KCUA 5KRIA 4N1YA 3W0AA 3F7DA 4WVDA 2A3IA 5AYGA 2B1VA 2AB2A 1NQ1A 1MZNA 2ZXNA 3WGPA 2V7CA 3CS8A 5A86A 5DXMA 4IVWA 5L7GA 3RUTA 4M8EA 2EWPA 3GD2A 3H0AD 4IV2A 4MDDA 3SP6A 1GWQA 1XZXX 3IXPD 4OZTE 4ZN9A 4OC7A 3W5QA 3A2HA 2Q5PA 3HZFA 4IA3A 5JI0D 3FC6A 4ZN7A 3K23A 3VRWA 3H0AA 5C4OA 3UUAA 3IXPA 3K6PA 3Q95B 5C4SA 2PKLA 1X7JA 2YFEA 2V0VA 1XJ7A 2HBHA 5C4UA 1S9QA 4IS8A 5KCCA 4HLWA 4IA7A 5DXBB 3PRGA 1G2NA 1Z5XE 2ACLB 2PIOA 3TY0A 1XDKB 2Q59A 1FM9D 4IA1A 4ZNWA 4ITFA 1XPCA 2F4BA 1FBYA 4OZRU 1OT7A 3W0IA 2Z4BA 3WT6A 5DXKA 2GWXA 4E2JA 1T7FA 2QZOA 3P8XA 1FM9A 5DWLA 2YJAB 5AWJA 5HJPA 4YPQA 2YATA 5DIDA 3W0YA 4G1ZA 2PJLA 4RAKA 1KKQA 3UVVB 2YLQA 4OGHA 5DV8A 2J14A 3OSIA 4OK1A 2XKWA 4NY9A 5E0WA 3GYTA 2QPYA 5EITA 3JZBA 2Q3YA 3B67A 1X7EA 2YHDA 4OFRA 2B23A 2PIVA 1L2JA 1NDEA 4DMAA 1PQ6A 5E19A 5EJVA 4PP3A 1E3KA 1R1KD 4L96A 3W0GA 2GPVA 3W5RA 2QH6A 4REEA 1XNXA 3D90A 4MGDA 5DI7A 4P6XA 5DY8A 4J5XA 4OFUA 1ZDTA 3VJTA 2GIUA 1FM6D 4G21A 4DK8A 2AA5A 1HG4A 1XQCA 5IZ0A 2YLYA 3SP9A 3VHVA 5AAUA 2VV0A 4OILA 4WQPA 3PEQA 2REWA 4WPFA 2OZ7A 1K7LA 3RLLA 5DKGA 5DL4A 5B5BA 3ADXA 2ZFXA 4ZO1X 3F5CB 3OOKA 2HFPA 3HQ5A 4OH6A 5DV6A 5DWJA 4DQMA 4OJ9A 3GYUA 3VT7A 3RUUA 2AA7A 1Z95A 4IUIA 2AX7A 3CQVA 3VSPA 5DKEA 5KYJA 5K13A 2FVJA 3CS6A 5KROA 1U3QA 3VHWA 3VI8A 2O4RA 2PINA 1HJ1A 2PNUA 3O1EA 3X1IA 4IU7A 3DCTA 3AN4A 4ZJRA 3ET1A 5H1EA 2AX9A 1T65A 2ZK5A 3B68A 1T7RA 2QA8B 3FLIA 4J26A 1T5ZA 5C4TA 1ILHA 3D6DA 1XVPA 3JZCA 4APUA 1OVLA 3VN2A 5DXPA 2ZMIA 4IW6A 2GTKA 1S9PA 1DKFB 5DX3B 3CDPA 3B0WA 4MG7A 1RKHA 4POJA 4K7AA 1UPWA 1R5KA 2YLPA 3PO9A 4S0SA 3VTBA 3WT5A 2OVHA 3D5FA 2AX8A 3AX8A 1UHLB 3HC6A 3OZJA 4J5XC 2H77A 3TKMA 3V3EA 3UU7B 1T76A 5KR9A 3CWDA 4MG9B 3ET2A 5JJMA 3K22A 3KWYA 3IMYA 3UUDB 2AX6A 4Q50A 4A4WA 1N46A 5KCEA 1UOMA 3MNOA 4QK4A 3AUNA 2ZASA 4A4VA 3KFCA 4Q0AC 4XHDA 3DZYD 3ILZA 4OHAA 5DTVA 3OMKA 1LV2A 4EMAA 5GICA 3EYBA 2QXMA 4Y29A 4RMDA 1E3GA 3CLDA 1T74A 4MGBB 5DXRA 1NRLA 3ADUA 3MNPA 2H79A 4A2JA 5DWGA 4OKBA 1XP9A 4K4JA 2POGA 2G5OA 4IWCA 5DYBA 3P88A 2PIPL 4LTWA 4ZOMA 1SKXA 1ZEOA 3A9EB 3ADVA 5DUEA 3KMGA 2FSZA 1NQ0A 2ABIA 3VJIA 2I0JA 1R20D 1XLSA 1YOWA 3GN8A 5AZVA 1YIMA 1L2IA 4PXMA 2IHQA 2ZNPA 3AZ3A 3FURA 3WT7A 4OIUA 3R8AA 3E7CA 4UDCA 2W8YA 1R20A 4CSJA 4FHHA 1X78A 4JYHA 3B66A 3ZR7A 3ERDA 5AK2A 4IVYA 3FXVA 1QKTA 2ZK2A 5DXGA 5I4VA 1XB7A 1PCGA 1S0ZA 1PRGA 3K8SA 5DUGA 3E94A 3R5NA 4KZMA 4MG8B 4QE6A 5E7VA 3DY6A 3WJ5A 2QGTA 4J24A 4QL8A 4ZNHA 3OS8A 5EC9A 1T7TA 5KCDA 2AMBA 4OKTA 4RFWA 3A78A 5AAVB 5DKSA 4QE8A 3W0JA 3OSWA 2JFAB 4OIVA 4OEAA 2P1TA 3L0JA 4PPSA 5FQRA 2ZL9A 2VV1B 2QMVA 3WMHA 3OS9A 5APJA 1OSVA 3OMPA 2HVCA 2PIWA 2BAWA 2BJ4B 2PIQA 4FN9A 3D57A 1SR7A 3ADSA 5E1CA 5E14A 2ZBSA 3PLZA 4MGAB 5DKBA 3A3ZX 4MG5A 1SJ0A 1A52A 2ZNOA 4OZRE 5DXBA 2ZVTA 2Q1HA 2ACLA 4XI3A 4XT9A 1XDKA 1G5YA 5HCVA 2R6YA 3S9SA 1YP0A 3VJSA 2G44A 1ERRA 2I0GA 2VV4B 3VRTA 5L7EA 4PP5A 1PDUA 3WWRA 4OJ4A 4POHA 3ZRAA 3VTCA 3AN3A 2ZK6A 3HM1A 1QKMA 2Q60A 3FALB 4PPPA 4EM9A 3KMRA 3KDUA 2XYWA 3G8OA 5DZ3A 3UVVA 5M96A 3D24A 3BQDA 3W5TA 4DK7A 2P54A 4N8RA 1ZGYA 2QTUA 4LNWA 1X76A 3OS8C 3OSAA 3B0QA 4DORA 2HB7A 2ZNNA 2E2RA 2P15A 2Q8SA 5AWKA 3AUQA 1XV9B 1X7RA 1GS4A 2GPOA 2Q5SA 2ZK4A 4DOSA 2ZMJA 5KD9A 3V9TA 2ZXMA 4M8HA 4DM6A 3GWSX 5DXQA 2AA6A 3A2IA 3V9VA 1M13A 3CS4A 5L11A 3FEIA 5G42A 3UP3A 5DLRA 1K74A 3RVFA 3E00A 2Q6RA 3U9QA 3W0CA 5KRCA 5KCWA 1QKUA 1R6GA 3LMPA 1OSHA 3OMQA 1ZH7A 1IE9A 5G46A 3L0LA 3VT9A 4IQRA 3OMMA 2HAMA 3GBKA 4G20A 5L7HA 3F5CA 4CI4A 5LWPA 2R40A 2QA6A 2OM9A 4RUOX 5ICKA 5ETHA 5DV3A 1YOKA 2J7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0G A;  1YJE A;  1MV9 A;  3R8I A;  3VRU A;  2ZK3 A;  2HB8 A;  2I4P A;  4TV1 B;  2HWQ A;  3RY9 A;  4CI5 A;  1T73 A;  4XLD A;  5KRM A;  4N5G A;  3R8D A;  3P0U A;  1I7G A;  3GZ9 A;  5KCF A;  3KBA A;  4QM0 A;  3L1B A;  5KRK A;  2QA8 A;  2P1U A;  1Y0S A;  2Q1V A;  4TUZ B;  2HCD A;  5LGA A;  4OEZ A;  5HZC A;  2NPA A;  4G1Y A;  1NAX A;  4IV4 A;  4QJR A;  4ZNT A;  2GP7 A;  4RUP A;  3M7R A;  2PIR A;  4MG6 A;  5DX3 A;  2PIX A;  1N4H A;  4ITE A;  1XP6 A;  3QT0 A;  4B7W A;  2Q6S A;  3OGT A;  3CTB A;  3OLF A;  1UHL A;  2HC4 A;  5DZH A;  5G3J A;  2IOK A;  3UU7 A;  2Z4J A;  4J5W A;  1KV6 A;  4MG9 A;  1PZL A;  1Y0X X;  1G1U A;  3AFR A;  4JL4 A;  4PVU A;  3NSQ A;  3UUD A;  4RME