4MG9A

Crystal structure of hera-lbd (y537s) in complex with butylparaben
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
244
structure length
241
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLEAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional profiling of environmental ligands for estrogen receptors.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Hormone receptor
source organism Homo sapiens
total genus 87
structure length 241
sequence length 244
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4mg9A00
4XAOA 3WFFA 2AA7A 2HFPA 3A9EA 3DT3A 1XVPB 1Y0XX 1FM9D 1PQCA 4TUZA 5E1CA 5DVCA 1NRLA 1Y0SA 3HO0A 3UP3A 1UHLB 5DIEA 5DWLA 3RLJA 4NB6A 3VJHA 4DQMA 1I37A 4ZN7A 3FS1A 4RUPA 3ZRBA 3V4AA 3VSOA 2GP7A 1XDKB 5KRLA 3UUAA 4MGAB 4QK4A 2FAIA 4MG8B 3DCTA 2P4YA 3R8AA 3KMRA 1NAXA 1PCGA 3F5CB 3WJ5A 4APUA 3H0AD 2VV4A 1EXAA 1T7RA 5ICKA 2AYRA 2ZLAA 4QM0A 4JGVA 3ADSA 5FQRA 1U9EA 3X36A 2QGWA 2ZNOA 1XLSE 2OCFA 2Q8SA 4IVWA 2OVMA 3B1MA 3WT5A 5DXGA 3W5QA 4OZRE 3ET2A 3W5RA 1MVCA 3KYTA 1U3RA 5KYAA 3VHWA 2P7GA 3GYUA 1KV6A 1I7GA 4PLDA 5DI7A 4JYIA 3HC6A 5DKEA 3JZBA 5G44A 2I4PA 5KROA 1KNUA 1T74A 5IXKA 4P6WA 2B23A 2QXSA 4A2JA 3MNPA 1YOWA 2E2RA 3L3ZA 4BCRA 5ACCA 2Q3YA 1A28A 3VRTA 2R6YA 3K23A 4JYGA 5AZTA 2P15A 1UOMA 2J7YA 3CDSA 3CS4A 2F4BA 3OKIA 1SQNA 2R40D 3D24A 4IW8A 4IV4A 5EC9A 2PIUA 4FN9A 1XP9A 4FHIA 3R8IA 3VJSA 1X7EA 3OZ0A 1YP0A 5JJMA 5DZHA 1T7FA 3RUUA 3CTBA 5DYBA 3RUTA 3HQ5A 1EREA 3OS8A 1U3SA 3OS9A 4YNKA 5L7EA 1QKNA 1R6GA 3VT8A 4MG7A 5DY8A 2ZBSA 2AAXA 5CJ6A 3R5MA 1SJ0A 3E00A 3A40X 2Q1HA 3B5RA 2JFAB 2Q70A 3FC6A 3R2AA 3KMZA 4OIUA 3G8OA 2FSZA 5DUEA 2PJLA 2ACLA 4QE8A 3MNOA 1G1UA 2QA8B 1NQ0A 5LGAA 5C4OA 3VJTA 4F9MA 3ET0A 3L1BA 5HYRA 4ZOMA 5KRKA 5KRAA 3DZUD 2IOGA 4K4JA 3EYBA 4LNWA 3CWDA 3G0WA 5AK2A 2PITA 1PQ6A 3ADTA 4XUHA 1PRGA 2EWPA 4G21A 1R1KA 2Q59B 3ADXA 2LBDA 3TX7B 2Q5GA 1M2ZA 4Y29A 1PQ9A 2G0GA 5F9BA 3VHVA 1G5YA 2HARA 5KD9A 3FEJA 4PRGA 2JFAA 1NDEA 1PZLA 2GWXA 5APHA 3AN3A 1ZDTA 4OFUA 4S0SA 4K6IA 2XKWA 2ZLCA 5DWIA 5KR9A 3OZJA 4JYHA 4MG5A 3IPSA 4REFA 3B66A 2NPAA 1GWXA 1XIUA 1S19A 2P1UA 1YA3A 3A9EB 4OJBA 1NHZA 2QA8A 1YJEA 4HEEX 4TUZB 3VSPA 3VT6A 5B5BA 3ADWA 1VJBA 5G46A 4EM9A 4XLDA 5B41A 3DZYA 4XT9A 3RVFA 1NYXA 5GIEA 5DWJA 2YLPA 3IPUA 5E0XA 2V0VA 3NOAA 3OMMA 5APKA 3UUAB 3ZR7A 2Q59A 3BC5A 3V9TA 1XNXA 4LNXA 3CDPA 4OEYA 1FBYA 5DMFA 4OC7A 5DMCA 5HZCA 3GD2A 3CLDA 4PVUA 2XYJA 3HZFA 5DSHA 1ZKYA 3WTQA 2VV4B 3VRUA 3DCUA 5GT4A 5KRCA 4QL8A 1MV9A 3LBDA 3B65A 1R5KA 5IAWA 3IA6A 3WT6A 4LSJA 3R8DA 4REEA 4J5WC 4KZIA 2J4AA 3ZQTA 2B1ZA 5DXEA 4WQPA 5DXQA 3VT4A 3VT5A 5DTVA 5DLRA 5APJA 5KRFA 5DKGA 3FEIA 4QE6A 5DRMA 2NW4A 4OKXA 5E14A 3U9QA 2QXMA 1Z5XU 4UDBA 2OUZA 2VV0A 2AB2A 4N1YA 3FLIA 2QZOA 1OSHA 4PWLA 5DXKA 3AFRA 1YYEA 2R6WA 2ZFXA 3OMQA 1OVLA 4IA2A 4OEDA 2PRGA 5I4VA 2P54A 3VRVA 2QNVA 2YFEA 5C4SA 1OT7A 2JF9A 3CS8A 4FHHA 4MGDA 2AA2A 1E3KA 4J5WA 1ERRA 1HG4A 3AN4A 3VTDA 2HASA 1SKXA 4PP3A 4OZTE 1I7IA 1MZNA 4OKWA 4ZO1B 5JJMB 1T7TA 4FGYA 5DWGA 2POGA 2QSEA 3A2JA 5G43A 5DXBB 4ONIA 1T5ZA 1BSXA 1P8DA 5HYKA 5KRJA 3UVVB 4OILA 4UDAA 3MNEA 3PRGA 5KCTA 4MG7B 4NIEA 3V3EA 2H77A 2O4JA 2YATA 3DY6A 2AX9A 3G9EA 4IUIA 4RZGA 3WFGA 3V9YA 1KKQA 2GTKA 2NXXA 3KPZA 3Q95A 5DX3A 5EI1A 2VV1A 2ZK5A 4M8HA 2P7ZA 2J7XA 3FC6B 5DZ3A 1FCYA 2Z4BA 4WVDA 1NQ7A 3HVLA 1T7MA 4X1FA 2O4RA 3OSWA 2ACLB 2BAWA 2P1VA 4MDDA 5DKSA 5DP0A 5EHJA 2Z4JA 3DR1A 1RDTA 4XHDA 5DWEA 1YMTA 2Q7JA 4OEAA 2PNUA 1XPCA 4POHA 2QGTA 5DZ1A 4ZO1X 5EITA 1XV9B 3P8XA 4G2IA 4ZNUA 1XZXX 3B0RA 3A3ZX 3OGTA 2PKLA 3VHUA 5DYDA 5DIDA 3OSAA 1P93A 3A78A 4G1YA 5DXBA 4ZNSA 3FALB 3UVVA 5DRJA 4PLEA 2VV2A 4IU7A 4UDCA 2ZK3A 3AURA 4IWCA 3P89A 3ADUA 2AX8A 4L98A 1YY4A 5DXRA 3TKMA 3SZ1A 3UUCA 4DMAA 2Q5PA 3NSQA 3OSIA 3GYTA 4K7AA 5AAVA 4OARA 3P0UA 2ZXMA 2HCDA 2Q7IA 4ZNWA 1RDTD 2YLQA 4DK8A 2Q61A 2AX6A 2G5OA 4ZNTA 2ZK4A 1H9UA 1QKMA 3AUQA 3B0WA 4IVYA 3PBAA 3VN2A 4DORA 1XV9A 3FXVA 4IA1A 4OIVA 4TV1B 5DV6A 2BJ4A 5KCUA 4KZMA 2PIRA 4DM6A 1NAVA 4WLBA 3RLLA 3FALA 1RKGA 4MGBA 3IXPA 3K22A 2HAMA 2ZNPA 1XAPA 3D90A 1UPVA 2ZXNA 3D57A 3GN8A 3W0AA 3E00D 4XI3A 3VI8A 3A2IA 3W5TA 3OLSA 2PIVA 5KRHA 3L0EA 4PPSA 1XOWA 5DVVA 1QKTA 5L7GA 3PCUA 1K74A 4OJ4A 4RUJA 3W0GA 2P1TA 3ET3A 2ZL9A 3KMGA 4JL4A 4OH6A 4OK1A 4R2UA 3V9VA 5KCEA 4P6XA 2QW4A 2ZK6A 3S9SA 4ZN9A 1RKHA 2ZK0A 5DV8A 4NUFA 1X7BA 5G3JA 5L7HA 3WMHA 2Q1VA 3ERTA 2AA6A 4MG9A 4O8FA 5DIGA 2ZNQA 3K8SA 3UUDA 4TV1A 4CSJA 5GICA 1R1KD 2QZOB 1G2NA 3D6DA 3OMPA 5EGVA 4ZJRA 3ET1A 5HJPA 2ZNNA 4RFWA 4RAKA 2AM9A 4YT1A 3HC5A 4DK7A 2J14A 1EXXA 1GWQA 4OZRU 1YIMA 1OVLB 2HBHA 1YUCA 3B0QA 4Q50A 3VJIA 4XTAA 2GL8A 1ZGYA 3HLVA 3JZCA 4N8RA 5DXMA 5E7VA 4MGDB 1XQCA 2ABIA 1FM9A 4IQRA 3AZ1A 3LMPA 1N4HA 3ERDA 3PO9A 3AZ3A 1DB1A 1NQ1A 3GZ9A 3M7RA 5EJVA 3DZYD 1M7WA 3UU7A 4OLMA 3VT9A 1RJKA 1NQ2A 2XYXA 4MGCA 4S14A 5G45A 1Z95A 2PINA 2YHDA 4WHGA 2W8YA 4CI4A 2PIQA 5KCFA 2QE4A 2XHSA 5FQSA 3IMYA 3Q95B 5DX3B 2QMVA 2JJ3A 1RK3A 2VV1B 3GWXA 4LBDA 5HCVA 3OMOA 3W0JA 4OEZA 1X78A 1ZDUA 2AA5A 3E7CA 5KCWA 3P88A 3VT3A 2GPPA 4NY9A 5AYGA 4RMEA 1LV2A 4E4KA 2OM9A 3W0HA 4E2JA 5KCCA 5JY3A 5HJSA 1T65A 2VV3A 2AMAA 4J24A 3FUGA 1FCXA 2ATHA 1TFCA 4R06A 4S0TA 3AX8A 2I0JA 5C4UA 3ZRAA 5DV3A 3KWYA 1XLSA 4WPFA 4PP6A 1N46A 1N83A 4J26A 4OKBA 4RZFA 4G2HA 1I38A 4G20A 3O1EA 2O9IA 5DUGA 4UDDA 1XP1A 1ILHA 2QABA 2IHQA 1FCZA 3OOFA 4Q13A 1YINA 5AAUA 2PIXA 2Q5SA 1NUOA 1L2IA 4OJ9A 3OKHA 4ZNHA 1FD0A 3T03A 3CJWA 2GPOA 1T63A 4PPPA 2AMBA 3ILZA 1QKUA 4HLWA 3PLZA 5DVSA 1M13A 2Q6SA 4IA3A 1ZUCA 4OKTA 2HVCA 2PIWA 4WHFA 5LWPA 2R40A 5AAVB 1XVPA 2NV7A 3VTBA 4OHAA 4QJRA 1ILGA 1UHLA 3A2HA 2ZVTA 4A4VA 5E15A 3CS6A 3FURA 3R29A 4IV2A 3W0IA 3SP9A 2H79A 5IZ0A 5KRIA 2NXXE 2QA6A 2IOKA 1S9QA 1T79A 1R20A 1Y9RA 3D5FA 3OS8C 4J5XC 4RZEA 5DXPA 1XDKA 2I0GA 1S9PA 1X7JA 1S0XA 2BJ4B 2HC4A 1HJ1A 4MGAA 4PP5A 3W0YA 1XP6A 2VSTA 4MG8A 5C4TA 4MG6A 4MGBB 1SR7A 4ITEA 4G1DA 2AO6A 3WJ4A 1PDUA 3F5CA 2OVHA 3V49A 4IS8A 1Z5XE 2AXAA 3E94A 2ZXZA 3L0JA 3OOKA 5FQPA 4ZJWA 1ZEOA 2ZMIA 5DL4A 4XUMA 3VTCA 2OZ7A 4IA7A 4JAZA 2QPYA 3SP6A 4A4WA 1OSVA 1GWRA 2AX7A 5M96A 4EMAA 5DZ0A 1XQ3A 3L3XA 3OLFA 2ZKCA 3R5NA 4OGHA 1K7LA 3CQVA 4L96A 3B67A 1YOKA 5DZIA 4E4QA 1GS4A 4N73A 1DKFB 2PIPL 2V7CA 5SYZA 3X31A 4M8EA 1R20D 3G8IA 2HWQA 1XJ7A 2GIUA 4J5XA 4MG9B 4PXMA 5FQTA 5K13A 1IE9A 4S15A 3UUDB 2YJAB 2ZK2A 5KYJA 2G0HA 2I4JA 2VSRA 3HM1A 1UPWA 4LTWA 1E3GA 1X76A 2ZMHA 3GWSX 3QT0A 4R6SA 1U3QA 3X1IA 4ZI1A 4DOSA 1A52A 3KFCA 3WGPA 5HJPB 5DK9A 1XNNA 3IPQA 3B0TA 4ZNVA 5A86A 1WM0X 2Q7LA 3PEQA 4OH5A 2Q6JA 4RWVA 3TY0A 2ZMJA 4N5GA 4G1ZA 2GPUA 3L0LA 1L2JA 3F7DA 5AZVA 1T73A 3BEJA 3X1HA 3UP0A 1IE8A 2HB7A 3V3QA 2HB8A 2Q7KA 2QR9A 3WWRA 1DKFA 2G44A 3KDTA 4FNEA 4ITFA 3H52A 3UU7B 2PIOA 2P7AA 3OMKA 3TKCA 2Q6RA 3N00A 5G42A 1G50A 2POBA 1FM6A 3OAPA 4YMQA 2ZY0A 5DU5A 3L03A 3GBKA 4PF3A 3RY9A 4RMDA 1X7RA 5DKBA 3KBAA 3HODA 3IXPD 1LBDA 4CI5A 5H1EA 3DZUA 2YLOA 2HWRA 5KRMA 3VRWA 2B1VA 4Q0AC 1Q4XA 2AWHA 5JI0D 4POJA 4OZTU 3WT7A 2ZASA 2Q60A 2FVJA 5GIDA 4DM8A 1K74D 3ADVA 3AZ2A 5G5WA 5L11A 3O1DA 4KZJA 4IWFA 2OAXA 4RE8A 4RMCA 5E19A 5DUHA 3K6PA 1XB7A 2GPVA 3KDUA 5KCDA 3OLLA 3W0CA 1TXIA 1ZAFA 5AVLA 4OFRA 5AWKA 2REWA 1FM6D 2YJDA 5AWJA 1ZH7A 4B7WA 3VT7A 3B68A 3NSPA 5FQVA 2QH6A 4IW6A 2XYWA 3W5PA 4X1GA 2QTUA 2ZK1A 4YPQA 1K4WA 2I4ZA 2YLYA 4RUOX 5ETHA 1PK5A 1S0ZA 3AUNA 5E0WA 3H0AA 1T76A 2B50A 2A3IA 5AVIA 4NQAB 3BQDA 3B3KA
