2B1VA

Human estrogen receptor alpha ligand-binding domain in complex with obcp-1m and a glucocorticoid receptor interacting protein 1 nr box ii peptide
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
244
structure length
233
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLEAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of ligands with bicyclic scaffolds provides insights into mechanisms of estrogen receptor subtype selectivity.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Hormone/growth factor receptor
source organism Homo sapiens
total genus 88
structure length 233
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2b1vA00
2Q3YA 3MNEA 1YA3A 3FEIA 2G5OA 3WT6A 5HJPA 1XP6A 3N00A 5AAUA 3LMPA 3W5TA 1S19A 4JGVA 2J14A 2REWA 2J4AA 5DXKA 3VI8A 1XB7A 2GWXA 4OZRE 5KROA 1XOWA 3E7CA 1PDUA 5DU5A 4K4JA 4REFA 3ADSA 5DWGA 4YPQA 1ERRA 3DZUD 1U9EA 3MNPA 1YY4A 4POJA 2YJAB 4G1DA 3FEJA 5GIEA 2QZOA 5L7HA 2ACLB 5G45A 2VV4B 3B0RA 5APKA 1I7IA 4EM9A 2Q5GA 5KRIA 2Q1VA 3FALA 3OMMA 3FC6B 1K74D 1KV6A 1YJEA 4OH6A 3JZCA 4OILA 4OZRU 4MGAA 2PIXA 4QL8A 3VHWA 3M7RA 3WT5A 4RMDA 1MZNA 3G9EA 4R6SA 3B67A 1T74A 3GWXA 4N73A 3HC6A 2Q61A 3CS4A 2QA6A 2P1UA 4WLBA 1NQ7A 5DTVA 3OAPA 5JJMA 3CLDA 3DZYD 3KDTA 3UP3A 2ZNNA 2ZK1A 3VT3A 4XTAA 1ZH7A 2ZVTA 3TY0A 4OKWA 4PVUA 4XAOA 4ONIA 2XHSA 4OHAA 3E00A 4JAZA 3IXPA 1XNXA 5DLRA 4M8HA 2Q6JA 5FQSA 3V9YA 4E4KA 1XQCA 1SJ0A 3NSPA 1PZLA 4ZNSA 5EI1A 4RE8A 2QXMA 5FQRA 1G50A 3GBKA 3AN4A 3HM1A 3UVVA 3SP6A 3F7DA 1ZAFA 2Z4JA 3HVLA 3OOKA 2VSRA 2JFAA 2VV0A 1NRLA 2OUZA 3HQ5A 4PP3A 4YNKA 4RZGA 3A3ZX 3GYUA 3VHVA 1DB1A 4YMQA 4QJRA 3A9EA 5DXMA 1Q4XA 2ATHA 3ZQTA 3R8AA 2PNUA 1N46A 4PXMA 1ZUCA 2PJLA 3WJ4A 3TKMA 5DXGA 5DIDA 4S14A 1RK3A 4DMAA 3L0JA 3VJHA 4ZJRA 3EYBA 3P0UA 3H52A 3OMPA 2PIQA 4MG9B 3TKCA 2QABA 3ZRBA 2R6YA 2AA5A 4FN9A 4MG7A 1T7FA 1XP9A 4L98A 4DORA 2P4YA 2QXSA 5DXBB 2AO6A 2FVJA 5G46A 2VV1A 2HARA 2YLOA 2P54A 5DVVA 5ICKA 4ZNUA 1S0ZA 1YOKA 5LWPA 4RZEA 5KRJA 2I4JA 4MGBA 2AX6A 4UDCA 