A;  3AZ1 A;  1LBD A;  1TXI A;  3DT3 A;  5CJ6 A;  3H52 A;  5FQV A;  3VT4 A;  5DP0 A;  2B1Z A;  3CDS A;  5AVI A;  2ZY0 A;  3B1M A;  3B65 A;  3VHU A;  3OKI A;  3KYT A;  4X1G A;  2P7A A;  2AWH A;  3R29 A;  1P93 A;  2ZMH A;  3W5P A;  1I38 A;  3V3Q A;  1DB1 A;  5DK9 A;  4MGB A;  1G50 A;  1PQ9 A;  4HEE X;  4RE8 A;  4UDA A;  4ZNV A;  5DVV A;  4NQA B;  1XLS E;  5KRA A;  2GL8 A;  3WFF A;  2HWR A;  4PF3 A;  3PBA A;  4ONI A;  1XQ3 A;  4OKW A;  1Q4X A;  3VTD A;  3A9E A;  3G0W A;  1I7I A;  1YIN A;  3KPZ A;  2VV2 A;  1NQ2 A;  4ZNS A;  1XAP A;  3X36 A;  3HVL A;  3MNE A;  2PIT A;  1ZAF A;  1M7W A;  2ZKC A;  1I37 A;  3SZ1 A;  3AUR A;  3OLS A;  4BCR A;  5EGV A;  2AYR A;  2NW4 A;  4MGC A;  2Q5G A;  3G8I A;  2VST A;  2QE4 A;  1A28 A;  4FNE A;  5FQP A;  4K6I A;  3FUG A;  1YUC A;  4N73 A;  4R06 A;  5AZT A;  5DVC A;  1T79 A;  1FCY A;  4J5W C;  5KRF A;  2JF9 A;  4P6W A;  5DIG A;  5JY3 A;  3VT6 A;  2XYJ A;  3L03 A;  3OKH A;  5DIE A;  3ADT A;  2ZXZ A;  5AAV A;  4LNX A;  3TKC A;  3HC5 A;  3FC6 B;  3UUC A;  2AAX A;  2JFA A;  1K4W A;  3A2J A;  3Q95 A;  2I4J A;  3UUA B;  2LBD A;  4OZT U;  2P7Z A;  4PRG A;  1GWR A;  3ADW A;  4G2I A;  4PP6 A;  2Q70 A;  2VV1 A;  5DZI A;  5KRH A;  3IPQ A;  1PQC A;  1WM0 X;  2XHS A;  2OCF A;  2AMA A;  2ZLC A;  2BJ4 A;  4ZJW A;  1GWX A;  4X1F A;  2Q59 B;  1NUO A;  2YLO A;  5FQS A;  3UP0 A;  3AZ2 A;  2QR9 A;  3BEJ A;  3NOA A;  4MGA A;  3NSP A;  1Z5X U;  4S0T A;  3PCU A;  2Q61 A;  4OAR A;  2J4A A;  4XUH A;  2QZO B;  5IXK A;  1YA3 A;  1S0X A;  3FEJ A;  3B5R A;  5DZ1 A;  5HJP B;  3VJH A;  1NQ7 A;  4IA2 A;  2Q7I A;  3A40 X;  3KDT A;  3GWX A;  3HOD A;  5SYZ A;  4JYG A;  2HAS A;  2VV4 A;  2O9I A;  4YT1 A;  1Y9R A;  3VSO A;  2I4Z A;  2OVM A;  4FGY A;  2QW4 A;  3FAL A;  3VT5 A;  1ERE A;  2ZLA A;  1S19 A;  5E0X A;  1K74 D;  1T7M A;  2HAR A;  2VV3 A;  3E00 D;  2OUZ A;  3ET3 A;  1P8D A;  3KMZ A;  4S15 A;  4LSJ A;  1RDT D;  4WHG A;  5DRM A;  1RJK A;  2ZK1 A;  1NYX A;  4MGD B;  5GID A;  4XTA A;  1XV9 A;  5G44 A;  4WLB A;  2GPU A;  1ZKY A;  1IE8 A;  5DRJ A;  5KRJ A;  1RDT A;  4REF A;  3DZU D;  3B0R A;  5AVL A;  2IOG A;  2R40 D;  4G2H A;  4OH5 A;  4OLM A;  2QNV A;  5DYD A;  4RUJ A;  4ZNU A;  5B41 A;  3BC5 A;  3DR1 A;  4OJB A;  4YMQ A;  3DZU A;  4RZF A;  1H9U A;  2ZNQ A;  1T63 A;  4UDD A;  1R1K A;  2XYX A;  1RK3 A;  1EXA A;  4RMC A;  4RZG A;  1BSX A;  4R2U A;  4ZO1 B;  4PLE A;  5KRL A;  1YMT A;  4G1D A;  4LBD A;  4XUM A;  3TX7 B;  3O1D A;  5KYA A;  4OKX A;  3VRV A;  1XOW A;  3P89 A;  3ZQT A;  1U9E A;  2O4J A;  3FS1 A;  1FM6 A;  5APH A;  1NHZ A;  1U3R A;  2B50 A;  2AXA A;  1QKN A;  3IA6 A;  5G45 A;  3W0H A;  1MVC A;  5F9B A;  2QAB A;  2NV7 A;  2QSE A;  2AA2 A;  5GT4 A;  5EHJ A;  2QGW A;  2Q7L A;  2Q6J A;  4JAZ A;  1XVP B;  4TV1 A;  1OVL B;  2Q7K A;  3OAP A;  4OED A;  3V49 A;  3CJW A;  3ZRB A;  1FD0 A;  4DM8 A;  1ILG A;  2ATH A;  2VSR A;  5APK A;  3R5M A;  1N83 A;  1RKG A;  1XNN A;  1DKF A;  3L0E A;  3OLL A;  2P7G A;  1SQN A;  4NIE A;  1FCX A;  4NB6 A;  4MG7 B;  4R6S A;  3R2A A;  2POB A;  2J7X A;  3ERT A;  4TUZ A;  2PIU A;  2AO6 A;  5DSH A;  2NXX A;  3IPU A;  3RLJ A;  1EXX A;  2PRG A;  2NXX E;  1FCZ A;  2ZK0 A;  1U3S A;  1YY4 A;  1KNU A;  5DU5 A;  4ZI1 A;  3ET0 A;  3WJ4 A;  5G43 A;  4KZI A;  2G0H A;  4NUF A;  5JJM B;  2Q7J A;  5HYR A;  5DUH A;  2P1V A;  4L98 A;  3HLV A;  5DMF A;  5DZ0 A;  5G5W A;  1YYE A;  5FQT A;  4RZE A;  1PK5 A;  5DMC A;  5DWE A;  4E4K A;  1XIU A;  4Q13 A;  2P4Y A;  4WHF A;  3DCU A;  4JYI A;  4JGV A;  5GIE A;  5IAW A;  3OOF A;  3B3K A;  4F9M A;  4PLD A;  5HJS A;  3L3X A;  4XAO A;  2AM9 A;  3N00 A;  4PWL A;  1TFC A;  5DXE A;  3X31 A;  1X7B A;  3OZ0 A;  5ACC A;  3B0T A;  2FAI A;  1NAV A;  3IPS A;  3OMO A;  5DVS A;  1M2Z A;  2R6W A;  3X1H A;  4UDB A;  1VJB A;  5KCT A;  3G9E A;  2QXS A;  3DZY A;  2YJD A;  4YNK A;  4S14 A;  1ZDU A;  5HYK A;  4E4Q A;  3LBD A;  1ZUC A;  4IW8 A;  5E15 A;  4KZJ A;  3WTQ A;  4OEY A;  3V4A A;  1XP1 A;  4RWV A;  5EI1 A;  1UPV A;  3HO0 A;  4FHI A;  5DWI A;  3WFG A;  3L3Z A;  3VT8 A;  4MG8 A;  4O8F A;  3VT3 A;  2GPP A;  2JJ3 A;  2OAX A;  3V9Y A;  4IWF A;  3T03 A;  5KCU A;  5KRI A;  4N1Y A;  3W0A A;  3F7D A;  4WVD A;  2A3I A;  5AYG A;  2B1V A;  2AB2 A;  1NQ1 A;  