chains in the Genus database with same CATH superfamily
4XAOA 3WFFA 2AA7A 2HFPA 3A9EA 3DT3A 1XVPB 1Y0XX 1FM9D 1PQCA 4TUZA 5E1CA 5DVCA 1NRLA 1Y0SA 3HO0A 3UP3A 1UHLB 5DIEA 5DWLA 3RLJA 4NB6A 3VJHA 4DQMA 1I37A 4ZN7A 3FS1A 4RUPA 3ZRBA 3V4AA 3VSOA 2GP7A 1XDKB 5KRLA 3UUAA 4MGAB 4QK4A 2FAIA 4MG8B 3DCTA 2P4YA 3R8AA 3KMRA 1NAXA 1PCGA 3F5CB 3WJ5A 4APUA 3H0AD 2VV4A 1EXAA 1T7RA 5ICKA 2AYRA 2ZLAA 4QM0A 4JGVA 3ADSA 5FQRA 1U9EA 3X36A 2QGWA 2ZNOA 1XLSE 2OCFA 2Q8SA 4IVWA 2OVMA 3B1MA 3WT5A 5DXGA 3W5QA 4OZRE 3ET2A 3W5RA 1MVCA 3KYTA 1U3RA 5KYAA 3VHWA 2P7GA 3GYUA 1KV6A 1I7GA 4PLDA 5DI7A 4JYIA 3HC6A 5DKEA 3JZBA 5G44A 2I4PA 5KROA 1KNUA 1T74A 5IXKA 4P6WA 2B23A 2QXSA 4A2JA 3MNPA 1YOWA 2E2RA 3L3ZA 4BCRA 5ACCA 2Q3YA 1A28A 3VRTA 2R6YA 3K23A 4JYGA 5AZTA 2P15A 1UOMA 2J7YA 3CDSA 3CS4A 2F4BA 3OKIA 1SQNA 2R40D 3D24A 4IW8A 4IV4A 5EC9A 2PIUA 4FN9A 1XP9A 4FHIA 3R8IA 3VJSA 1X7EA 3OZ0A 1YP0A 5JJMA 5DZHA 1T7FA 3RUUA 3CTBA 5DYBA 3RUTA 3HQ5A 1EREA 3OS8A 1U3SA 3OS9A 4YNKA 5L7EA 1QKNA 1R6GA 3VT8A 4MG7A 5DY8A 2ZBSA 2AAXA 5CJ6A 3R5MA 1SJ0A 3E00A 3A40X 2Q1HA 3B5RA 2JFAB 2Q70A 3FC6A 3R2AA 3KMZA 4OIUA 3G8OA 2FSZA 5DUEA 2PJLA 2ACLA 4QE8A 3MNOA 1G1UA 2QA8B 1NQ0A 5LGAA 5C4OA 3VJTA 4F9MA 3ET0A 3L1BA 5HYRA 4ZOMA 5KRKA 5KRAA 3DZUD 2IOGA 4K4JA 3EYBA 4LNWA 3CWDA 3G0WA 5AK2A 2PITA 1PQ6A 3ADTA 4XUHA 1PRGA 2EWPA 4G21A 1R1KA 2Q59B 3ADXA 2LBDA 3TX7B 2Q5GA 1M2ZA 4Y29A 1PQ9A 2G0GA 5F9BA 3VHVA 1G5YA 2HARA 5KD9A 3FEJA 4PRGA 2JFAA 1NDEA 1PZLA 2GWXA 5APHA 3AN3A 1ZDTA 4OFUA 4S0SA 4K6IA 2XKWA 2ZLCA 5DWIA 5KR9A 3OZJA 4JYHA 4MG5A 3IPSA 4REFA 3B66A 2NPAA 1GWXA 1XIUA 1S19A 2P1UA 1YA3A 3A9EB 4OJBA 1NHZA 2QA8A 1YJEA 4HEEX 4TUZB 3VSPA 3VT6A 5B5BA 3ADWA 1VJBA 5G46A 4EM9A 4XLDA 5B41A 3DZYA 4XT9A 3RVFA 1NYXA 5GIEA 5DWJA 2YLPA 3IPUA 5E0XA 2V0VA 3NOAA 3OMMA 5APKA 3UUAB 3ZR7A 2Q59A 3BC5A 3V9TA 1XNXA 4LNXA 3CDPA 4OEYA 1FBYA 5DMFA 4OC7A 5DMCA 5HZCA 3GD2A 3CLDA 4PVUA 2XYJA 3HZFA 5DSHA 1ZKYA 3WTQA 2VV4B 3VRUA 3DCUA 5GT4A 5KRCA 4QL8A 1MV9A 3LBDA 3B65A 1R5KA 5IAWA 3IA6A 3WT6A 4LSJA 3R8DA 4REEA 4J5WC 4KZIA 2J4AA 3ZQTA 2B1ZA 5DXEA 4WQPA 5DXQA 3VT4A 3VT5A 5DTVA 5DLRA 5APJA 5KRFA 5DKGA 3FEIA 4QE6A 5DRMA 2NW4A 4OKXA 5E14A 3U9QA 2QXMA 1Z5XU 4UDBA 2OUZA 2VV0A 2AB2A 4N1YA 3FLIA 2QZOA 1OSHA 4PWLA 5DXKA 3AFRA 1YYEA 2R6WA 2ZFXA 3OMQA 1OVLA 4IA2A 4OEDA 2PRGA 5I4VA 2P54A 3VRVA 2QNVA 2YFEA 5C4SA 1OT7A 2JF9A 3CS8A 4FHHA 4MGDA 2AA2A 1E3KA 4J5WA 1ERRA 1HG4A 3AN4A 3VTDA 2HASA 1SKXA 4PP3A 4OZTE 1I7IA 1MZNA 4OKWA 4ZO1B 5JJMB 1T7TA 4FGYA 5DWGA 2POGA 2QSEA 3A2JA 5G43A 5DXBB 4ONIA 1T5ZA 1BSXA 1P8DA 5HYKA 5KRJA 3UVVB 4OILA 4UDAA 3MNEA 3PRGA 5KCTA 4MG7B 4NIEA 3V3EA 2H77A 2O4JA 2YATA 3DY6A 2AX9A 3G9EA 4IUIA 4RZGA 3WFGA 3V9YA 1KKQA 2GTKA 2NXXA 3KPZA 3Q95A 5DX3A 5EI1A 2VV1A 2ZK5A 4M8HA 2P7ZA 2J7XA 3FC6B 5DZ3A 1FCYA 2Z4BA 4WVDA 1NQ7A 3HVLA 1T7MA 4X1FA 2O4RA 3OSWA 2ACLB 2BAWA 2P1VA 4MDDA 5DKSA 5DP0A 5EHJA 2Z4JA 3DR1A 1RDTA 4XHDA 5DWEA 1YMTA 2Q7JA 4OEAA 2PNUA 1XPCA 4POHA 2QGTA 5DZ1A 4ZO1X 5EITA 1XV9B 3P8XA 4G2IA 4ZNUA 1XZXX 3B0RA 3A3ZX 3OGTA 2PKLA 3VHUA 5DYDA 5DIDA 3OSAA 1P93A 3A78A 4G1YA 5DXBA 4ZNSA 3FALB 3UVVA 5DRJA 4PLEA 2VV2A 4IU7A 4UDCA 2ZK3A 3AURA 4IWCA 3P89A 3ADUA 2AX8A 4L98A 1YY4A 5DXRA 3TKMA 3SZ1A 3UUCA 4DMAA 2Q5PA 3NSQA 3OSIA 3GYTA 4K7AA 5AAVA 4OARA 3P0UA 2ZXMA 2HCDA 2Q7IA 4ZNWA 1RDTD 2YLQA 4DK8A 2Q61A 2AX6A 2G5OA 4ZNTA 2ZK4A 1H9UA 1QKMA 3AUQA 3B0WA 4IVYA 3PBAA 3VN2A 4DORA 1XV9A 3FXVA 4IA1A 4OIVA 4TV1B 5DV6A 2BJ4A 5KCUA 4KZMA 2PIRA 4DM6A 1NAVA 4WLBA 3RLLA 3FALA 1RKGA 4MGBA 3IXPA 3K22A 2HAMA 2ZNPA 1XAPA 3D90A 1UPVA 2ZXNA 3D57A 3GN8A 3W0AA 3E00D 4XI3A 3VI8A 3A2IA 3W5TA 3OLSA 2PIVA 5KRHA 3L0EA 4PPSA 1XOWA 5DVVA 1QKTA 5L7GA 3PCUA 1K74A 4OJ4A 4RUJA 3W0GA 2P1TA 3ET3A 2ZL9A 3KMGA 4JL4A 4OH6A 4OK1A 4R2UA 3V9VA 5KCEA 4P6XA 2QW4A 2ZK6A 3S9SA 4ZN9A 1RKHA 2ZK0A 5DV8A 4NUFA 1X7BA 5G3JA 5L7HA 3WMHA 2Q1VA 3ERTA 2AA6A 4MG9A 4O8FA 5DIGA 2ZNQA 3K8SA 3UUDA 4TV1A 4CSJA 5GICA 1R1KD 2QZOB 1G2NA 3D6DA 3OMPA 5EGVA 4ZJRA 3ET1A 5HJPA 2ZNNA 4RFWA 4RAKA 2AM9A 4YT1A 3HC5A 4DK7A 2J14A 1EXXA 1GWQA 4OZRU 1YIMA 1OVLB 2HBHA 1YUCA 3B0QA 4Q50A 3VJIA 4XTAA 2GL8A 1ZGYA 3HLVA 3JZCA 4N8RA 5DXMA 5E7VA 4MGDB 1XQCA 2ABIA 1FM9A 4IQRA 3AZ1A 3LMPA 1N4HA 3ERDA 3PO9A 3AZ3A 1DB1A 1NQ1A 3GZ9A 3M7RA 5EJVA 3DZYD 1M7WA 3UU7A 4OLMA 3VT9A 1RJKA 1NQ2A 2XYXA 4MGCA 4S14A 5G45A 1Z95A 2PINA 2YHDA 4WHGA 2W8YA 4CI4A 2PIQA 5KCFA 2QE4A 2XHSA 5FQSA 3IMYA 3Q95B 5DX3B 2QMVA 2JJ3A 1RK3A 2VV1B 3GWXA 4LBDA 5HCVA 3OMOA 3W0JA 4OEZA 1X78A 1ZDUA 2AA5A 3E7CA 5KCWA 3P88A 3VT3A 2GPPA 4NY9A 5AYGA 4RMEA 1LV2A 4E4KA 2OM9A 3W0HA 4E2JA 5KCCA 5JY3A 5HJSA 1T65A 2VV3A 2AMAA 4J24A 3FUGA 1FCXA 2ATHA 1TFCA 4R06A 4S0TA 3AX8A 2I0JA 5C4UA 3ZRAA 5DV3A 3KWYA 1XLSA 4WPFA 4PP6A 1N46A 1N83A 4J26A 4OKBA 4RZFA 4G2HA 1I38A 4G20A 3O1EA 2O9IA 5DUGA 4UDDA 1XP1A 1ILHA 2QABA 2IHQA 1FCZA 3OOFA 4Q13A 1YINA 5AAUA 2PIXA 2Q5SA 1NUOA 1L2IA 4OJ9A 3OKHA 4ZNHA 1FD0A 3T03A 3CJWA 2GPOA 1T63A 4PPPA 2AMBA 3ILZA 1QKUA 4HLWA 3PLZA 5DVSA 1M13A 2Q6SA 4IA3A 1ZUCA 4OKTA 2HVCA 2PIWA 4WHFA 5LWPA 2R40A 5AAVB 1XVPA 2NV7A 3VTBA 4OHAA 4QJRA 1ILGA 1UHLA 3A2HA 2ZVTA 4A4VA 5E15A 3CS6A 3FURA 3R29A 4IV2A 3W0IA 3SP9A 2H79A 5IZ0A 5KRIA 2NXXE 2QA6A 2IOKA 1S9QA 1T79A 1R20A 1Y9RA 3D5FA 3OS8C 4J5XC 4RZEA 5DXPA 1XDKA 2I0GA 1S9PA 1X7JA 1S0XA 2BJ4B 2HC4A 1HJ1A 4MGAA 4PP5A 3W0YA 1XP6A 2VSTA 4MG8A 5C4TA 4MG6A 4MGBB 1SR7A 4ITEA 4G1DA 2AO6A 3WJ4A 1PDUA 3F5CA 2OVHA 3V49A 4IS8A 1Z5XE 2AXAA 3E94A 2ZXZA 3L0JA 3OOKA 5FQPA 4ZJWA 1ZEOA 2ZMIA 5DL4A 4XUMA 3VTCA 2OZ7A 4IA7A 4JAZA 2QPYA 3SP6A 4A4WA 1OSVA 1GWRA 2AX7A 5M96A 4EMAA 5DZ0A 1XQ3A 3L3XA 3OLFA 