1MZN A;  2ZXN A;  3WGP A;  2V7C A;  3CS8 A;  5A86 A;  5DXM A;  4IVW A;  5L7G A;  3RUT A;  4M8E A;  2EWP A;  3GD2 A;  3H0A D;  4IV2 A;  4MDD A;  3SP6 A;  1GWQ A;  1XZX X;  3IXP D;  4OZT E;  4ZN9 A;  4OC7 A;  3W5Q A;  3A2H A;  2Q5P A;  3HZF A;  4IA3 A;  5JI0 D;  3FC6 A;  4ZN7 A;  3K23 A;  3VRW A;  3H0A A;  5C4O A;  3UUA A;  3IXP A;  3K6P A;  3Q95 B;  5C4S A;  2PKL A;  1X7J A;  2YFE A;  2V0V A;  1XJ7 A;  2HBH A;  5C4U A;  1S9Q A;  4IS8 A;  5KCC A;  4HLW A;  4IA7 A;  5DXB B;  3PRG A;  1G2N A;  1Z5X E;  2ACL B;  2PIO A;  3TY0 A;  1XDK B;  2Q59 A;  1FM9 D;  4IA1 A;  4ZNW A;  4ITF A;  1XPC A;  2F4B A;  1FBY A;  4OZR U;  1OT7 A;  3W0I A;  2Z4B A;  3WT6 A;  5DXK A;  2GWX A;  4E2J A;  1T7F A;  2QZO A;  3P8X A;  1FM9 A;  5DWL A;  2YJA B;  5AWJ A;  5HJP A;  4YPQ A;  2YAT A;  5DID A;  3W0Y A;  4G1Z A;  2PJL A;  4RAK A;  1KKQ A;  3UVV B;  2YLQ A;  4OGH A;  5DV8 A;  2J14 A;  3OSI A;  4OK1 A;  2XKW A;  4NY9 A;  5E0W A;  3GYT A;  2QPY A;  5EIT A;  3JZB A;  2Q3Y A;  3B67 A;  1X7E A;  2YHD A;  4OFR A;  2B23 A;  2PIV A;  1L2J A;  1NDE A;  4DMA A;  1PQ6 A;  5E19 A;  5EJV A;  4PP3 A;  1E3K A;  1R1K D;  4L96 A;  3W0G A;  2GPV A;  3W5R A;  2QH6 A;  4REE A;  1XNX A;  3D90 A;  4MGD A;  5DI7 A;  4P6X A;  5DY8 A;  4J5X A;  4OFU A;  1ZDT A;  3VJT A;  2GIU A;  1FM6 D;  4G21 A;  4DK8 A;  2AA5 A;  1HG4 A;  1XQC A;  5IZ0 A;  2YLY A;  3SP9 A;  3VHV A;  5AAU A;  2VV0 A;  4OIL A;  4WQP A;  3PEQ A;  2REW A;  4WPF A;  2OZ7 A;  1K7L A;  3RLL A;  5DKG A;  5DL4 A;  5B5B A;  3ADX A;  2ZFX A;  4ZO1 X;  3F5C B;  3OOK A;  2HFP A;  3HQ5 A;  4OH6 A;  5DV6 A;  5DWJ A;  4DQM A;  4OJ9 A;  3GYU A;  3VT7 A;  3RUU A;  2AA7 A;  1Z95 A;  4IUI A;  2AX7 A;  3CQV A;  3VSP A;  5DKE A;  5KYJ A;  5K13 A;  2FVJ A;  3CS6 A;  5KRO A;  1U3Q A;  3VHW A;  3VI8 A;  2O4R A;  2PIN A;  1HJ1 A;  2PNU A;  3O1E A;  3X1I A;  4IU7 A;  3DCT A;  3AN4 A;  4ZJR A;  3ET1 A;  5H1E A;  2AX9 A;  1T65 A;  2ZK5 A;  3B68 A;  1T7R A;  2QA8 B;  3FLI A;  4J26 A;  1T5Z A;  5C4T A;  1ILH A;  3D6D A;  1XVP A;  3JZC A;  4APU A;  1OVL A;  3VN2 A;  5DXP A;  2ZMI A;  4IW6 A;  2GTK A;  1S9P A;  1DKF B;  5DX3 B;  3CDP A;  3B0W A;  4MG7 A;  1RKH A;  4POJ A;  4K7A A;  1UPW A;  1R5K A;  2YLP A;  3PO9 A;  4S0S A;  3VTB A;  3WT5 A;  2OVH A;  3D5F A;  2AX8 A;  3AX8 A;  1UHL B;  3HC6 A;  3OZJ A;  4J5X C;  2H77 A;  3TKM A;  3V3E A;  3UU7 B;  1T76 A;  5KR9 A;  3CWD A;  4MG9 B;  3ET2 A;  5JJM A;  3K22 A;  3KWY A;  3IMY A;  3UUD B;  2AX6 A;  4Q50 A;  4A4W A;  1N46 A;  5KCE A;  1UOM A;  3MNO A;  4QK4 A;  3AUN A;  2ZAS A;  4A4V A;  3KFC A;  4Q0A C;  4XHD A;  3DZY D;  3ILZ A;  4OHA A;  5DTV A;  3OMK A;  1LV2 A;  4EMA A;  5GIC A;  3EYB A;  2QXM A;  4Y29 A;  4RMD A;  1E3G A;  3CLD A;  1T74 A;  4MGB B;  5DXR A;  1NRL A;  3ADU A;  3MNP A;  2H79 A;  4A2J A;  5DWG A;  4OKB A;  1XP9 A;  4K4J A;  2POG A;  2G5O A;  4IWC A;  5DYB A;  3P88 A;  2PIP L;  4LTW A;  4ZOM A;  1SKX A;  1ZEO A;  3A9E B;  3ADV A;  5DUE A;  3KMG A;  2FSZ A;  1NQ0 A;  2ABI A;  3VJI A;  2I0J A;  1R20 D;  1XLS A;  1YOW A;  3GN8 A;  5AZV A;  1YIM A;  1L2I A;  4PXM A;  2IHQ A;  2ZNP A;  3AZ3 A;  3FUR A;  3WT7 A;  4OIU A;  3R8A A;  3E7C A;  4UDC A;  2W8Y A;  1R20 A;  4CSJ A;  4FHH A;  1X78 A;  4JYH A;  3B66 A;  3ZR7 A;  3ERD A;  5AK2 A;  4IVY A;  3FXV A;  1QKT A;  2ZK2 A;  5DXG A;  5I4V A;  1XB7 A;  1PCG A;  1S0Z A;  1PRG A;  3K8S A;  5DUG A;  3E94 A;  3R5N A;  4KZM A;  4MG8 B;  4QE6 A;  5E7V A;  3DY6 A;  3WJ5 A;  2QGT A;  4J24 A;  4QL8 A;  4ZNH A;  3OS8 A;  5EC9 A;  1T7T A;  5KCD A;  2AMB A;  4OKT A;  4RFW A;  3A78 A;  5AAV B;  5DKS A;  4QE8 A;  3W0J A;  3OSW A;  2JFA B;  4OIV A;  4OEA A;  2P1T A;  3L0J A;  4PPS A;  5FQR A;  2ZL9 A;  2VV1 B;  2QMV A;  3WMH A;  3OS9 A;  5APJ A;  1OSV A;  3OMP A;  2HVC A;  2PIW A;  2BAW A;  2BJ4 B;  2PIQ A;  4FN9 A;  3D57 A;  1SR7 A;  3ADS A;  5E1C A;  5E14 A;  2ZBS A;  3PLZ A;  4MGA B;  5DKB A;  3A3Z X;  4MG5 A;  1SJ0 A;  1A52 A;  2ZNO A;  4OZR E;  5DXB A;  2ZVT A;  2Q1H A;  2ACL A;  4XI3 A;  4XT9 A;  1XDK A;  1G5Y A;  5HCV A;  2R6Y A;  3S9S A;  1YP0 A;  3VJS A;  2G44 A;  1ERR A;  2I0G A;  2VV4 B;  3VRT A;  5L7E A;  4PP5 A;  1PDU A;  3WWR A;  4OJ4 A;  4POH A;  3ZRA A;  3VTC A;  3AN3 A;  2ZK6 A;  3HM1 