2ZKCA 3R5NA 4OGHA 1K7LA 3CQVA 4L96A 3B67A 1YOKA 5DZIA 4E4QA 1GS4A 4N73A 1DKFB 2PIPL 2V7CA 5SYZA 3X31A 4M8EA 1R20D 3G8IA 2HWQA 1XJ7A 2GIUA 4J5XA 4MG9B 4PXMA 5FQTA 5K13A 1IE9A 4S15A 3UUDB 2YJAB 2ZK2A 5KYJA 2G0HA 2I4JA 2VSRA 3HM1A 1UPWA 4LTWA 1E3GA 1X76A 2ZMHA 3GWSX 3QT0A 4R6SA 1U3QA 3X1IA 4ZI1A 4DOSA 1A52A 3KFCA 3WGPA 5HJPB 5DK9A 1XNNA 3IPQA 3B0TA 4ZNVA 5A86A 1WM0X 2Q7LA 3PEQA 4OH5A 2Q6JA 4RWVA 3TY0A 2ZMJA 4N5GA 4G1ZA 2GPUA 3L0LA 1L2JA 3F7DA 5AZVA 1T73A 3BEJA 3X1HA 3UP0A 1IE8A 2HB7A 3V3QA 2HB8A 2Q7KA 2QR9A 3WWRA 1DKFA 2G44A 3KDTA 4FNEA 4ITFA 3H52A 3UU7B 2PIOA 2P7AA 3OMKA 3TKCA 2Q6RA 3N00A 5G42A 1G50A 2POBA 1FM6A 3OAPA 4YMQA 2ZY0A 5DU5A 3L03A 3GBKA 4PF3A 3RY9A 4RMDA 1X7RA 5DKBA 3KBAA 3HODA 3IXPD 1LBDA 4CI5A 5H1EA 3DZUA 2YLOA 2HWRA 5KRMA 3VRWA 2B1VA 4Q0AC 1Q4XA 2AWHA 5JI0D 4POJA 4OZTU 3WT7A 2ZASA 2Q60A 2FVJA 5GIDA 4DM8A 1K74D 3ADVA 3AZ2A 5G5WA 5L11A 3O1DA 4KZJA 4IWFA 2OAXA 4RE8A 4RMCA 5E19A 5DUHA 3K6PA 1XB7A 2GPVA 3KDUA 5KCDA 3OLLA 3W0CA 1TXIA 1ZAFA 5AVLA 4OFRA 5AWKA 2REWA 1FM6D 2YJDA 5AWJA 1ZH7A 4B7WA 3VT7A 3B68A 3NSPA 5FQVA 2QH6A 4IW6A 2XYWA 3W5PA 4X1GA 2QTUA 2ZK1A 4YPQA 1K4WA 2I4ZA 2YLYA 4RUOX 5ETHA 1PK5A 1S0ZA 3AUNA 5E0WA 3H0AA 1T76A 2B50A 2A3IA 5AVIA 4NQAB 3BQDA 3B3KA
chains in the Genus database with same CATH topology
4XAOA 3WFFA 2AA7A 2HFPA 3A9EA 3DT3A 1XVPB 1Y0XX 1FM9D 1PQCA 4TUZA 5E1CA 5DVCA 1NRLA 1Y0SA 3HO0A 3UP3A 1UHLB 5DIEA 5DWLA 3RLJA 4NB6A 3VJHA 4DQMA 1I37A 4ZN7A 3FS1A 4RUPA 3ZRBA 3V4AA 3VSOA 2GP7A 1XDKB 5KRLA 3UUAA 4MGAB 4QK4A 2FAIA 4MG8B 3DCTA 2P4YA 3R8AA 3KMRA 1NAXA 1PCGA 3F5CB 3WJ5A 4APUA 3H0AD 2VV4A 1EXAA 1T7RA 5ICKA 2AYRA 2ZLAA 4QM0A 4JGVA 3ADSA 5FQRA 1U9EA 3X36A 2QGWA 2ZNOA 1XLSE 2OCFA 2Q8SA 4IVWA 2OVMA 3B1MA 3WT5A 5DXGA 3W5QA 4OZRE 3ET2A 3W5RA 1MVCA 3KYTA 1U3RA 5KYAA 3VHWA 2P7GA 3GYUA 1KV6A 1I7GA 4PLDA 5DI7A 4JYIA 3HC6A 5DKEA 3JZBA 5G44A 2I4PA 5KROA 1KNUA 1T74A 5IXKA 4P6WA 2B23A 2QXSA 4A2JA 3MNPA 1YOWA 2E2RA 3L3ZA 4BCRA 5ACCA 2Q3YA 1A28A 3VRTA 2R6YA 3K23A 4JYGA 5AZTA 2P15A 1UOMA 2J7YA 3CDSA 3CS4A 2F4BA 3OKIA 1SQNA 2R40D 3D24A 4IW8A 4IV4A 5EC9A 2PIUA 4FN9A 1XP9A 4FHIA 3R8IA 3VJSA 1X7EA 3OZ0A 1YP0A 5JJMA 5DZHA 1T7FA 3RUUA 3CTBA 5DYBA 3RUTA 3HQ5A 1EREA 3OS8A 1U3SA 3OS9A 4YNKA 5L7EA 1QKNA 1R6GA 3VT8A 4MG7A 5DY8A 2ZBSA 2AAXA 5CJ6A 3R5MA 1SJ0A 3E00A 3A40X 2Q1HA 3B5RA 2JFAB 2Q70A 3FC6A 3R2AA 3KMZA 4OIUA 3G8OA 2FSZA 5DUEA 2PJLA 2ACLA 4QE8A 3MNOA 1G1UA 2QA8B 1NQ0A 5LGAA 5C4OA 3VJTA 4F9MA 3ET0A 3L1BA 5HYRA 4ZOMA 5KRKA 5KRAA 3DZUD 2IOGA 4K4JA 3EYBA 4LNWA 3CWDA 3G0WA 5AK2A 2PITA 1PQ6A 3ADTA 4XUHA 1PRGA 2EWPA 4G21A 1R1KA 2Q59B 3ADXA 2LBDA 3TX7B 2Q5GA 1M2ZA 4Y29A 1PQ9A 2G0GA 5F9BA 3VHVA 1G5YA 2HARA 5KD9A 3FEJA 4PRGA 2JFAA 1NDEA 1PZLA 2GWXA 5APHA 3AN3A 1ZDTA 4OFUA 4S0SA 4K6IA 2XKWA 2ZLCA 5DWIA 5KR9A 3OZJA 4JYHA 4MG5A 3IPSA 4REFA 3B66A 2NPAA 1GWXA 1XIUA 1S19A 2P1UA 1YA3A 3A9EB 4OJBA 1NHZA 2QA8A 1YJEA 4HEEX 4TUZB 3VSPA 3VT6A 5B5BA 3ADWA 1VJBA 5G46A 4EM9A 4XLDA 5B41A 3DZYA 4XT9A 3RVFA 1NYXA 5GIEA 5DWJA 2YLPA 3IPUA 5E0XA 2V0VA 3NOAA 3OMMA 5APKA 3UUAB 3ZR7A 2Q59A 3BC5A 3V9TA 1XNXA 4LNXA 3CDPA 4OEYA 1FBYA 5DMFA 4OC7A 5DMCA 5HZCA 3GD2A 3CLDA 4PVUA 2XYJA 3HZFA 5DSHA 1ZKYA 3WTQA 2VV4B 3VRUA 3DCUA 5GT4A 5KRCA 4QL8A 1MV9A 3LBDA 3B65A 1R5KA 5IAWA 3IA6A 3WT6A 4LSJA 3R8DA 4REEA 4J5WC 4KZIA 2J4AA 3ZQTA 2B1ZA 5DXEA 4WQPA 5DXQA 3VT4A 3VT5A 5DTVA 5DLRA 5APJA 5KRFA 5DKGA 3FEIA 4QE6A 5DRMA 2NW4A 4OKXA 5E14A 3U9QA 2QXMA 1Z5XU 4UDBA 2OUZA 2VV0A 2AB2A 4N1YA 3FLIA 2QZOA 1OSHA 4PWLA 5DXKA 3AFRA 1YYEA 2R6WA 2ZFXA 3OMQA 1OVLA 4IA2A 4OEDA 2PRGA 5I4VA 2P54A 3VRVA 2QNVA 2YFEA 5C4SA 1OT7A 2JF9A 3CS8A 4FHHA 4MGDA 2AA2A 1E3KA 4J5WA 1ERRA 1HG4A 3AN4A 3VTDA 2HASA 1SKXA 4PP3A 4OZTE 1I7IA 1MZNA 4OKWA 4ZO1B 5JJMB 1T7TA 4FGYA 5DWGA 2POGA 2QSEA 3A2JA 5G43A 5DXBB 4ONIA 1T5ZA 1BSXA 1P8DA 5HYKA 5KRJA 3UVVB 4OILA 4UDAA 3MNEA 3PRGA 5KCTA 4MG7B 4NIEA 3V3EA 2H77A 2O4JA 2YATA 3DY6A 2AX9A 3G9EA 4IUIA 4RZGA 3WFGA 3V9YA 1KKQA 2GTKA 2NXXA 3KPZA 3Q95A 5DX3A 5EI1A 2VV1A 2ZK5A 4M8HA 2P7ZA 2J7XA 3FC6B 5DZ3A 1FCYA 2Z4BA 4WVDA 1NQ7A 3HVLA 1T7MA 4X1FA 2O4RA 3OSWA 2ACLB 2BAWA 2P1VA 4MDDA 5DKSA 5DP0A 5EHJA 2Z4JA 3DR1A 1RDTA 4XHDA 5DWEA 1YMTA 2Q7JA 4OEAA 2PNUA 1XPCA 4POHA 2QGTA 5DZ1A 4ZO1X 5EITA 1XV9B 3P8XA 4G2IA 4ZNUA 1XZXX 3B0RA 3A3ZX 3OGTA 2PKLA 3VHUA 5DYDA 5DIDA 3OSAA 1P93A 3A78A 4G1YA 5DXBA 4ZNSA 3FALB 3UVVA 5DRJA 4PLEA 2VV2A 4IU7A 4UDCA 2ZK3A 3AURA 4IWCA 3P89A 3ADUA 2AX8A 4L98A 1YY4A 5DXRA 3TKMA 3SZ1A 3UUCA 4DMAA 2Q5PA 3NSQA 3OSIA 3GYTA 4K7AA 5AAVA 4OARA 3P0UA 2ZXMA 2HCDA 2Q7IA 4ZNWA 1RDTD 2YLQA 4DK8A 2Q61A 2AX6A 2G5OA 4ZNTA 2ZK4A 1H9UA 1QKMA 3AUQA 3B0WA 4IVYA 3PBAA 3VN2A 4DORA 1XV9A 3FXVA 4IA1A 4OIVA 4TV1B 5DV6A 2BJ4A 5KCUA 4KZMA 2PIRA 4DM6A 1NAVA 4WLBA 3RLLA 3FALA 1RKGA 4MGBA 3IXPA 3K22A 2HAMA 2ZNPA 1XAPA 3D90A 1UPVA 2ZXNA 3D57A 3GN8A 3W0AA 3E00D 4XI3A 3VI8A 3A2IA 3W5TA 3OLSA 2PIVA 5KRHA 3L0EA 4PPSA 1XOWA 5DVVA 1QKTA 5L7GA 3PCUA 1K74A 4OJ4A 4RUJA 3W0GA 2P1TA 3ET3A 2ZL9A 3KMGA 4JL4A 4OH6A 4OK1A 4R2UA 3V9VA 5KCEA 4P6XA 2QW4A 2ZK6A 3S9SA 4ZN9A 1RKHA 2ZK0A 5DV8A 4NUFA 1X7BA 5G3JA 5L7HA 3WMHA 2Q1VA 3ERTA 2AA6A 4MG9A 4O8FA 5DIGA 2ZNQA 3K8SA 3UUDA 4TV1A 4CSJA 5GICA 1R1KD 2QZOB 1G2NA 3D6DA 3OMPA 5EGVA 4ZJRA 3ET1A 5HJPA 2ZNNA 4RFWA 4RAKA 2AM9A 4YT1A 3HC5A 4DK7A 2J14A 1EXXA 1GWQA 4OZRU 1YIMA 1OVLB 2HBHA 1YUCA 3B0QA 4Q50A 3VJIA 4XTAA 2GL8A 1ZGYA 3HLVA 3JZCA 4N8RA 5DXMA 5E7VA 4MGDB 1XQCA 2ABIA 1FM9A 4IQRA 3AZ1A 3LMPA 1N4HA 3ERDA 3PO9A 3AZ3A 1DB1A 1NQ1A 3GZ9A 3M7RA 5EJVA 3DZYD 1M7WA 3UU7A 4OLMA 3VT9A 1RJKA 1NQ2A 2XYXA 4MGCA 4S14A 5G45A 1Z95A 2PINA 2YHDA 4WHGA 2W8YA 4CI4A 2PIQA 5KCFA 2QE4A 2XHSA 5FQSA 3IMYA 3Q95B 5DX3B 2QMVA 2JJ3A 1RK3A 2VV1B 3GWXA 4LBDA 5HCVA 3OMOA 3W0JA 4OEZA 1X78A 1ZDUA 2AA5A 3E7CA 5KCWA 3P88A 3VT3A 2GPPA 4NY9A 5AYGA 4RMEA 1LV2A 4E4KA 2OM9A 3W0HA 4E2JA 5KCCA 5JY3A 5HJSA 1T65A 2VV3A 2AMAA 4J24A 3FUGA 1FCXA 2ATHA 1TFCA 4R06A 4S0TA 3AX8A 2I0JA 5C4UA 3ZRAA 5DV3A 3KWYA 1XLSA 4WPFA 4PP6A 1N46A 1N83A 4J26A 4OKBA 4RZFA 4G2HA 1I38A 4G20A 3O1EA 2O9IA 5DUGA 4UDDA 1XP1A 1ILHA 2QABA 2IHQA 1FCZA 3OOFA 4Q13A 1YINA 5AAUA 2PIXA 2Q5SA 1NUOA 1L2IA 4OJ9A 3OKHA 4ZNHA 1FD0A 3T03A 3CJWA 2GPOA 1T63A 4PPPA 2AMBA 3ILZA 1QKUA 4HLWA 3PLZA 5DVSA 1M13A 2Q6SA 4IA3A 1ZUCA 4OKTA 2HVCA 2PIWA 4WHFA 5LWPA 2R40A 5AAVB 1XVPA 2NV7A 3VTBA 4OHAA 4QJRA 1ILGA 1UHLA 3A2HA 2ZVTA 4A4VA 5E15A 3CS6A 3FURA 3R29A 4IV2A 3W0IA 3SP9A 2H79A 5IZ0A 5KRIA 2NXXE 2QA6A 2IOKA 1S9QA 1T79A 1R20A 1Y9RA 3D5FA 3OS8C 4J5XC 