A;  1QKM A;  2Q60 A;  3FAL B;  4PPP A;  4EM9 A;  3KMR A;  3KDU A;  2XYW A;  3G8O A;  5DZ3 A;  3UVV A;  5M96 A;  3D24 A;  3BQD A;  3W5T A;  4DK7 A;  2P54 A;  4N8R A;  1ZGY A;  2QTU A;  4LNW A;  1X76 A;  3OS8 C;  3OSA A;  3B0Q A;  4DOR A;  2HB7 A;  2ZNN A;  2E2R A;  2P15 A;  2Q8S A;  5AWK A;  3AUQ A;  1XV9 B;  1X7R A;  1GS4 A;  2GPO A;  2Q5S A;  2ZK4 A;  4DOS A;  2ZMJ A;  5KD9 A;  3V9T A;  2ZXM A;  4M8H A;  4DM6 A;  3GWS X;  5DXQ A;  2AA6 A;  3A2I A;  3V9V A;  1M13 A;  3CS4 A;  5L11 A;  3FEI A;  5G42 A;  3UP3 A;  5DLR A;  1K74 A;  3RVF A;  3E00 A;  2Q6R A;  3U9Q A;  3W0C A;  5KRC A;  5KCW A;  1QKU A;  1R6G A;  3LMP A;  1OSH A;  3OMQ A;  1ZH7 A;  1IE9 A;  5G46 A;  3L0L A;  3VT9 A;  4IQR A;  3OMM A;  2HAM A;  3GBK A;  4G20 A;  5L7H A;  3F5C A;  4CI4 A;  5LWP A;  2R40 A;  2QA6 A;  2OM9 A;  4RUO X;  5ICK A;  5ETH A;  5DV3 A;  1YOK A;  2J7Y A; 
#chains in the Genus database with same CATH topology
 2G0G A;  1YJE A;  1MV9 A;  3R8I A;  3VRU A;  2ZK3 A;  2HB8 A;  2I4P A;  4TV1 B;  2HWQ A;  3RY9 A;  4CI5 A;  1T73 A;  4XLD A;  5KRM A;  4N5G A;  3R8D A;  3P0U A;  1I7G A;  3GZ9 A;  5KCF A;  3KBA A;  4QM0 A;  3L1B A;  5KRK A;  2QA8 A;  2P1U A;  1Y0S A;  2Q1V A;  4TUZ B;  2HCD A;  5LGA A;  4OEZ A;  5HZC A;  2NPA A;  4G1Y A;  1NAX A;  4IV4 A;  4QJR A;  4ZNT A;  2GP7 A;  4RUP A;  3M7R A;  2PIR A;  4MG6 A;  5DX3 A;  2PIX A;  1N4H A;  4ITE A;  1XP6 A;  3QT0 A;  4B7W A;  2Q6S A;  3OGT A;  3CTB A;  3OLF A;  1UHL A;  2HC4 A;  5DZH A;  5G3J A;  2IOK A;  3UU7 A;  2Z4J A;  4J5W A;  1KV6 A;  4MG9 A;  1PZL A;  1Y0X X;  1G1U A;  3AFR A;  4JL4 A;  4PVU A;  3NSQ A;  3UUD A;  4RME A;  3AZ1 A;  1LBD A;  1TXI A;  3DT3 A;  5CJ6 A;  3H52 A;  5FQV A;  3VT4 A;  5DP0 A;  2B1Z A;  3CDS A;  5AVI A;  2ZY0 A;  3B1M A;  3B65 A;  3VHU A;  3OKI A;  3KYT A;  4X1G A;  2P7A A;  2AWH A;  3R29 A;  1P93 A;  2ZMH A;  3W5P A;  1I38 A;  3V3Q A;  1DB1 A;  5DK9 A;  4MGB A;  1G50 A;  1PQ9 A;  4HEE X;  4RE8 A;  4UDA A;  4ZNV A;  5DVV A;  4NQA B;  1XLS E;  5KRA A;  2GL8 A;  3WFF A;  2HWR A;  4PF3 A;  3PBA A;  4ONI A;  1XQ3 A;  4OKW A;  1Q4X A;  3VTD A;  3A9E A;  3G0W A;  1I7I A;  1YIN A;  3KPZ A;  2VV2 A;  1NQ2 A;  4ZNS A;  1XAP A;  3X36 A;  3HVL A;  3MNE A;  2PIT A;  1ZAF A;  1M7W A;  2ZKC A;  1I37 A;  3SZ1 A;  3AUR A;  3OLS A;  4BCR A;  5EGV A;  2AYR A;  2NW4 A;  4MGC A;  2Q5G A;  3G8I A;  2VST A;  2QE4 A;  1A28 A;  4FNE A;  5FQP A;  4K6I A;  3FUG A;  1YUC A;  4N73 A;  4R06 A;  5AZT A;  5DVC A;  1T79 A;  1FCY A;  4J5W C;  5KRF A;  2JF9 A;  4P6W A;  5DIG A;  5JY3 A;  3VT6 A;  2XYJ A;  3L03 A;  3OKH A;  5DIE A;  3ADT A;  2ZXZ A;  5AAV A;  4LNX A;  3TKC A;  3HC5 A;  3FC6 B;  3UUC A;  2AAX A;  2JFA A;  1K4W A;  3A2J A;  3Q95 A;  2I4J A;  3UUA B;  2LBD A;  4OZT U;  2P7Z A;  4PRG A;  1GWR A;  3ADW A;  4G2I A;  4PP6 A;  2Q70 A;  2VV1 A;  5DZI A;  5KRH A;  3IPQ A;  1PQC A;  1WM0 X;  2XHS A;  2OCF A;  2AMA A;  2ZLC A;  2BJ4 A;  4ZJW A;  1GWX A;  4X1F A;  2Q59 B;  1NUO A;  2YLO A;  5FQS A;  3UP0 A;  3AZ2 A;  2QR9 A;  3BEJ A;  3NOA A;  4MGA A;  3NSP A;  1Z5X U;  4S0T A;  3PCU A;  2Q61 A;  4OAR A;  2J4A A;  4XUH A;  2QZO B;  5IXK A;  1YA3 A;  1S0X A;  3FEJ A;  3B5R A;  5DZ1 A;  5HJP B;  3VJH A;  1NQ7 A;  4IA2 A;  2Q7I A;  3A40 X;  3KDT A;  3GWX A;  3HOD A;  5SYZ A;  4JYG A;  2HAS A;  2VV4 A;  2O9I A;  4YT1 A;  1Y9R A;  3VSO A;  2I4Z A;  2OVM A;  4FGY A;  2QW4 A;  3FAL A;  3VT5 A;  1ERE A;  2ZLA A;  1S19 A;  5E0X A;  1K74 D;  1T7M A;  2HAR A;  2VV3 A;  3E00 D;  2OUZ A;  3ET3 A;  1P8D A;  3KMZ A;  4S15 A;  4LSJ A;  1RDT D;  4WHG A;  5DRM A;  1RJK A;  2ZK1 A;  1NYX A;  4MGD B;  5GID A;  4XTA A;  1XV9 A;  5G44 A;  4WLB A;  2GPU A;  1ZKY A;  1IE8 A;  5DRJ A;  5KRJ A;  1RDT A;  4REF A;  3DZU D;  3B0R A;  5AVL A;  2IOG A;  2R40 D;  4G2H A;  4OH5 A;  4OLM A;  2QNV A;  5DYD A;  4RUJ A;  4ZNU A;  5B41 A;  3BC5 A;  3DR1 A;  4OJB A;  4YMQ A;  3DZU A;  4RZF A;  1H9U A;  2ZNQ A;  1T63 A;  4UDD A;  1R1K A;  2XYX A;  1RK3 A;  1EXA A;  4RMC A;  4RZG A;  1BSX A;  4R2U A;  4ZO1 B;  4PLE A;  5KRL A;  1YMT A;  4G1D A;  4LBD A;  4XUM A;  3TX7 B;  3O1D A;  5KYA A;  4OKX A;  3VRV A;  1XOW A;  3P89 A;  3ZQT A;  1U9E A;  2O4J A;  3FS1 A;  1FM6 A;  5APH A;  1NHZ A;  1U3R A;  2B50 A;  2AXA A;  1QKN A;  3IA6 A;  5G45 A;  3W0H A;  1MVC A;  5F9B A;  2QAB A;  2NV7 A;  2QSE A;  2AA2 A;  5GT4 A;  5EHJ A;  2QGW A;  2Q7L A;  2Q6J A;  4JAZ A;  1XVP B;  4TV1 A;  1OVL B;  2Q7K A;  3OAP A;  4OED A;  3V49 A;  3CJW A;  3ZRB A;  1FD0 A;  4DM8 A;  1ILG A;  2ATH A;  2VSR A;  5APK A;  3R5M A;  1N83 A;  1RKG A;  1XNN A;  1DKF A;  3L0E A;  3OLL A;  2P7G A;  1SQN A;  4NIE A;  1FCX A;  4NB6 A;  4MG7 B;  4R6S A;  3R2A A;  2POB A;  2J7X A;  3ERT A;  4TUZ A;  2PIU A;  2AO6 A;  5DSH A;  2NXX A;  3IPU A;  3RLJ A;  1EXX A;  2PRG A;  2NXX E;  1FCZ A;  2ZK0 A;  1U3S A;  1YY4 A;  1KNU A;  5DU5 A;  4ZI1 A;  3ET0 A;  3WJ4 A;  5G43 A;  4KZI A;  2G0H A;  4NUF A;  5JJM B;  2Q7J A;  5HYR A;  5DUH A;  2P1V A;  4L98 A;  3HLV A;  5DMF A;  5DZ0 A;  5G5W A;  1YYE A;  5FQT A;  4RZE A;  1PK5 A;  5DMC A;  5DWE A;  4E4K A;  1XIU A;  4Q13 A;  2P4Y A;  4WHF A;  3DCU A;  4JYI A;  4JGV A;  5GIE A;  5IAW A;  3OOF A;  3B3K A;  4F9M A;  4PLD A;  5HJS A;  3L3X A;  4XAO A;  2AM9 A;  3N00 A;  4PWL A;  1TFC A;  5DXE A;  3X31 A;  1X7B A;  3OZ0 A;  5ACC A;  3B0T A;  2FAI A;  1NAV A;  3IPS A;  3OMO A;  5DVS A;  1M2Z A;  2R6W A;  3X1H A;  4UDB A;  1VJB A;  5KCT A;  3G9E A;  2QXS A;  3DZY A;  2YJD A;  4YNK A;  4S14 A;  1ZDU A;  5HYK A;  4E4Q A;  3LBD A;  1ZUC A;  4IW8 A;  5E15 A;  4KZJ A;  3WTQ A;  4OEY A;  3V4A A;  1XP1 A;  4RWV A;  5EI1 A;  1UPV A;  3HO0 A;  4FHI A;  5DWI A;  3WFG A;  3L3Z A;  3VT8 A;  4MG8 A;  4O8F A;  3VT3 A;  2GPP A;  2JJ3 A;  2OAX A;  3V9Y A;  4IWF A;  3T03 A;  5KCU A;  5KRI A;  4N1Y A;  3W0A A;  3F7D A;  4WVD A;  2A3I A;  5AYG A;  2B1V A;  2AB2 A;  1NQ1 A;  1MZN A;  2ZXN A;  3WGP A;  2V7C A;  3CS8 A;  5A86 A;  5DXM A;  4IVW A;  5L7G A;  3RUT A;  4M8E A;  2EWP A;  3GD2 A;  3H0A D;  4IV2 A;  4MDD A;  3SP6 A;  1GWQ A;  1XZX X;  3IXP D;  4OZT E;  4ZN9 A;  4OC7 A;  3W5Q A;  3A2H A;  2Q5P A;  3HZF A;  4IA3 A;  5JI0 D;  3FC6 A;  4ZN7 A;  3K23 A;  3VRW A;  3H0A A;  5C4O A;  3UUA A;  3IXP A;  3K6P A;  3Q95 B;  5C4S A;  2PKL A;  1X7J A;  2YFE A;  2V0V A;  1XJ7 A;  2HBH A;  5C4U A;  1S9Q A;  4IS8 A;  5KCC A;  4HLW A;  4IA7 A;  5DXB B;  3PRG A;  1G2N A;  1Z5X E;  2ACL B;  2PIO A;  3TY0 A;  1XDK B;  2Q59 A;  1FM9 D;  4IA1 A;  4ZNW A;  4ITF A;  1XPC A;  2F4B A;  1FBY A;  4OZR U;  1OT7 A;  3W0I A;  2Z4B A;  3WT6 A;  5DXK A;  2GWX A;  4E2J A;  1T7F A;  2QZO A;  3P8X A;  1FM9 A;  5DWL A;  2YJA B;  5AWJ A;  5HJP A;  4YPQ A;  2YAT A;  5DID A;  3W0Y A;  4G1Z A;  2PJL A;  4RAK A;  1KKQ A;  3UVV B;  2YLQ A;  4OGH A;  5DV8 A;  2J14 A;  3OSI A;  4OK1 A;  2XKW A;  4NY9 A;  5E0W A;  3GYT A;  2QPY A;  5EIT A;  3JZB A;  2Q3Y A;  3B67 A;  1X7E A;  2YHD A;  4OFR A;  2B23 A;  2PIV A;  1L2J A;  1NDE A;  4DMA A;  1PQ6 A;  5E19 A;  5EJV A;  4PP3 A;  1E3K A;  1R1K D;  4L96 A;  3W0G A;  2GPV A;  3W5R A;  2QH6 A;  4REE A;  1XNX A;  3D90 A;  4MGD A;  5DI7 A;  4P6X A;  5DY8 A;  4J5X A;  4OFU A;  1ZDT A;  3VJT A;  2GIU A;  1FM6 D;  4G21 A;  4DK8 A;  2AA5 A;  1HG4 A;  1XQC A;  5IZ0 A;  2YLY A;  3SP9 A;  3VHV A;  5AAU A;  2VV0 A;  4OIL A;  4WQP A;  3PEQ A;  2REW A;  4WPF A;  2OZ7 A;  1K7L A;  3RLL A;  5DKG A;  5DL4 A;  5B5B A;  3ADX A;  2ZFX A;  4ZO1 X;  3F5C B;  3OOK A;  2HFP A;  3HQ5 A;  4OH6 A;  5DV6 A;  5DWJ A;  4DQM A;  4OJ9 A;  3GYU A;  3VT7 A;  3RUU A;  2AA7 A;  1Z95 A;  4IUI A;  2AX7 A;  3CQV A;  3VSP A;  5DKE A;  5KYJ A;  5K13 A;  2FVJ A;  3CS6 A;  5KRO A;  1U3Q A;  3VHW A;  3VI8 A;  2O4R A;  2PIN A;  1HJ1 A;  2PNU A;  3O1E A;  3X1I A;  4IU7 A;  3DCT A;  3AN4 A;  4ZJR A;  3ET1 A;  5H1E A;  2AX9 A;  1T65 A;  2ZK5 A;  3B68 A;  1T7R A;  2QA8 B;  3FLI A;  4J26 A;  1T5Z A;  5C4T A;  1ILH A;  3D6D A;  1XVP A;  3JZC A;  4APU A;  1OVL A;  3VN2 A;  5DXP A;  2ZMI A;  4IW6 A;  2GTK A;  1S9P A;  1DKF B;  5DX3 B;  3CDP A;  3B0W A;  4MG7 A;  1RKH A;  4POJ A;  4K7A A;  1UPW A;  1R5K A;  2YLP A;  3PO9 A;  4S0S A;  3VTB A;  3WT5 A;  2OVH A;  3D5F A;  2AX8 A;  3AX8 A;  1UHL B;  3HC6 A;  3OZJ A;  4J5X C;  2H77 A;  3TKM A;  3V3E A;  3UU7 B;  1T76 A;  5KR9 A;  3CWD A;  4MG9 B;  3ET2 A;  5JJM A;  3K22 A;  3KWY A;  3IMY A;  3UUD B;  2AX6 A;  4Q50 A;  4A4W A;  1N46 A;  5KCE A;  1UOM A;  3MNO A;  4QK4 A;  3AUN A;  2ZAS A;  4A4V A;  3KFC A;  4Q0A