4RZEA 5DXPA 1XDKA 2I0GA 1S9PA 1X7JA 1S0XA 2BJ4B 2HC4A 1HJ1A 4MGAA 4PP5A 3W0YA 1XP6A 2VSTA 4MG8A 5C4TA 4MG6A 4MGBB 1SR7A 4ITEA 4G1DA 2AO6A 3WJ4A 1PDUA 3F5CA 2OVHA 3V49A 4IS8A 1Z5XE 2AXAA 3E94A 2ZXZA 3L0JA 3OOKA 5FQPA 4ZJWA 1ZEOA 2ZMIA 5DL4A 4XUMA 3VTCA 2OZ7A 4IA7A 4JAZA 2QPYA 3SP6A 4A4WA 1OSVA 1GWRA 2AX7A 5M96A 4EMAA 5DZ0A 1XQ3A 3L3XA 3OLFA 2ZKCA 3R5NA 4OGHA 1K7LA 3CQVA 4L96A 3B67A 1YOKA 5DZIA 4E4QA 1GS4A 4N73A 1DKFB 2PIPL 2V7CA 5SYZA 3X31A 4M8EA 1R20D 3G8IA 2HWQA 1XJ7A 2GIUA 4J5XA 4MG9B 4PXMA 5FQTA 5K13A 1IE9A 4S15A 3UUDB 2YJAB 2ZK2A 5KYJA 2G0HA 2I4JA 2VSRA 3HM1A 1UPWA 4LTWA 1E3GA 1X76A 2ZMHA 3GWSX 3QT0A 4R6SA 1U3QA 3X1IA 4ZI1A 4DOSA 1A52A 3KFCA 3WGPA 5HJPB 5DK9A 1XNNA 3IPQA 3B0TA 4ZNVA 5A86A 1WM0X 2Q7LA 3PEQA 4OH5A 2Q6JA 4RWVA 3TY0A 2ZMJA 4N5GA 4G1ZA 2GPUA 3L0LA 1L2JA 3F7DA 5AZVA 1T73A 3BEJA 3X1HA 3UP0A 1IE8A 2HB7A 3V3QA 2HB8A 2Q7KA 2QR9A 3WWRA 1DKFA 2G44A 3KDTA 4FNEA 4ITFA 3H52A 3UU7B 2PIOA 2P7AA 3OMKA 3TKCA 2Q6RA 3N00A 5G42A 1G50A 2POBA 1FM6A 3OAPA 4YMQA 2ZY0A 5DU5A 3L03A 3GBKA 4PF3A 3RY9A 4RMDA 1X7RA 5DKBA 3KBAA 3HODA 3IXPD 1LBDA 4CI5A 5H1EA 3DZUA 2YLOA 2HWRA 5KRMA 3VRWA 2B1VA 4Q0AC 1Q4XA 2AWHA 5JI0D 4POJA 4OZTU 3WT7A 2ZASA 2Q60A 2FVJA 5GIDA 4DM8A 1K74D 3ADVA 3AZ2A 5G5WA 5L11A 3O1DA 4KZJA 4IWFA 2OAXA 4RE8A 4RMCA 5E19A 5DUHA 3K6PA 1XB7A 2GPVA 3KDUA 5KCDA 3OLLA 3W0CA 1TXIA 1ZAFA 5AVLA 4OFRA 5AWKA 2REWA 1FM6D 2YJDA 5AWJA 1ZH7A 4B7WA 3VT7A 3B68A 3NSPA 5FQVA 2QH6A 4IW6A 2XYWA 3W5PA 4X1GA 2QTUA 2ZK1A 4YPQA 1K4WA 2I4ZA 2YLYA 4RUOX 5ETHA 1PK5A 1S0ZA 3AUNA 5E0WA 3H0AA 1T76A 2B50A 2A3IA 5AVIA 4NQAB 3BQDA 3B3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XAO A;  3WFF A;  2AA7 A;  2HFP A;  3A9E A;  3DT3 A;  1XVP B;  1Y0X X;  1FM9 D;  1PQC A;  4TUZ A;  5E1C A;  5DVC A;  1NRL A;  1Y0S A;  3HO0 A;  3UP3 A;  1UHL B;  5DIE A;  5DWL A;  3RLJ A;  4NB6 A;  3VJH A;  4DQM A;  1I37 A;  4ZN7 A;  3FS1 A;  4RUP A;  3ZRB A;  3V4A A;  3VSO A;  2GP7 A;  1XDK B;  5KRL A;  3UUA A;  4MGA B;  4QK4 A;  2FAI A;  4MG8 B;  3DCT A;  2P4Y A;  3R8A A;  3KMR A;  1NAX A;  1PCG A;  3F5C B;  3WJ5 A;  4APU A;  3H0A D;  2VV4 A;  1EXA A;  1T7R A;  5ICK A;  2AYR A;  2ZLA A;  4QM0 A;  4JGV A;  3ADS A;  5FQR A;  1U9E A;  3X36 A;  2QGW A;  2ZNO A;  1XLS E;  2OCF A;  2Q8S A;  4IVW A;  2OVM A;  3B1M A;  3WT5 A;  5DXG A;  3W5Q A;  4OZR E;  3ET2 A;  3W5R A;  1MVC A;  3KYT A;  1U3R A;  5KYA A;  3VHW A;  2P7G A;  3GYU A;  1KV6 A;  1I7G A;  4PLD A;  5DI7 A;  4JYI A;  3HC6 A;  5DKE A;  3JZB A;  5G44 A;  2I4P A;  5KRO A;  1KNU A;  1T74 A;  5IXK A;  4P6W A;  2B23 A;  2QXS A;  4A2J A;  3MNP A;  1YOW A;  2E2R A;  3L3Z A;  4BCR A;  5ACC A;  2Q3Y A;  1A28 A;  3VRT A;  2R6Y A;  3K23 A;  4JYG A;  5AZT A;  2P15 A;  1UOM A;  2J7Y A;  3CDS A;  3CS4 A;  2F4B A;  3OKI A;  1SQN A;  2R40 D;  3D24 A;  4IW8 A;  4IV4 A;  5EC9 A;  2PIU A;  4FN9 A;  1XP9 A;  4FHI A;  3R8I A;  3VJS A;  1X7E A;  3OZ0 A;  1YP0 A;  5JJM A;  5DZH A;  1T7F A;  3RUU A;  3CTB A;  5DYB A;  3RUT A;  3HQ5 A;  1ERE A;  3OS8 A;  1U3S A;  3OS9 A;  4YNK A;  5L7E A;  1QKN A;  1R6G A;  3VT8 A;  4MG7 A;  5DY8 A;  2ZBS A;  2AAX A;  5CJ6 A;  3R5M A;  1SJ0 A;  3E00 A;  3A40 X;  2Q1H A;  3B5R A;  2JFA B;  2Q70 A;  3FC6 A;  3R2A A;  3KMZ A;  4OIU A;  3G8O A;  2FSZ A;  5DUE A;  2PJL A;  2ACL A;  4QE8 A;  3MNO A;  1G1U A;  2QA8 B;  1NQ0 A;  5LGA A;  5C4O A;  3VJT A;  4F9M A;  3ET0 A;  3L1B A;  5HYR A;  4ZOM A;  5KRK A;  5KRA A;  3DZU D;  2IOG A;  4K4J A;  3EYB A;  4LNW A;  3CWD A;  3G0W A;  5AK2 A;  2PIT A;  1PQ6 A;  3ADT A;  4XUH A;  1PRG A;  2EWP A;  4G21 A;  1R1K A;  2Q59 B;  3ADX A;  2LBD A;  3TX7 B;  2Q5G A;  1M2Z A;  4Y29 A;  1PQ9 A;  2G0G A;  5F9B A;  3VHV A;  1G5Y A;  2HAR A;  5KD9 A;  3FEJ A;  4PRG A;  2JFA A;  1NDE A;  1PZL A;  2GWX A;  5APH A;  3AN3 A;  1ZDT A;  4OFU A;  4S0S A;  4K6I A;  2XKW A;  2ZLC A;  5DWI A;  5KR9 A;  3OZJ A;  4JYH A;  4MG5 A;  3IPS A;  4REF A;  3B66 A;  2NPA A;  1GWX A;  1XIU A;  1S19 A;  2P1U A;  1YA3 A;  3A9E B;  4OJB A;  1NHZ A;  2QA8 A;  1YJE A;  4HEE X;  4TUZ B;  3VSP A;  3VT6 A;  5B5B A;  3ADW A;  1VJB A;  5G46 A;  4EM9 A;  4XLD A;  5B41 A;  3DZY A;  4XT9 A;  3RVF A;  1NYX A;  5GIE A;  5DWJ A;  2YLP A;  3IPU A;  5E0X A;  2V0V A;  3NOA A;  3OMM A;  5APK A;  3UUA B;  3ZR7 A;  2Q59 A;  3BC5 A;  3V9T A;  1XNX A;  4LNX A;  3CDP A;  4OEY A;  1FBY A;  5DMF A;  4OC7 A;  5DMC A;  5HZC A;  3GD2 A;  3CLD A;  4PVU A;  2XYJ A;  3HZF A;  5DSH A;  1ZKY A;  3WTQ A;  2VV4 B;  3VRU A;  3DCU A;  5GT4 A;  5KRC A;  4QL8 A;  1MV9 A;  3LBD A;  3B65 A;  1R5K A;  5IAW A;  3IA6 A;  3WT6 A;  4LSJ A;  3R8D A;  4REE A;  4J5W C;  4KZI A;  2J4A A;  3ZQT A;  2B1Z A;  5DXE A;  4WQP A;  5DXQ A;  3VT4 A;  3VT5 A;  5DTV A;  5DLR A;  5APJ A;  5KRF A;  5DKG A;  3FEI A;  4QE6 A;  5DRM A;  2NW4 A;  4OKX A;  5E14 A;  3U9Q A;  2QXM A;  1Z5X U;  4UDB A;  2OUZ A;  2VV0 A;  2AB2 A;  4N1Y A;  3FLI A;  2QZO A;  1OSH A;  4PWL A;  5DXK A;  3AFR A;  1YYE A;  2R6W A;  2ZFX A;  3OMQ A;  1OVL A;  4IA2 A;  4OED A;  2PRG A;  5I4V A;  2P54 A;  3VRV A;  2QNV A;  2YFE A;  5C4S A;  1OT7 A;  2JF9 A;  3CS8 A;  4FHH A;  4MGD A;  2AA2 A;  1E3K A;  4J5W A;  1ERR A;  1HG4 A;  3AN4 A;  3VTD A;  2HAS A;  1SKX A;  4PP3 A;  4OZT E;  1I7I A;  1MZN A;  4OKW A;  4ZO1 B;  5JJM B;  1T7T A;  4FGY A;  5DWG A;  2POG A;  2QSE A;  3A2J A;  5G43 A;  5DXB B;  4ONI A;  1T5Z A;  1BSX A;  1P8D A;  5HYK A;  5KRJ A;  3UVV B;  4OIL A;  4UDA A;  3MNE A;  3PRG A;  5KCT A;  4MG7 B;  4NIE A;  3V3E A;  2H77 A;  2O4J A;  2YAT A;  3DY6 A;  2AX9 A;  3G9E A;  4IUI A;  4RZG A;  3WFG A;  3V9Y A;  1KKQ A;  2GTK A;  2NXX A;  3KPZ A;  3Q95 A;  5DX3 A;  5EI1 A;  2VV1 A;  2ZK5 A;  4M8H A;  2P7Z A;  2J7X A;  3FC6 B;  5DZ3 A;  1FCY A;  2Z4B A;  4WVD A;  1NQ7 A;  3HVL A;  1T7M A;  4X1F A;  2O4R A;  3OSW A;  2ACL B;  2BAW A;  2P1V A;  4MDD A;  5DKS A;  5DP0 A;  5EHJ A;  2Z4J A;  3DR1 A;  1RDT A;  4XHD A;  5DWE A;  1YMT A;  2Q7J A;  4OEA A;  2PNU A;  1XPC A;  4POH A;  2QGT A;  5DZ1 A;  4ZO1 X;  5EIT A;  1XV9 B;  3P8X A;  4G2I A;  4ZNU A;  1XZX X;  3B0R A;  3A3Z X;  3OGT A;  2PKL A;  3VHU A;  5DYD A;  5DID A;  3OSA A;  1P93 A;  3A78 A;  4G1Y A;  5DXB A;  4ZNS A;  3FAL B;  3UVV A;  5DRJ A;  4PLE A;  2VV2 A;  4IU7 A;  4UDC A;  2ZK3 A;  3AUR A;  4IWC A;  3P89 A;  3ADU A;  2AX8 A;  4L98 A;  1YY4 A;  5DXR A;  3TKM A;  3SZ1 A;  3UUC A;  4DMA A;  2Q5P A;  3NSQ A;  3OSI A;  3GYT A;  4K7A A;  