C;  4XHD A;  3DZY D;  3ILZ A;  4OHA A;  5DTV A;  3OMK A;  1LV2 A;  4EMA A;  5GIC A;  3EYB A;  2QXM A;  4Y29 A;  4RMD A;  1E3G A;  3CLD A;  1T74 A;  4MGB B;  5DXR A;  1NRL A;  3ADU A;  3MNP A;  2H79 A;  4A2J A;  5DWG A;  4OKB A;  1XP9 A;  4K4J A;  2POG A;  2G5O A;  4IWC A;  5DYB A;  3P88 A;  2PIP L;  4LTW A;  4ZOM A;  1SKX A;  1ZEO A;  3A9E B;  3ADV A;  5DUE A;  3KMG A;  2FSZ A;  1NQ0 A;  2ABI A;  3VJI A;  2I0J A;  1R20 D;  1XLS A;  1YOW A;  3GN8 A;  5AZV A;  1YIM A;  1L2I A;  4PXM A;  2IHQ A;  2ZNP A;  3AZ3 A;  3FUR A;  3WT7 A;  4OIU A;  3R8A A;  3E7C A;  4UDC A;  2W8Y A;  1R20 A;  4CSJ A;  4FHH A;  1X78 A;  4JYH A;  3B66 A;  3ZR7 A;  3ERD A;  5AK2 A;  4IVY A;  3FXV A;  1QKT A;  2ZK2 A;  5DXG A;  5I4V A;  1XB7 A;  1PCG A;  1S0Z A;  1PRG A;  3K8S A;  5DUG A;  3E94 A;  3R5N A;  4KZM A;  4MG8 B;  4QE6 A;  5E7V A;  3DY6 A;  3WJ5 A;  2QGT A;  4J24 A;  4QL8 A;  4ZNH A;  3OS8 A;  5EC9 A;  1T7T A;  5KCD A;  2AMB A;  4OKT A;  4RFW A;  3A78 A;  5AAV B;  5DKS A;  4QE8 A;  3W0J A;  3OSW A;  2JFA B;  4OIV A;  4OEA A;  2P1T A;  3L0J A;  4PPS A;  5FQR A;  2ZL9 A;  2VV1 B;  2QMV A;  3WMH A;  3OS9 A;  5APJ A;  1OSV A;  3OMP A;  2HVC A;  2PIW A;  2BAW A;  2BJ4 B;  2PIQ A;  4FN9 A;  3D57 A;  1SR7 A;  3ADS A;  5E1C A;  5E14 A;  2ZBS A;  3PLZ A;  4MGA B;  5DKB A;  3A3Z X;  4MG5 A;  1SJ0 A;  1A52 A;  2ZNO A;  4OZR E;  5DXB A;  2ZVT A;  2Q1H A;  2ACL A;  4XI3 A;  4XT9 A;  1XDK A;  1G5Y A;  5HCV A;  2R6Y A;  3S9S A;  1YP0 A;  3VJS A;  2G44 A;  1ERR A;  2I0G A;  2VV4 B;  3VRT A;  5L7E A;  4PP5 A;  1PDU A;  3WWR A;  4OJ4 A;  4POH A;  3ZRA A;  3VTC A;  3AN3 A;  2ZK6 A;  3HM1 A;  1QKM A;  2Q60 A;  3FAL B;  4PPP A;  4EM9 A;  3KMR A;  3KDU A;  2XYW A;  3G8O A;  5DZ3 A;  3UVV A;  5M96 A;  3D24 A;  3BQD A;  3W5T A;  4DK7 A;  2P54 A;  4N8R A;  1ZGY A;  2QTU A;  4LNW A;  1X76 A;  3OS8 C;  3OSA A;  3B0Q A;  4DOR A;  2HB7 A;  2ZNN A;  2E2R A;  2P15 A;  2Q8S A;  5AWK A;  3AUQ A;  1XV9 B;  1X7R A;  1GS4 A;  2GPO A;  2Q5S A;  2ZK4 A;  4DOS A;  2ZMJ A;  5KD9 A;  3V9T A;  2ZXM A;  4M8H A;  4DM6 A;  3GWS X;  5DXQ A;  2AA6 A;  3A2I A;  3V9V A;  1M13 A;  3CS4 A;  5L11 A;  3FEI A;  5G42 A;  3UP3 A;  5DLR A;  1K74 A;  3RVF A;  3E00 A;  2Q6R A;  3U9Q A;  3W0C A;  5KRC A;  5KCW A;  1QKU A;  1R6G A;  3LMP A;  1OSH A;  3OMQ A;  1ZH7 A;  1IE9 A;  5G46 A;  3L0L A;  3VT9 A;  4IQR A;  3OMM A;  2HAM A;  3GBK A;  4G20 A;  5L7H A;  3F5C A;  4CI4 A;  5LWP A;  2R40 A;  2QA6 A;  2OM9 A;  4RUO X;  5ICK A;  5ETH A;  5DV3 A;  1YOK A;  2J7Y A; 
#chains in the Genus database with same CATH homology
 2G0G A;  1YJE A;  1MV9 A;  3R8I A;  3VRU A;  2ZK3 A;  2HB8 A;  2I4P A;  4TV1 B;  2HWQ A;  3RY9 A;  4CI5 A;  1T73 A;  4XLD A;  5KRM A;  4N5G A;  3R8D A;  3P0U A;  1I7G A;  3GZ9 A;  5KCF A;  3KBA A;  4QM0 A;  3L1B A;  5KRK A;  2QA8 A;  2P1U A;  1Y0S A;  2Q1V A;  4TUZ B;  2HCD A;  5LGA A;  4OEZ A;  5HZC A;  2NPA A;  4G1Y A;  1NAX A;  4IV4 A;  4QJR A;  4ZNT A;  2GP7 A;  4RUP A;  3M7R A;  2PIR A;  4MG6 A;  5DX3 A;  2PIX A;  1N4H A;  4ITE A;  1XP6 A;  3QT0 A;  4B7W A;  2Q6S A;  3OGT A;  3CTB A;  3OLF A;  1UHL A;  2HC4 A;  5DZH A;  5G3J A;  2IOK A;  3UU7 A;  2Z4J A;  4J5W A;  1KV6 A;  4MG9 A;  1PZL A;  1Y0X X;  1G1U A;  3AFR A;  4JL4 A;  4PVU A;  3NSQ A;  3UUD A;  4RME A;  3AZ1 A;  1LBD A;  1TXI A;  3DT3 A;  5CJ6 A;  3H52 A;  5FQV A;  3VT4 A;  5DP0 A;  2B1Z A;  3CDS A;  5AVI A;  2ZY0 A;  3B1M A;  3B65 A;  3VHU A;  3OKI A;  3KYT A;  4X1G A;  2P7A A;  2AWH A;  3R29 A;  1P93 A;  2ZMH A;  3W5P A;  1I38 A;  3V3Q A;  1DB1 A;  5DK9 A;  4MGB A;  1G50 A;  1PQ9 A;  4HEE X;  4RE8 A;  4UDA A;  4ZNV A;  5DVV A;  4NQA B;  1XLS E;  5KRA A;  2GL8 A;  3WFF A;  2HWR A;  4PF3 A;  3PBA A;  4ONI A;  1XQ3 A;  4OKW A;  1Q4X A;  3VTD A;  3A9E A;  3G0W A;  1I7I A;  1YIN A;  3KPZ A;  2VV2 A;  1NQ2 A;  4ZNS A;  1XAP A;  3X36 A;  3HVL A;  3MNE A;  2PIT A;  1ZAF A;  1M7W A;  2ZKC A;  1I37 A;  3SZ1 A;  3AUR A;  3OLS A;  4BCR A;  5EGV A;  2AYR A;  2NW4 A;  4MGC A;  2Q5G A;  3G8I A;  2VST A;  2QE4 A;  1A28 A;  4FNE A;  5FQP A;  4K6I A;  3FUG A;  1YUC A;  4N73 A;  4R06 A;  5AZT A;  5DVC A;  1T79 A;  1FCY A;  4J5W C;  5KRF A;  2JF9 A;  4P6W A;  5DIG A;  5JY3 A;  3VT6 A;  2XYJ A;  3L03 