5AAV A;  4OAR A;  3P0U A;  2ZXM A;  2HCD A;  2Q7I A;  4ZNW A;  1RDT D;  2YLQ A;  4DK8 A;  2Q61 A;  2AX6 A;  2G5O A;  4ZNT A;  2ZK4 A;  1H9U A;  1QKM A;  3AUQ A;  3B0W A;  4IVY A;  3PBA A;  3VN2 A;  4DOR A;  1XV9 A;  3FXV A;  4IA1 A;  4OIV A;  4TV1 B;  5DV6 A;  2BJ4 A;  5KCU A;  4KZM A;  2PIR A;  4DM6 A;  1NAV A;  4WLB A;  3RLL A;  3FAL A;  1RKG A;  4MGB A;  3IXP A;  3K22 A;  2HAM A;  2ZNP A;  1XAP A;  3D90 A;  1UPV A;  2ZXN A;  3D57 A;  3GN8 A;  3W0A A;  3E00 D;  4XI3 A;  3VI8 A;  3A2I A;  3W5T A;  3OLS A;  2PIV A;  5KRH A;  3L0E A;  4PPS A;  1XOW A;  5DVV A;  1QKT A;  5L7G A;  3PCU A;  1K74 A;  4OJ4 A;  4RUJ A;  3W0G A;  2P1T A;  3ET3 A;  2ZL9 A;  3KMG A;  4JL4 A;  4OH6 A;  4OK1 A;  4R2U A;  3V9V A;  5KCE A;  4P6X A;  2QW4 A;  2ZK6 A;  3S9S A;  4ZN9 A;  1RKH A;  2ZK0 A;  5DV8 A;  4NUF A;  1X7B A;  5G3J A;  5L7H A;  3WMH A;  2Q1V A;  3ERT A;  2AA6 A;  4MG9 A;  4O8F A;  5DIG A;  2ZNQ A;  3K8S A;  3UUD A;  4TV1 A;  4CSJ A;  5GIC A;  1R1K D;  2QZO B;  1G2N A;  3D6D A;  3OMP A;  5EGV A;  4ZJR A;  3ET1 A;  5HJP A;  2ZNN A;  4RFW A;  4RAK A;  2AM9 A;  4YT1 A;  3HC5 A;  4DK7 A;  2J14 A;  1EXX A;  1GWQ A;  4OZR U;  1YIM A;  1OVL B;  2HBH A;  1YUC A;  3B0Q A;  4Q50 A;  3VJI A;  4XTA A;  2GL8 A;  1ZGY A;  3HLV A;  3JZC A;  4N8R A;  5DXM A;  5E7V A;  4MGD B;  1XQC A;  2ABI A;  1FM9 A;  4IQR A;  3AZ1 A;  3LMP A;  1N4H A;  3ERD A;  3PO9 A;  3AZ3 A;  1DB1 A;  1NQ1 A;  3GZ9 A;  3M7R A;  5EJV A;  3DZY D;  1M7W A;  3UU7 A;  4OLM A;  3VT9 A;  1RJK A;  1NQ2 A;  2XYX A;  4MGC A;  4S14 A;  5G45 A;  1Z95 A;  2PIN A;  2YHD A;  4WHG A;  2W8Y A;  4CI4 A;  2PIQ A;  5KCF A;  2QE4 A;  2XHS A;  5FQS A;  3IMY A;  3Q95 B;  5DX3 B;  2QMV A;  2JJ3 A;  1RK3 A;  2VV1 B;  3GWX A;  4LBD A;  5HCV A;  3OMO A;  3W0J A;  4OEZ A;  1X78 A;  1ZDU A;  2AA5 A;  3E7C A;  5KCW A;  3P88 A;  3VT3 A;  2GPP A;  4NY9 A;  5AYG A;  4RME A;  1LV2 A;  4E4K A;  2OM9 A;  3W0H A;  4E2J A;  5KCC A;  5JY3 A;  5HJS A;  1T65 A;  2VV3 A;  2AMA A;  4J24 A;  3FUG A;  1FCX A;  2ATH A;  1TFC A;  4R06 A;  4S0T A;  3AX8 A;  2I0J A;  5C4U A;  3ZRA A;  5DV3 A;  3KWY A;  1XLS A;  4WPF A;  4PP6 A;  1N46 A;  1N83 A;  4J26 A;  4OKB A;  4RZF A;  4G2H A;  1I38 A;  4G20 A;  3O1E A;  2O9I A;  5DUG A;  4UDD A;  1XP1 A;  1ILH A;  2QAB A;  2IHQ A;  1FCZ A;  3OOF A;  4Q13 A;  1YIN A;  5AAU A;  2PIX A;  2Q5S A;  1NUO A;  1L2I A;  4OJ9 A;  3OKH A;  4ZNH A;  1FD0 A;  3T03 A;  3CJW A;  2GPO A;  1T63 A;  4PPP A;  2AMB A;  3ILZ A;  1QKU A;  4HLW A;  3PLZ A;  5DVS A;  1M13 A;  2Q6S A;  4IA3 A;  1ZUC A;  4OKT A;  2HVC A;  2PIW A;  4WHF A;  5LWP A;  2R40 A;  5AAV B;  1XVP A;  2NV7 A;  3VTB A;  4OHA A;  4QJR A;  1ILG A;  1UHL A;  3A2H A;  2ZVT A;  4A4V A;  5E15 A;  3CS6 A;  3FUR A;  3R29 A;  4IV2 A;  3W0I A;  3SP9 A;  2H79 A;  5IZ0 A;  5KRI A;  2NXX E;  2QA6 A;  2IOK A;  1S9Q A;  1T79 A;  1R20 A;  1Y9R A;  3D5F A;  3OS8 C;  4J5X C;  4RZE A;  5DXP A;  1XDK A;  2I0G A;  1S9P A;  1X7J A;  1S0X A;  2BJ4 B;  2HC4 A;  1HJ1 A;  4MGA A;  4PP5 A;  3W0Y A;  1XP6 A;  2VST A;  4MG8 A;  5C4T A;  4MG6 A;  4MGB B;  1SR7 A;  4ITE A;  4G1D A;  2AO6 A;  3WJ4 A;  1PDU A;  3F5C A;  2OVH A;  3V49 A;  4IS8 A;  1Z5X E;  2AXA A;  3E94 A;  2ZXZ A;  3L0J A;  3OOK A;  5FQP A;  4ZJW A;  1ZEO A;  2ZMI A;  5DL4 A;  4XUM A;  3VTC A;  2OZ7 A;  4IA7 A;  4JAZ A;  2QPY A;  3SP6 A;  4A4W A;  1OSV A;  1GWR A;  2AX7 A;  5M96 A;  4EMA A;  5DZ0 A;  1XQ3 A;  3L3X A;  3OLF A;  2ZKC A;  3R5N A;  4OGH A;  1K7L A;  3CQV A;  4L96 A;  3B67 A;  1YOK A;  5DZI A;  4E4Q A;  1GS4 A;  4N73 A;  1DKF B;  2PIP L;  2V7C A;  5SYZ A;  3X31 A;  4M8E A;  1R20 D;  3G8I A;  2HWQ A;  1XJ7 A;  2GIU A;  4J5X A;  4MG9 B;  4PXM A;  5FQT A;  5K13 A;  1IE9 A;  4S15 A;  3UUD B;  2YJA B;  2ZK2 A;  5KYJ A;  2G0H A;  2I4J A;  2VSR A;  3HM1 A;  1UPW A;  4LTW A;  1E3G A;  1X76 A;  2ZMH A;  3GWS X;  3QT0 A;  4R6S A;  1U3Q A;  3X1I A;  4ZI1 A;  4DOS A;  1A52 A;  3KFC A;  3WGP A;  5HJP B;  5DK9 A;  1XNN A;  3IPQ A;  3B0T A;  4ZNV A;  5A86 A;  1WM0 X;  2Q7L A;  3PEQ A;  4OH5 A;  2Q6J A;  4RWV A;  3TY0 A;  2ZMJ A;  4N5G A;  4G1Z A;  2GPU A;  3L0L A;  1L2J A;  3F7D A;  5AZV A;  1T73 A;  3BEJ A;  3X1H A;  3UP0 A;  1IE8 A;  2HB7 A;  3V3Q A;  2HB8 A;  2Q7K A;  2QR9 A;  3WWR A;  1DKF A;  2G44 A;  3KDT A;  4FNE A;  4ITF A;  3H52 A;  3UU7 B;  2PIO A;  2P7A A;  3OMK A;  3TKC A;  2Q6R A;  3N00 A;  5G42 A;  1G50 A;  2POB A;  1FM6 A;  3OAP A;  4YMQ A;  2ZY0 A;  5DU5 A;  3L03 A;  3GBK A;  4PF3 A;  3RY9 A;  4RMD A;  1X7R A;  5DKB A;  3KBA A;  3HOD A;  3IXP D;  1LBD A;  4CI5 A;  5H1E A;  3DZU A;  2YLO A;  2HWR A;  5KRM A;  3VRW A;  2B1V A;  4Q0A C;  1Q4X A;  2AWH A;  5JI0 D;  4POJ A;  4OZT U;  3WT7 A;  2ZAS A;  2Q60 A;  2FVJ A;  5GID A;  4DM8 A;  1K74 D;  3ADV A;  3AZ2 A;  5G5W A;  5L11 A;  3O1D A;  4KZJ A;  4IWF A;  2OAX A;  4RE8 A;  4RMC A;  5E19 A;  5DUH A;  3K6P A;  1XB7 A;  2GPV A;  3KDU A;  5KCD A;  3OLL A;  3W0C A;  1TXI A;  1ZAF A;  5AVL A;  4OFR A;  5AWK A;  2REW A;  1FM6 D;  2YJD A;  5AWJ A;  1ZH7 A;  4B7W A;  3VT7 A;  3B68 A;  3NSP A;  5FQV A;  2QH6 A;  4IW6 A;  2XYW A;  3W5P A;  4X1G A;  2QTU A;  2ZK1 A;  4YPQ A;  1K4W A;  2I4Z A;  2YLY A;  4RUO X;  5ETH A;  1PK5 A;  1S0Z A;  3AUN A;  5E0W A;  3H0A A;  1T76 A;  2B50 A;  2A3I A;  5AVI A;  4NQA B;  3BQD A;  3B3K A; 
#chains in the Genus database with same CATH topology
 4XAO A;  3WFF A;  2AA7 A;  2HFP A;  3A9E A;  3DT3 A;  1XVP B;  1Y0X X;  1FM9 D;  1PQC A;  4TUZ A;  5E1C A;  5DVC A;  1NRL A;  1Y0S A;  3HO0 A;  3UP3 A;  1UHL B;  5DIE A;  5DWL A;  3RLJ A;  4NB6 A;  3VJH A;  4DQM A;  1I37 A;  4ZN7 A;  3FS1 A;  4RUP A;  3ZRB A;  3V4A A;  3VSO A;  2GP7 A;  1XDK B;  5KRL A;  3UUA A;  4MGA B;  4QK4 A;  2FAI A;  4MG8 B;  3DCT A;  2P4Y A;  3R8A A;  3KMR A;  1NAX A;  1PCG A;  3F5C B;  3WJ5 A;  4APU A;  3H0A D;  2VV4 A;  1EXA A;  1T7R A;  5ICK A;  2AYR A;  2ZLA A;  4QM0 A;  4JGV A;  3ADS A;  5FQR A;  1U9E A;  3X36 A;  2QGW A;  2ZNO A;  1XLS E;  2OCF A;  2Q8S A;  4IVW A;  2OVM A;  3B1M A;  3WT5 A;  5DXG A;  3W5Q A;  4OZR E;  3ET2 A;  3W5R A;  1MVC A;  3KYT A;  1U3R A;  5KYA A;  3VHW A;  2P7G A;  3GYU A;  1KV6 A;  1I7G A;  4PLD A;  5DI7 A;  4JYI A;  3HC6 A;  5DKE A;  3JZB A;  5G44 A;  2I4P A;  5KRO A;  1KNU A;  1T74 A;  5IXK A;  4P6W A;  2B23 A;  2QXS A;  4A2J A;  3MNP A;  1YOW A;  2E2R A;  3L3Z A;  4BCR A;  5ACC A;  2Q3Y A;  1A28 A;  3VRT A;  2R6Y A;  3K23 A;  4JYG A;  5AZT A;  2P15 A;  1UOM A;  2J7Y A;  3CDS A;  3CS4 A;  2F4B A;  3OKI A;  1SQN A;  2R40 D;  3D24 A;  4IW8 A;  4IV4 A;  5EC9 A;  2PIU A;  4FN9 A;  1XP9 A;  4FHI A;  3R8I A;  3VJS A;  1X7E A;  3OZ0 A;  1YP0 A;  5JJM A;  5DZH A;  1T7F A;  3RUU A;  3CTB A;  5DYB A;  3RUT A;  3HQ5 A;  1ERE A;  3OS8 A;  1U3S A;  3OS9 A;  4YNK A;  5L7E A;  1QKN A;  1R6G A;  3VT8 A;  4MG7 A;  5DY8 A;  2ZBS A;  2AAX A;  5CJ6 A;  3R5M A;  1SJ0 A;  3E00 A;  3A40 X;  2Q1H A;  3B5R A;  2JFA B;  2Q70 A;  3FC6 A;  3R2A A;  3KMZ A;  4OIU A;  3G8O A;  2FSZ A;  5DUE A;  2PJL A;  2ACL A;  4QE8 A;  3MNO A;  1G1U A;  2QA8 B;  1NQ0 A;  5LGA A;  5C4O A;  3VJT A;  4F9M A;  3ET0 A;  3L1B A;  5HYR A;  4ZOM A;  5KRK A;  5KRA A;  3DZU D;  2IOG A;  4K4J A;  3EYB A;  4LNW A;  3CWD A;  3G0W A;  5AK2 A;  2PIT A;  1PQ6 A;  3ADT A;  4XUH A;  1PRG A;  2EWP A;  4G21 A;  1R1K A;  2Q59 B;  3ADX A;  2LBD A;  3TX7 B;  2Q5G A;  1M2Z A;  4Y29 A;  1PQ9 A;  2G0G A;  5F9B A;  3VHV A;  1G5Y A;  2HAR A;  5KD9 A;  3FEJ A;  4PRG A;  2JFA A;  1NDE A;  1PZL A;  2GWX A;  5APH A;  3AN3 A;  1ZDT A;  4OFU A;  4S0S A;  4K6I A;  2XKW A;  2ZLC A;  5DWI A;  5KR9 A;  3OZJ A;  4JYH A;  4MG5 A;  3IPS A;  4REF A;  3B66 A;  2NPA A;  1GWX A;  1XIU A;  1S19 A;  2P1U A;  1YA3 A;  3A9E B;  4OJB A;  1NHZ A;  2QA8 A;  1YJE A;  4HEE X;  4TUZ B;  3VSP A;  3VT6 A;  5B5B A;  3ADW A;  1VJB A;  5G46 A;  4EM9 A;  4XLD A;  5B41 A;  3DZY A;  4XT9 A;  3RVF A;  1NYX A;  5GIE A;  5DWJ A;  2YLP A;  3IPU A;  5E0X A;  2V0V A;  3NOA A;  3OMM A;  5APK A;  3UUA B;  3ZR7 A;  2Q59 A;  3BC5 A;  3V9T A;  1XNX A;  4LNX A;  3CDP A;  4OEY A;  1FBY A;  5DMF A;  4OC7 A;  5DMC A;  5HZC A;  3GD2 A;  3CLD A;  4PVU A;  2XYJ A;  3HZF A;  5DSH A;  1ZKY A;  3WTQ A;  2VV4 B;  3VRU A;  3DCU A;  5GT4 A;  5KRC A;  4QL8 A;  1MV9 A;  3LBD A;  3B65 A;  1R5K A;  5IAW A;  3IA6 A;  3WT6 A;  4LSJ A;  3R8D A;  4REE A;  4J5W C;  4KZI A;  2J4A A;  3ZQT A;  2B1Z A;  5DXE A;  4WQP A;  5DXQ A;  3VT4 A;  3VT5 A;  5DTV A;  5DLR A;  5APJ A;  5KRF A;  5DKG A;  3FEI A;  4QE6 A;  5DRM A;  2NW4 A;  4OKX A;  5E14 A;  3U9Q A;  2QXM A;  1Z5X U;  4UDB A;  2OUZ A;  2VV0 A;  2AB2 A;  4N1Y A;  3FLI A;  2QZO A;  1OSH A;  4PWL A;  5DXK A;  3AFR A;  1YYE A;  2R6W A;  2ZFX A;  3OMQ A;  1OVL A;  4IA2 A;  4OED A;  2PRG A;  5I4V A;  2P54 A;  3VRV A;  2QNV A;  2YFE A;  5C4S A;  1OT7 A;  2JF9 A;  3CS8 A;  4FHH A;  4MGD A;  2AA2 A;  1E3K A;  4J5W A;  1ERR A;  1HG4 A;  3AN4 A;  3VTD A;  2HAS A;  1SKX A;  4PP3 A;  4OZT E;  1I7I A;  1MZN A;  4OKW A;  4ZO1 B;  5JJM B;  1T7T A;  4FGY A;  5DWG A;  2POG A;  2QSE A;  3A2J A;  5G43 A;  5DXB B;  4ONI A;  1T5Z A;  1BSX A;  1P8D A;  5HYK A;  5KRJ A;  3UVV B;  4OIL A;  4UDA A;  3MNE A;  3PRG A;  5KCT A;  4MG7 B;  4NIE A;  3V3E A;  2H77 A;  2O4J A;  2YAT A;  3DY6 A;  2AX9 A;  3G9E A;  4IUI A;  4RZG A;  3WFG A;  3V9Y A;  1KKQ A;  2GTK A;  2NXX A;  3KPZ A;  3Q95 A;  5DX3 A;  5EI1 A;  2VV1 A;  2ZK5 A;  4M8H A;  2P7Z A;  2J7X A;  3FC6 B;  5DZ3 A;  1FCY A;  2Z4B A;  4WVD A;  1NQ7 A;  3HVL A;  1T7M A;  4X1F A;  2O4R A;  3OSW A;  2ACL B;  2BAW A;  2P1V A;  4MDD A;  5DKS A;  5DP0 A;  5EHJ A;  2Z4J A;  3DR1 A;  1RDT A;  4XHD A;  5DWE A;  1YMT A;  2Q7J A;  4OEA A;  2PNU A;  1XPC A;  4POH A;  2QGT A;  5DZ1 A;  4ZO1 X;  5EIT A;  1XV9 B;  3P8X A;  4G2I A;  4ZNU A;  1XZX X;  3B0R A;  3A3Z X;  3OGT A;  2PKL A;  3VHU A;  5DYD A;  5DID A;  3OSA A;  1P93 A;  3A78 A;  4G1Y A;  5DXB A;  4ZNS A;  3FAL B;  3UVV A;  5DRJ A;  4PLE A;  2VV2 A;  4IU7 A;  4UDC A;  2ZK3 A;  3AUR A;  4IWC A;  3P89 A;  3ADU A;  2AX8 A;  4L98 A;  1YY4 A;  5DXR A;  3TKM A;  3SZ1 A;  3UUC A;  4DMA A;  2Q5P A;  3NSQ A;  3OSI A;  3GYT A;  4K7A A;  5AAV A;  4OAR A;  3P0U A;  2ZXM A;  2HCD A;  2Q7I A;  4ZNW A;  1RDT D;  2YLQ A;  4DK8 A;  2Q61 A;  2AX6 A;  2G5O A;  4ZNT A;  2ZK4 A;  1H9U A;  1QKM A;  3AUQ A;  3B0W A;  4IVY A;  3PBA A;  3VN2 A;  4DOR A;  1XV9 A;  3FXV A;  4IA1 A;  4OIV A;  4TV1 B;  5DV6 A;  2BJ4 A;  5KCU A;  4KZM A;  2PIR A;  4DM6 A;  1NAV A;  4WLB A;  3RLL A;  3FAL A;  1RKG A;  4MGB A;  3IXP A;  3K22 A;  2HAM A;  2ZNP A;  1XAP A;  3D90 A;  1UPV A;  2ZXN A;  3D57 A;  3GN8 A;  3W0A A;  3E00 D;  4XI3 A;  3VI8 A;  3A2I A;  3W5T A;  3OLS A;  2PIV A;  5KRH A;  3L0E A;  4PPS A;  1XOW A;  5DVV A;  1QKT A;  5L7G A;  3PCU A;  1K74 A;  4OJ4 A;  4RUJ A;  3W0G A;  2P1T A;  3ET3 A;  2ZL9 A;  3KMG A;  4JL4 A;  4OH6 A;  4OK1 A;  4R2U A;  3V9V A;  5KCE A;  4P6X A;  2QW4 A;  2ZK6 A;  3S9S A;  4ZN9 A;  1RKH A;  2ZK0 A;  5DV8 A;  4NUF A;  1X7B A;  5G3J A;  5L7H A;  3WMH A;  2Q1V A;  3ERT A;  2AA6 A;  4MG9 A;  4O8F A;  5DIG A;  2ZNQ A;  3K8S A;  3UUD A;  4TV1 A;  4CSJ A;  5GIC A;  1R1K D;  2QZO B;  1G2N A;  3D6D A;  3OMP A;  5EGV A;  4ZJR A;  3ET1 A;  5HJP A;  2ZNN A;  4RFW A;  4RAK A;  2AM9 A;  4YT1 A;  3HC5 A;  4DK7 A;  2J14 A;  1EXX A;  1GWQ A;  4OZR U;  1YIM A;  1OVL B;  2HBH A;  1YUC A;  3B0Q A;  4Q50 A;  3VJI A;  4XTA A;  2GL8 A;  1ZGY A;  3HLV A;  3JZC A;  4N8R A;  5DXM A;  5E7V A;  4MGD B;  1XQC A;  2ABI A;  1FM9 A;  4IQR A;  3AZ1 A;  3LMP A;  1N4H A;  3ERD A;  3PO9 A;  3AZ3 A;  1DB1 A;  1NQ1 A;  3GZ9 A;  3M7R A;  5EJV A;  3DZY D;  1M7W A;  3UU7 A;  4OLM A;  3VT9 A;  1RJK A;  1NQ2 A;  2XYX A;  4MGC A;  4S14 A;  5G45 A;  1Z95 A;  2PIN A;  2YHD A;  4WHG A;  2W8Y A;  4CI4 A;  2PIQ A;  5KCF A;  2QE4 A;  2XHS A;  5FQS A;  3IMY A;  3Q95 B;  5DX3 B;  2QMV A;  2JJ3 A;  1RK3 A;  2VV1 B;  3GWX A;  4LBD A;  5HCV A;  3OMO A;  3W0J A;  4OEZ A;  1X78 A;  1ZDU A;  2AA5 A;  3E7C A;  5KCW A;  3P88 A;  3VT3 A;  2GPP A;  4NY9 A;  5AYG A;  4RME A;  1LV2 A;  4E4K A;  2OM9 A;  3W0H A;  4E2J A;  5KCC A;  5JY3 A;  5HJS A;  1T65 A;  2VV3 A;  2AMA A;  4J24 A;  3FUG A;  1FCX A;  2ATH A;  1TFC A;  4R06 A;  4S0T A;  3AX8 A;  2I0J A;  5C4U A;  3ZRA A;  5DV3 A;  3KWY A;  1XLS A;  4WPF A;  4PP6 A;  1N46 A;  1N83 A;  4J26 A;  4OKB A;  4RZF A;  4G2H A;  1I38 A;  4G20 A;  3O1E A;  2O9I A;  5DUG A;  4UDD A;  1XP1 A;  1ILH A;  2QAB A;  2IHQ A;  1FCZ A;  3OOF A;  4Q13 A;  1YIN A;  5AAU A;  2PIX A;  2Q5S A;  1NUO A;  1L2I A;  4OJ9 A;  3OKH A;  4ZNH A;  1FD0 A;  3T03 A;  3CJW A;  2GPO A;  1T63 A;  4PPP A;  2AMB A;  3ILZ A;  1QKU A;  4HLW A;  3PLZ A;  5DVS A;  1M13 A;  2Q6S A;  4IA3 A;  1ZUC A;  4OKT A;  2HVC A;  2PIW A;  4WHF A;  5LWP A;  2R40 A;  5AAV B;  1XVP A;  2NV7 A;  3VTB A;  4OHA A;  4QJR A;  