A;  3OKH A;  5DIE A;  3ADT A;  2ZXZ A;  5AAV A;  4LNX A;  3TKC A;  3HC5 A;  3FC6 B;  3UUC A;  2AAX A;  2JFA A;  1K4W A;  3A2J A;  3Q95 A;  2I4J A;  3UUA B;  2LBD A;  4OZT U;  2P7Z A;  4PRG A;  1GWR A;  3ADW A;  4G2I A;  4PP6 A;  2Q70 A;  2VV1 A;  5DZI A;  5KRH A;  3IPQ A;  1PQC A;  1WM0 X;  2XHS A;  2OCF A;  2AMA A;  2ZLC A;  2BJ4 A;  4ZJW A;  1GWX A;  4X1F A;  2Q59 B;  1NUO A;  2YLO A;  5FQS A;  3UP0 A;  3AZ2 A;  2QR9 A;  3BEJ A;  3NOA A;  4MGA A;  3NSP A;  1Z5X U;  4S0T A;  3PCU A;  2Q61 A;  4OAR A;  2J4A A;  4XUH A;  2QZO B;  5IXK A;  1YA3 A;  1S0X A;  3FEJ A;  3B5R A;  5DZ1 A;  5HJP B;  3VJH A;  1NQ7 A;  4IA2 A;  2Q7I A;  3A40 X;  3KDT A;  3GWX A;  3HOD A;  5SYZ A;  4JYG A;  2HAS A;  2VV4 A;  2O9I A;  4YT1 A;  1Y9R A;  3VSO A;  2I4Z A;  2OVM A;  4FGY A;  2QW4 A;  3FAL A;  3VT5 A;  1ERE A;  2ZLA A;  1S19 A;  5E0X A;  1K74 D;  1T7M A;  2HAR A;  2VV3 A;  3E00 D;  2OUZ A;  3ET3 A;  1P8D A;  3KMZ A;  4S15 A;  4LSJ A;  1RDT D;  4WHG A;  5DRM A;  1RJK A;  2ZK1 A;  1NYX A;  4MGD B;  5GID A;  4XTA A;  1XV9 A;  5G44 A;  4WLB A;  2GPU A;  1ZKY A;  1IE8 A;  5DRJ A;  5KRJ A;  1RDT A;  4REF A;  3DZU D;  3B0R A;  5AVL A;  2IOG A;  2R40 D;  4G2H A;  4OH5 A;  4OLM A;  2QNV A;  5DYD A;  4RUJ A;  4ZNU A;  5B41 A;  3BC5 A;  3DR1 A;  4OJB A;  4YMQ A;  3DZU A;  4RZF A;  1H9U A;  2ZNQ A;  1T63 A;  4UDD A;  1R1K A;  2XYX A;  1RK3 A;  1EXA A;  4RMC A;  4RZG A;  1BSX A;  4R2U A;  4ZO1 B;  4PLE A;  5KRL A;  1YMT A;  4G1D A;  4LBD A;  4XUM A;  3TX7 B;  3O1D A;  5KYA A;  4OKX A;  3VRV A;  1XOW A;  3P89 A;  3ZQT A;  1U9E A;  2O4J A;  3FS1 A;  1FM6 A;  5APH A;  1NHZ A;  1U3R A;  2B50 A;  2AXA A;  1QKN A;  3IA6 A;  5G45 A;  3W0H A;  1MVC A;  5F9B A;  2QAB A;  2NV7 A;  2QSE A;  2AA2 A;  5GT4 A;  5EHJ A;  2QGW A;  2Q7L A;  2Q6J A;  4JAZ A;  1XVP B;  4TV1 A;  1OVL B;  2Q7K A;  3OAP A;  4OED A;  3V49 A;  3CJW A;  3ZRB A;  1FD0 A;  4DM8 A;  1ILG A;  2ATH A;  2VSR A;  5APK A;  3R5M A;  1N83 A;  1RKG A;  1XNN A;  1DKF A;  3L0E A;  3OLL A;  2P7G A;  1SQN A;  4NIE A;  1FCX A;  4NB6 A;  4MG7 B;  4R6S A;  3R2A A;  2POB A;  2J7X A;  3ERT A;  4TUZ A;  2PIU A;  2AO6 A;  5DSH A;  2NXX A;  3IPU A;  3RLJ A;  1EXX A;  2PRG A;  2NXX E;  1FCZ A;  2ZK0 A;  1U3S A;  1YY4 A;  1KNU A;  5DU5 A;  4ZI1 A;  3ET0 A;  3WJ4 A;  5G43 A;  4KZI A;  2G0H A;  4NUF A;  5JJM B;  2Q7J A;  5HYR A;  5DUH A;  2P1V A;  4L98 A;  3HLV A;  5DMF A;  5DZ0 A;  5G5W A;  1YYE A;  5FQT A;  4RZE A;  1PK5 A;  5DMC A;  5DWE A;  4E4K A;  1XIU A;  4Q13 A;  2P4Y A;  4WHF A;  3DCU A;  4JYI A;  4JGV A;  5GIE A;  5IAW A;  3OOF A;  3B3K A;  4F9M A;  4PLD A;  5HJS A;  3L3X A;  4XAO A;  2AM9 A;  3N00 A;  4PWL A;  1TFC A;  5DXE A;  3X31 A;  1X7B A;  3OZ0 A;  5ACC A;  3B0T A;  2FAI A;  1NAV A;  3IPS A;  3OMO A;  5DVS A;  1M2Z A;  2R6W A;  3X1H A;  4UDB A;  1VJB A;  5KCT A;  3G9E A;  2QXS A;  3DZY A;  2YJD A;  4YNK A;  4S14 A;  1ZDU A;  5HYK A;  4E4Q A;  3LBD A;  1ZUC A;  4IW8 A;  5E15 A;  4KZJ A;  3WTQ A;  4OEY A;  3V4A A;  1XP1 A;  4RWV A;  5EI1 A;  1UPV A;  3HO0 A;  4FHI A;  5DWI A;  3WFG A;  3L3Z A;  3VT8 A;  4MG8 A;  4O8F A;  3VT3 A;  2GPP A;  2JJ3 A;  2OAX A;  3V9Y A;  4IWF A;  3T03 A;  5KCU A;  5KRI A;  4N1Y A;  3W0A A;  3F7D A;  4WVD A;  2A3I A;  5AYG A;  2B1V A;  2AB2 A;  1NQ1 A;  1MZN A;  2ZXN A;  3WGP A;  2V7C A;  3CS8 A;  5A86 A;  5DXM A;  4IVW A;  5L7G A;  3RUT A;  4M8E A;  2EWP A;  3GD2 A;  3H0A D;  4IV2 A;  4MDD A;  3SP6 A;  1GWQ A;  1XZX X;  3IXP D;  4OZT E;  4ZN9 A;  4OC7 A;  3W5Q A;  3A2H A;  2Q5P A;  3HZF A;  4IA3 A;  5JI0 D;  3FC6 A;  4ZN7 A;  3K23 A;  3VRW A;  3H0A A;  5C4O A;  3UUA A;  3IXP A;  3K6P A;  3Q95 B;  5C4S A;  2PKL A;  1X7J A;  2YFE A;  2V0V A;  1XJ7 A;  2HBH A;  5C4U A;  1S9Q A;  4IS8 A;  5KCC A;  4HLW A;  4IA7 A;  5DXB B;  3PRG A;  1G2N A;  1Z5X E;  2ACL B;  2PIO A;  3TY0 A;  1XDK B;  2Q59 A;  1FM9 D;  4IA1 A;  4ZNW A;  4ITF A;  1XPC A;  2F4B A;  1FBY A;  4OZR U;  1OT7 A;  3W0I A;  2Z4B A;  3WT6 A;  5DXK A;  2GWX A;  4E2J A;  1T7F A;  2QZO A;  3P8X A;  1FM9 A;  5DWL A;  2YJA B;  5AWJ A;  5HJP A;  4YPQ A;  2YAT A;  5DID A;  3W0Y A;  4G1Z A;  2PJL A;  4RAK A;  1KKQ A;  3UVV B;  2YLQ A;  4OGH A;  5DV8 A;  2J14 A;  3OSI A;  4OK1 A;  2XKW A;  