1ILG A;  1UHL A;  3A2H A;  2ZVT A;  4A4V A;  5E15 A;  3CS6 A;  3FUR A;  3R29 A;  4IV2 A;  3W0I A;  3SP9 A;  2H79 A;  5IZ0 A;  5KRI A;  2NXX E;  2QA6 A;  2IOK A;  1S9Q A;  1T79 A;  1R20 A;  1Y9R A;  3D5F A;  3OS8 C;  4J5X C;  4RZE A;  5DXP A;  1XDK A;  2I0G A;  1S9P A;  1X7J A;  1S0X A;  2BJ4 B;  2HC4 A;  1HJ1 A;  4MGA A;  4PP5 A;  3W0Y A;  1XP6 A;  2VST A;  4MG8 A;  5C4T A;  4MG6 A;  4MGB B;  1SR7 A;  4ITE A;  4G1D A;  2AO6 A;  3WJ4 A;  1PDU A;  3F5C A;  2OVH A;  3V49 A;  4IS8 A;  1Z5X E;  2AXA A;  3E94 A;  2ZXZ A;  3L0J A;  3OOK A;  5FQP A;  4ZJW A;  1ZEO A;  2ZMI A;  5DL4 A;  4XUM A;  3VTC A;  2OZ7 A;  4IA7 A;  4JAZ A;  2QPY A;  3SP6 A;  4A4W A;  1OSV A;  1GWR A;  2AX7 A;  5M96 A;  4EMA A;  5DZ0 A;  1XQ3 A;  3L3X A;  3OLF A;  2ZKC A;  3R5N A;  4OGH A;  1K7L A;  3CQV A;  4L96 A;  3B67 A;  1YOK A;  5DZI A;  4E4Q A;  1GS4 A;  4N73 A;  1DKF B;  2PIP L;  2V7C A;  5SYZ A;  3X31 A;  4M8E A;  1R20 D;  3G8I A;  2HWQ A;  1XJ7 A;  2GIU A;  4J5X A;  4MG9 B;  4PXM A;  5FQT A;  5K13 A;  1IE9 A;  4S15 A;  3UUD B;  2YJA B;  2ZK2 A;  5KYJ A;  2G0H A;  2I4J A;  2VSR A;  3HM1 A;  1UPW A;  4LTW A;  1E3G A;  1X76 A;  2ZMH A;  3GWS X;  3QT0 A;  4R6S A;  1U3Q A;  3X1I A;  4ZI1 A;  4DOS A;  1A52 A;  3KFC A;  3WGP A;  5HJP B;  5DK9 A;  1XNN A;  3IPQ A;  3B0T A;  4ZNV A;  5A86 A;  1WM0 X;  2Q7L A;  3PEQ A;  4OH5 A;  2Q6J A;  4RWV A;  3TY0 A;  2ZMJ A;  4N5G A;  4G1Z A;  2GPU A;  3L0L A;  1L2J A;  3F7D A;  5AZV A;  1T73 A;  3BEJ A;  3X1H A;  3UP0 A;  1IE8 A;  2HB7 A;  3V3Q A;  2HB8 A;  2Q7K A;  2QR9 A;  3WWR A;  1DKF A;  2G44 A;  3KDT A;  4FNE A;  4ITF A;  3H52 A;  3UU7 B;  2PIO A;  2P7A A;  3OMK A;  3TKC A;  2Q6R A;  3N00 A;  5G42 A;  1G50 A;  2POB A;  1FM6 A;  3OAP A;  4YMQ A;  2ZY0 A;  5DU5 A;  3L03 A;  3GBK A;  4PF3 A;  3RY9 A;  4RMD A;  1X7R A;  5DKB A;  3KBA A;  3HOD A;  3IXP D;  1LBD A;  4CI5 A;  5H1E A;  3DZU A;  2YLO A;  2HWR A;  5KRM A;  3VRW A;  2B1V A;  4Q0A C;  1Q4X A;  2AWH A;  5JI0 D;  4POJ A;  4OZT U;  3WT7 A;  2ZAS A;  2Q60 A;  2FVJ A;  5GID A;  4DM8 A;  1K74 D;  3ADV A;  3AZ2 A;  5G5W A;  5L11 A;  3O1D A;  4KZJ A;  4IWF A;  2OAX A;  4RE8 A;  4RMC A;  5E19 A;  5DUH A;  3K6P A;  1XB7 A;  2GPV A;  3KDU A;  5KCD A;  3OLL A;  3W0C A;  1TXI A;  1ZAF A;  5AVL A;  4OFR A;  5AWK A;  2REW A;  1FM6 D;  2YJD A;  5AWJ A;  1ZH7 A;  4B7W A;  3VT7 A;  3B68 A;  3NSP A;  5FQV A;  2QH6 A;  4IW6 A;  2XYW A;  3W5P A;  4X1G A;  2QTU A;  2ZK1 A;  4YPQ A;  1K4W A;  2I4Z A;  2YLY A;  4RUO X;  5ETH A;  1PK5 A;  1S0Z A;  3AUN A;  5E0W A;  3H0A A;  1T76 A;  2B50 A;  2A3I A;  5AVI A;  4NQA B;  3BQD A;  3B3K A; 
#chains in the Genus database with same CATH homology
 4XAO A;  3WFF A;  2AA7 A;  2HFP A;  3A9E A;  3DT3 A;  1XVP B;  1Y0X X;  1FM9 D;  1PQC A;  4TUZ A;  5E1C A;  5DVC A;  1NRL A;  1Y0S A;  3HO0 A;  3UP3 A;  1UHL B;  5DIE A;  5DWL A;  3RLJ A;  4NB6 A;  3VJH A;  4DQM A;  1I37 A;  4ZN7 A;  3FS1 A;  4RUP A;  3ZRB A;  3V4A A;  3VSO A;  2GP7 A;  1XDK B;  5KRL A;  3UUA A;  4MGA B;  4QK4 A;  2FAI A;  4MG8 B;  3DCT A;  2P4Y A;  3R8A A;  3KMR A;  1NAX A;  1PCG A;  3F5C B;  3WJ5 A;  4APU A;  3H0A D;  2VV4 A;  1EXA A;  1T7R A;  5ICK A;  2AYR A;  2ZLA A;  4QM0 A;  4JGV A;  3ADS A;  5FQR A;  1U9E A;  3X36 A;  2QGW A;  2ZNO A;  1XLS E;  2OCF A;  2Q8S A;  4IVW A;  2OVM A;  3B1M A;  3WT5 A;  5DXG A;  3W5Q A;  4OZR E;  3ET2 A;  3W5R A;  1MVC A;  3KYT A;  1U3R A;  5KYA A;  3VHW A;  2P7G A;  3GYU A;  1KV6 A;  1I7G A;  4PLD A;  5DI7 A;  4JYI A;  3HC6 A;  5DKE A;  3JZB A;  5G44 A;  2I4P A;  5KRO A;  1KNU A;  1T74 A;  5IXK A;  4P6W A;  2B23 A;  2QXS A;  4A2J A;  3MNP A;  1YOW A;  2E2R A;  3L3Z A;  4BCR A;  5ACC A;  2Q3Y A;  1A28 A;  3VRT A;  2R6Y A;  3K23 A;  4JYG A;  5AZT A;  2P15 A;  1UOM A;  2J7Y A;  3CDS A;  3CS4 A;  2F4B A;  3OKI A;  1SQN A;  2R40 D;  3D24 A;  4IW8 A;  4IV4 A;  5EC9 A;  2PIU A;  4FN9 A;  1XP9 A;  4FHI A;  3R8I A;  3VJS A;  1X7E A;  3OZ0 A;  1YP0 A;  5JJM A;  5DZH A;  1T7F A;  3RUU A;  3CTB A;  5DYB A;  3RUT A;  3HQ5 A;  1ERE A;  3OS8 A;  1U3S A;  3OS9 A;  4YNK A;  5L7E A;  1QKN A;  1R6G A;  3VT8 A;  4MG7 A;  5DY8 A;  2ZBS A;  2AAX A;  5CJ6 A;  3R5M A;  1SJ0 A;  3E00 A;  3A40 X;  2Q1H A;  3B5R A;  2JFA B;  2Q70 A;  3FC6 A;  3R2A A;  3KMZ A;  4OIU A;  3G8O A;  2FSZ A;  5DUE A;  2PJL A;  2ACL A;  4QE8 A;  3MNO A;  1G1U A;  2QA8 B;  1NQ0 A;  5LGA A;  5C4O A;  3VJT A;  4F9M A;  3ET0 A;  3L1B A;  5HYR A;  4ZOM A;  5KRK A;  5KRA A;  3DZU D;  2IOG A;  4K4J A;  3EYB A;  4LNW A;  3CWD A;  3G0W A;  5AK2 A;  2PIT A;  1PQ6 A;  3ADT A;  4XUH A;  1PRG A;  2EWP A;  4G21 A;  1R1K A;  2Q59 B;  3ADX A;  2LBD A;  3TX7 B;  2Q5G A;  1M2Z A;  4Y29 A;  1PQ9 A;  2G0G A;  5F9B A;  3VHV A;  1G5Y A;  2HAR A;  5KD9 A;  3FEJ A;  4PRG A;  2JFA A;  1NDE A;  1PZL A;  2GWX A;  5APH A;  3AN3 A;  1ZDT A;  4OFU A;  4S0S A;  4K6I A;  2XKW A;  2ZLC A;  5DWI A;  5KR9 A;  3OZJ A;  4JYH A;  4MG5 A;  3IPS A;  4REF A;  3B66 A;  2NPA A;  1GWX A;  1XIU A;  1S19 A;  2P1U A;  1YA3 A;  3A9E B;  4OJB A;  1NHZ A;  2QA8 A;  1YJE A;  4HEE X;  4TUZ B;  3VSP A;  3VT6 A;  5B5B A;  3ADW A;  1VJB A;  5G46 A;  4EM9 A;  4XLD A;  5B41 A;  3DZY A;  4XT9 A;  3RVF A;  1NYX A;  5GIE A;  5DWJ A;  2YLP A;  3IPU A;  5E0X A;  2V0V A;  3NOA A;  3OMM A;  5APK A;  3UUA B;  3ZR7 A;  2Q59 A;  3BC5 A;  3V9T A;  1XNX A;  4LNX A;  3CDP A;  4OEY A;  1FBY A;  5DMF A;  4OC7 A;  5DMC A;  5HZC A;  3GD2 A;  3CLD A;  4PVU A;  2XYJ A;  3HZF A;  5DSH A;  1ZKY A;  3WTQ A;  2VV4 B;  3VRU A;  3DCU A;  5GT4 A;  5KRC A;  4QL8 A;  1MV9 A;  3LBD A;  3B65 A;  1R5K A;  5IAW A;  3IA6 A;  3WT6 A;  4LSJ A;  3R8D A;  4REE A;  4J5W C;  4KZI A;  2J4A A;  3ZQT A;  2B1Z A;  5DXE A;  4WQP A;  5DXQ A;  3VT4 A;  3VT5 A;  5DTV A;  5DLR A;  5APJ A;  5KRF A;  5DKG A;  3FEI A;  4QE6 A;  5DRM A;  2NW4 A;  4OKX A;  5E14 A;  3U9Q A;  2QXM A;  1Z5X U;  4UDB A;  2OUZ A;  2VV0 A;  2AB2 A;  4N1Y A;  3FLI A;  2QZO A;  1OSH A;  4PWL A;  5DXK A;  3AFR A;  1YYE A;  2R6W A;  2ZFX A;  3OMQ A;  1OVL A;  4IA2 A;  4OED A;  2PRG A;  5I4V A;  2P54 A;  3VRV A;  2QNV A;  2YFE A;  5C4S A;  1OT7 A;  2JF9 A;  3CS8 A;  4FHH A;  4MGD A;  2AA2 A;  1E3K A;  4J5W A;  1ERR A;  1HG4 A;  3AN4 A;  3VTD A;  2HAS A;  1SKX A;  4PP3 A;  4OZT E;  1I7I A;  1MZN A;  4OKW A;  4ZO1 B;  5JJM B;  1T7T A;  4FGY A;  5DWG A;  2POG A;  2QSE A;  3A2J A;  5G43 A;  5DXB B;  4ONI A;  1T5Z A;  1BSX A;  1P8D A;  5HYK A;  5KRJ A;  3UVV B;  4OIL A;  4UDA A;  3MNE A;  3PRG A;  5KCT A;  4MG7 B;  4NIE A;  3V3E A;  2H77 A;  2O4J A;  2YAT A;  3DY6 A;  2AX9 A;  3G9E A;  4IUI A;  4RZG A;  3WFG A;  3V9Y A;  1KKQ A;  2GTK A;  2NXX A;  3KPZ A;  3Q95 A;  5DX3 A;  5EI1 A;  2VV1 A;  2ZK5 A;  4M8H A;  2P7Z A;  2J7X A;  3FC6 B;  5DZ3 A;  1FCY A;  2Z4B A;  4WVD A;  1NQ7 A;  3HVL A;  1T7M A;  4X1F A;  2O4R A;  3OSW A;  2ACL B;  2BAW A;  2P1V A;  4MDD A;  5DKS A;  5DP0 A;  5EHJ A;  2Z4J A;  3DR1 A;  1RDT A;  4XHD A;  5DWE A;  1YMT A;  2Q7J A;  4OEA A;  2PNU A;  1XPC A;  4POH A;  2QGT A;  5DZ1 A;  4ZO1 X;  5EIT A;  1XV9 B;  3P8X A;  4G2I A;  4ZNU A;  1XZX X;  3B0R A;  3A3Z X;  3OGT A;  2PKL A;  3VHU A;  5DYD A;  5DID A;  3OSA A;  1P93 A;  3A78 A;  4G1Y A;  5DXB A;  4ZNS A;  3FAL B;  3UVV A;  5DRJ A;  4PLE A;  2VV2 A;  4IU7 A;  4UDC A;  2ZK3 A;  3AUR A;  4IWC A;  3P89 A;  3ADU A;  2AX8 A;  4L98 A;  1YY4 A;  5DXR A;  3TKM A;  3SZ1 A;  3UUC A;  4DMA A;  2Q5P A;  3NSQ A;  3OSI A;  3GYT A;  4K7A A;  5AAV A;  4OAR A;  3P0U A;  2ZXM A;  2HCD A;  2Q7I A;  4ZNW A;  1RDT D;  2YLQ A;  4DK8 A;  2Q61 A;  2AX6 A;  2G5O A;  4ZNT A;  2ZK4 A;  1H9U A;  1QKM A;  3AUQ A;  3B0W A;  4IVY A;  3PBA A;  3VN2 A;  4DOR A;  1XV9 A;  3FXV A;  4IA1 A;  4OIV A;  4TV1 B;  5DV6 A;  2BJ4 A;  5KCU A;  4KZM A;  2PIR A;  4DM6 A;  1NAV A;  4WLB A;  3RLL A;  3FAL A;  1RKG A;  4MGB A;  3IXP A;  3K22 A;  2HAM A;  2ZNP A;  1XAP A;  3D90 A;  1UPV A;  2ZXN A;  3D57 A;  3GN8 A;  3W0A A;  3E00 D;  4XI3 A;  3VI8 A;  3A2I A;  3W5T A;  3OLS A;  2PIV A;  5KRH A;  3L0E A;  4PPS A;  1XOW A;  5DVV A;  1QKT A;  5L7G A;  3PCU A;  1K74 A;  4OJ4 A;  4RUJ A;  3W0G A;  2P1T A;  3ET3 A;  2ZL9 A;  3KMG A;  4JL4 A;  4OH6 A;  4OK1 A;  4R2U A;  3V9V A;  5KCE A;  4P6X A;  2QW4 A;  2ZK6 A;  3S9S A;  4ZN9 A;  1RKH A;  2ZK0 A;  5DV8 A;  4NUF A;  1X7B A;  5G3J A;  5L7H A;  3WMH A;  2Q1V A;  3ERT A;  2AA6 A;  4MG9 A;  4O8F A;  5DIG A;  2ZNQ A;  3K8S A;  3UUD A;  4TV1 A;  4CSJ A;  5GIC A;  1R1K D;  2QZO B;  1G2N A;  3D6D A;  3OMP A;  5EGV A;  4ZJR A;  3ET1 A;  5HJP A;  2ZNN A;  4RFW A;  4RAK A;  2AM9 A;  4YT1 A;  3HC5 A;  4DK7 A;  2J14 A;  1EXX A;  1GWQ A;  4OZR U;  1YIM A;  1OVL B;  2HBH A;  1YUC A;  3B0Q A;  4Q50 A;  3VJI A;  4XTA A;  2GL8 A;  1ZGY A;  3HLV A;  3JZC A;  4N8R A;  5DXM A;  5E7V A;  4MGD B;  1XQC A;  2ABI A;  1FM9 A;  4IQR A;  3AZ1 A;  3LMP A;  1N4H A;  3ERD A;  3PO9 A;  3AZ3 A;  1DB1 A;  1NQ1 A;  3GZ9 A;  3M7R A;  5EJV A;  3DZY D;  1M7W A;  3UU7 A;  4OLM A;  3VT9 A;  1RJK A;  1NQ2 A;  2XYX A;  4MGC A;  4S14 A;  5G45 A;  1Z95 A;  2PIN A;  2YHD A;  4WHG A;  2W8Y A;  4CI4 A;  2PIQ A;  5KCF A;  2QE4 A;  2XHS A;  5FQS A;  3IMY A;  3Q95 B;  5DX3 B;  2QMV A;  2JJ3 A;  1RK3 A;  2VV1 B;  3GWX A;  4LBD A;  5HCV A;  3OMO A;  3W0J A;  4OEZ A;  1X78 A;  1ZDU A;  2AA5 A;  3E7C A;  5KCW A;  3P88 A;  3VT3 A;  2GPP A;  4NY9 A;  5AYG A;  4RME A;  1LV2 A;  4E4K A;  2OM9 A;  3W0H A;  4E2J A;  5KCC A;  5JY3 A;  5HJS A;  1T65 A;  2VV3 A;  2AMA A;  4J24 A;  3FUG A;  1FCX A;  2ATH A;  1TFC A;  4R06 A;  4S0T A;  3AX8 A;  2I0J A;  5C4U A;  3ZRA A;  5DV3 A;  3KWY A;  1XLS A;  4WPF A;  4PP6 A;  1N46 A;  1N83 A;  4J26 A;  4OKB A;  4RZF A;  4G2H A;  1I38 A;  4G20 A;  3O1E A;  2O9I A;  5DUG A;  4UDD A;  1XP1 A;  1ILH A;  2QAB A;  2IHQ A;  1FCZ A;  3OOF A;  4Q13 A;  1YIN A;  5AAU A;  2PIX A;  2Q5S A;  1NUO A;  1L2I A;  4OJ9 A;  3OKH A;  4ZNH A;  1FD0 A;  3T03 A;  3CJW A;  2GPO A;  1T63 A;  4PPP A;  2AMB A;  3ILZ A;  1QKU A;  4HLW A;  3PLZ A;  5DVS A;  1M13 A;  2Q6S A;  4IA3 A;  1ZUC A;  4OKT A;  2HVC A;  2PIW A;  4WHF A;  5LWP A;  2R40 A;  5AAV B;  1XVP A;  2NV7 A;  3VTB A;  4OHA A;  4QJR A;  1ILG A;  1UHL A;  3A2H A;  2ZVT A;  4A4V A;  5E15 A;  3CS6 A;  3FUR A;  3R29 A;  4IV2 A;  3W0I A;  3SP9 A;  2H79 A;  5IZ0 A;  5KRI A;  2NXX E;  2QA6 A;  2IOK A;  1S9Q A;  1T79 A;  1R20 A;  1Y9R A;  3D5F A;  3OS8 C;  4J5X C;  4RZE A;  5DXP A;  1XDK A;  2I0G A;  1S9P A;  1X7J A;  1S0X A;  2BJ4 B;  2HC4 A;  1HJ1 A;  4MGA A;  4PP5 A;  3W0Y A;  1XP6 A;  2VST A;  4MG8 A;  5C4T A;  4MG6 A;  4MGB B;  1SR7 A;  4ITE A;  4G1D A;  2AO6 A;  3WJ4 A;  1PDU A;  3F5C A;  2OVH A;  3V49 A;  4IS8 A;  1Z5X E;  2AXA A;  3E94 A;  2ZXZ A;  3L0J A;  3OOK A;  5FQP A;  4ZJW A;  1ZEO A;  2ZMI A;  5DL4 A;  4XUM A;  3VTC A;  2OZ7 A;  4IA7 A;  4JAZ A;  2QPY A;  3SP6 A;  4A4W A;  1OSV A;  1GWR A;  2AX7 A;  5M96 A;  4EMA A;  5DZ0 A;  1XQ3 A;  3L3X A;  3OLF A;  2ZKC A;  3R5N A;  4OGH A;  1K7L A;  3CQV A;  4L96 A;  3B67 A;  1YOK A;  5DZI A;  4E4Q A;  1GS4 A;  4N73 A;  1DKF B;  2PIP L;  2V7C A;  5SYZ A;  3X31 A;  4M8E A;  1R20 D;  3G8I A;  2HWQ A;  1XJ7 A;  2GIU A;  4J5X A;  4MG9 B;  4PXM A;  5FQT A;  5K13 A;  1IE9 A;  4S15 A;  3UUD B;  2YJA B;  2ZK2 A;  5KYJ A;  2G0H A;  2I4J A;  2VSR A;  3HM1 A;  1UPW A;  4LTW A;  1E3G A;  1X76 A;  2ZMH A;  3GWS X;  3QT0 A;  4R6S A;  1U3Q A;  3X1I A;  4ZI1 A;  4DOS A;  1A52 A;  3KFC A;  3WGP A;  5HJP B;  5DK9 A;  1XNN A;  3IPQ A;  3B0T A;  4ZNV A;  5A86 A;  1WM0 X;  2Q7L A;  3PEQ A;  4OH5 A;  2Q6J A;  4RWV A;  3TY0 A;  2ZMJ A;  4N5G A;  4G1Z A;  2GPU A;  3L0L A;  1L2J A;  3F7D A;  5AZV A;  1T73 A;  3BEJ A;  3X1H A;  3UP0 A;  1IE8 A;  2HB7 A;  3V3Q A;  2HB8 A;  2Q7K A;  2QR9 A;  3WWR A;  1DKF A;  2G44 A;  3KDT A;  4FNE A;  4ITF A;  3H52 A;  3UU7 B;  2PIO A;  2P7A A;  3OMK A;  3TKC A;  2Q6R A;  3N00 A;  5G42 A;  1G50 A;  2POB A;  1FM6 A;  3OAP A;  4YMQ A;  2ZY0 A;  5DU5 A;  3L03 A;  3GBK A;  4PF3 A;  3RY9 A;  4RMD A;  1X7R A;  5DKB A;  3KBA A;  3HOD A;  3IXP D;  1LBD A;  4CI5 A;  5H1E A;  3DZU A;  2YLO A;  2HWR A;  5KRM A;  3VRW A;  2B1V A;  4Q0A C;  1Q4X A;  2AWH A;  5JI0 D;  4POJ A;  4OZT U;  3WT7 A;  2ZAS A;  2Q60 A;  2FVJ A;  5GID A;  4DM8 A;  1K74 D;  3ADV A;  3AZ2 A;  5G5W A;  5L11 A;  3O1D A;  4KZJ A;  4IWF A;  2OAX A;  4RE8 A;  4RMC A;  5E19 A;  5DUH A;  3K6P A;  1XB7 A;  2GPV A;  3KDU A;  5KCD A;  3OLL A;  3W0C A;  1TXI A;  1ZAF A;  5AVL A;  4OFR A;  5AWK A;  2REW A;  1FM6 D;  2YJD A;  5AWJ A;  1ZH7 A;  4B7W A;  3VT7 A;  3B68 A;  3NSP A;  5FQV A;  2QH6 A;  4IW6 A;  2XYW A;  3W5P A;  4X1G A;  2QTU A;  2ZK1 A;  4YPQ A;  1K4W A;  2I4Z A;  2YLY A;  4RUO X;  5ETH A;  1PK5 A;  1S0Z A;  3AUN A;  5E0W A;  3H0A A;  1T76 A;  2B50 A;  2A3I A;  5AVI A;  4NQA B;  3BQD A;  3B3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...