4NY9 A;  5E0W A;  3GYT A;  2QPY A;  5EIT A;  3JZB A;  2Q3Y A;  3B67 A;  1X7E A;  2YHD A;  4OFR A;  2B23 A;  2PIV A;  1L2J A;  1NDE A;  4DMA A;  1PQ6 A;  5E19 A;  5EJV A;  4PP3 A;  1E3K A;  1R1K D;  4L96 A;  3W0G A;  2GPV A;  3W5R A;  2QH6 A;  4REE A;  1XNX A;  3D90 A;  4MGD A;  5DI7 A;  4P6X A;  5DY8 A;  4J5X A;  4OFU A;  1ZDT A;  3VJT A;  2GIU A;  1FM6 D;  4G21 A;  4DK8 A;  2AA5 A;  1HG4 A;  1XQC A;  5IZ0 A;  2YLY A;  3SP9 A;  3VHV A;  5AAU A;  2VV0 A;  4OIL A;  4WQP A;  3PEQ A;  2REW A;  4WPF A;  2OZ7 A;  1K7L A;  3RLL A;  5DKG A;  5DL4 A;  5B5B A;  3ADX A;  2ZFX A;  4ZO1 X;  3F5C B;  3OOK A;  2HFP A;  3HQ5 A;  4OH6 A;  5DV6 A;  5DWJ A;  4DQM A;  4OJ9 A;  3GYU A;  3VT7 A;  3RUU A;  2AA7 A;  1Z95 A;  4IUI A;  2AX7 A;  3CQV A;  3VSP A;  5DKE A;  5KYJ A;  5K13 A;  2FVJ A;  3CS6 A;  5KRO A;  1U3Q A;  3VHW A;  3VI8 A;  2O4R A;  2PIN A;  1HJ1 A;  2PNU A;  3O1E A;  3X1I A;  4IU7 A;  3DCT A;  3AN4 A;  4ZJR A;  3ET1 A;  5H1E A;  2AX9 A;  1T65 A;  2ZK5 A;  3B68 A;  1T7R A;  2QA8 B;  3FLI A;  4J26 A;  1T5Z A;  5C4T A;  1ILH A;  3D6D A;  1XVP A;  3JZC A;  4APU A;  1OVL A;  3VN2 A;  5DXP A;  2ZMI A;  4IW6 A;  2GTK A;  1S9P A;  1DKF B;  5DX3 B;  3CDP A;  3B0W A;  4MG7 A;  1RKH A;  4POJ A;  4K7A A;  1UPW A;  1R5K A;  2YLP A;  3PO9 A;  4S0S A;  3VTB A;  3WT5 A;  2OVH A;  3D5F A;  2AX8 A;  3AX8 A;  1UHL B;  3HC6 A;  3OZJ A;  4J5X C;  2H77 A;  3TKM A;  3V3E A;  3UU7 B;  1T76 A;  5KR9 A;  3CWD A;  4MG9 B;  3ET2 A;  5JJM A;  3K22 A;  3KWY A;  3IMY A;  3UUD B;  2AX6 A;  4Q50 A;  4A4W A;  1N46 A;  5KCE A;  1UOM A;  3MNO A;  4QK4 A;  3AUN A;  2ZAS A;  4A4V A;  3KFC A;  4Q0A C;  4XHD A;  3DZY D;  3ILZ A;  4OHA A;  5DTV A;  3OMK A;  1LV2 A;  4EMA A;  5GIC A;  3EYB A;  2QXM A;  4Y29 A;  4RMD A;  1E3G A;  3CLD A;  1T74 A;  4MGB B;  5DXR A;  1NRL A;  3ADU A;  3MNP A;  2H79 A;  4A2J A;  5DWG A;  4OKB A;  1XP9 A;  4K4J A;  2POG A;  2G5O A;  4IWC A;  5DYB A;  3P88 A;  2PIP L;  4LTW A;  4ZOM A;  1SKX A;  1ZEO A;  3A9E B;  3ADV A;  5DUE A;  3KMG A;  2FSZ A;  1NQ0 A;  2ABI A;  3VJI A;  2I0J A;  1R20 D;  1XLS A;  1YOW A;  3GN8 A;  5AZV A;  1YIM A;  1L2I A;  4PXM A;  2IHQ A;  2ZNP A;  3AZ3 A;  3FUR A;  3WT7 A;  4OIU A;  3R8A A;  3E7C A;  4UDC A;  2W8Y A;  1R20 A;  4CSJ A;  4FHH A;  1X78 A;  4JYH A;  3B66 A;  3ZR7 A;  3ERD A;  5AK2 A;  4IVY A;  3FXV A;  1QKT A;  2ZK2 A;  5DXG A;  5I4V A;  1XB7 A;  1PCG A;  1S0Z A;  1PRG A;  3K8S A;  5DUG A;  3E94 A;  3R5N A;  4KZM A;  4MG8 B;  4QE6 A;  5E7V A;  3DY6 A;  3WJ5 A;  2QGT A;  4J24 A;  4QL8 A;  4ZNH A;  3OS8 A;  5EC9 A;  1T7T A;  5KCD A;  2AMB A;  4OKT A;  4RFW A;  3A78 A;  5AAV B;  5DKS A;  4QE8 A;  3W0J A;  3OSW A;  2JFA B;  4OIV A;  4OEA A;  2P1T A;  3L0J A;  4PPS A;  5FQR A;  2ZL9 A;  2VV1 B;  2QMV A;  3WMH A;  3OS9 A;  5APJ A;  1OSV A;  3OMP A;  2HVC A;  2PIW A;  2BAW A;  2BJ4 B;  2PIQ A;  4FN9 A;  3D57 A;  1SR7 A;  3ADS A;  5E1C A;  5E14 A;  2ZBS A;  3PLZ A;  4MGA B;  5DKB A;  3A3Z X;  4MG5 A;  1SJ0 A;  1A52 A;  2ZNO A;  4OZR E;  5DXB A;  2ZVT A;  2Q1H A;  2ACL A;  4XI3 A;  4XT9 A;  1XDK A;  1G5Y A;  5HCV A;  2R6Y A;  3S9S A;  1YP0 A;  3VJS A;  2G44 A;  1ERR A;  2I0G A;  2VV4 B;  3VRT A;  5L7E A;  4PP5 A;  1PDU A;  3WWR A;  4OJ4 A;  4POH A;  3ZRA A;  3VTC A;  3AN3 A;  2ZK6 A;  3HM1 A;  1QKM A;  2Q60 A;  3FAL B;  4PPP A;  4EM9 A;  3KMR A;  3KDU A;  2XYW A;  3G8O A;  5DZ3 A;  3UVV A;  5M96 A;  3D24 A;  3BQD A;  3W5T A;  4DK7 A;  2P54 A;  4N8R A;  1ZGY A;  2QTU A;  4LNW A;  1X76 A;  3OS8 C;  3OSA A;  3B0Q A;  4DOR A;  2HB7 A;  2ZNN A;  2E2R A;  2P15 A;  2Q8S A;  5AWK A;  3AUQ A;  1XV9 B;  1X7R A;  1GS4 A;  2GPO A;  2Q5S A;  2ZK4 A;  4DOS A;  2ZMJ A;  5KD9 A;  3V9T A;  2ZXM A;  4M8H A;  4DM6 A;  3GWS X;  5DXQ A;  2AA6 A;  3A2I A;  3V9V A;  1M13 A;  3CS4 A;  5L11 A;  3FEI A;  5G42 A;  3UP3 A;  5DLR A;  1K74 A;  3RVF A;  3E00 A;  2Q6R A;  3U9Q A;  3W0C A;  5KRC A;  5KCW A;  1QKU A;  1R6G A;  3LMP A;  1OSH A;  3OMQ A;  1ZH7 A;  1IE9 A;  5G46 A;  3L0L A;  3VT9 A;  4IQR A;  3OMM A;  2HAM A;  3GBK A;  4G20 A;  5L7H A;  3F5C A;  4CI4 A;  5LWP A;  2R40 A;  2QA6 A;  2OM9 A;  4RUO X;  5ICK A;  5ETH A;  5DV3 A;  1YOK A;  2J7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...