1K4WA 2P1VA 4PRGA 4QM0A 2XKWA 3WFGA 5I4VA 2OZ7A 3IPSA 4XHDA 5DSHA 5JI0D 2LBDA 5DKSA 2QR9A 3OS8A 3V3EA 2ZASA 3VT6A 1GWQA 4OIUA 5DIEA 4S15A 1XAPA 2I4ZA 2H79A 2POBA 4MGDA 5KYJA 1R20D 3IA6A 5DZHA 3UP0A 1H9UA 2GIUA 1FBYA 3IMYA 5DUHA 3OLSA 3E94A 2ZMIA 3AFRA 4J26A 4MG8B 3DCTA 3A2JA 4IVYA 2VV2A 2QA8A 1TXIA 3A2HA 3KFCA 5DYDA 2J7XA 2QGWA 4M8EA 3RUTA 3V9TA 4YT1A 4ZN7A 1QKNA 4K7AA 2AMAA 1T76A 4EMAA 3VRVA 4ZO1X 2ZK5A 4OFUA 5KCWA 2PKLA 4OIVA 4IWCA 2Q59B 3OMOA 3R29A 4IA1A 4CI4A 2GP7A 2PIPL 3PEQA 3UU7A 1S9QA 3W0IA 1XLSA 4KZIA 3ZRAA 4CSJA 1MVCA 2YLYA 5KRFA 2ZY0A 5DX3B 5EHJA 3W0JA 2Q1HA 4N5GA 4OZTE 3VRWA 1UPVA 2YLPA 5AK2A 1KKQA 2BJ4B 1XP1A 2IHQA 2POGA 2Q70A 1QKMA 2OM9A 2XYXA 2ZMHA 3AUNA 4J24A 4LTWA 4PLDA 3RY9A 3OOFA 3PBAA 3W0CA 5KD9A 4ZNWA 5A86A 1UHLB 1XJ7A 2JF9A 2G0HA 3GN8A 1NQ0A 3DY6A 1NHZA 4OKXA 5DXEA 3ET1A 5DV8A 3F5CA 5DY8A 4A2JA 3FURA 1R1KD 3IPQA 3UUCA 2R40A 3PCUA 4UDBA 3HO0A 4OZTU 2ZLAA 5DL4A 3SZ1A 1PQCA 4RUJA 2AX9A 5DK9A 1XV9B 4Q13A 5LGAA 4G1ZA 3UUDB 3FUGA 3B0TA 3D90A 2HC4A 4NIEA 1OT7A 1SQNA 2NXXA 4E4QA 1HG4A 4JYHA 5DWEA 3VRTA 4WPFA 5E7VA 4MG5A 2R40D 1Y9RA 1XDKB 2ZKCA 4DOSA 2ABIA 1RKGA 2PIWA 1FCZA 3BQDA 5DV6A 3VT8A 3R5MA 1BSXA 2I4PA 4REEA 5DMFA 3RLLA 1VJBA 5L7GA 1MV9A 4A4VA 5M96A 3IPUA 5AWJA 5DV3A 2B1VA 2AA2A 4OJBA 3KMZA 3LBDA 4RMCA 2PITA 1T7RA 2AWHA 2GL8A 2XYJA 4PP5A 5E15A 5G3JA 1L2IA 2GPUA 3UUAB 1X7JA 1EXXA 4XI3A 3AN3A 5FQPA 3OS9A 4BCRA 1FM6A 4RFWA 4NQAB 4MDDA 4CI5A 2HWRA 2HASA 3WTQA 3K22A 4KZMA 4OH5A 1OSHA 1QKTA 3HODA 2ZK4A 4DK7A 3VT4A 3KMGA 4OFRA 5HJSA 4PPPA 4WHGA 3V3QA 5KRKA 2GTKA 1G1UA 1GWXA 3D24A 5HZCA 1XIUA 3L0EA 4PWLA 5GIDA 3VJIA 2QW4A 1X7BA 1PQ9A 5DVCA 1DKFB 3VT7A 4B7WA 2ZMJA 5AAVB 3S9SA 3GYTA 1OVLB 1FM6D 4IS8A 4OKTA 2NXXE 3QT0A 5KRLA 2ZNPA 1Z95A 4RWVA 3AZ3A 5DZ0A 1T7TA 2PRGA 3PLZA 1X78A 4OC7A 1XVPA 4ZNVA 3VJSA 3OSAA 5H1EA 2OVHA 3L1BA 3Q95A 4ZI1A 2P1TA 2AMBA 3L0LA 3O1DA 5ETHA 3E00D 1N4HA 2IOGA 3IXPD 4K6IA 2PIRA 5F9BA 1X7RA 3B0WA 5HJPB 3G8OA 3W0AA 3P8XA 3GD2A 3VHUA 3GZ9A 2HAMA 3WJ5A 2Q6RA 2J7YA 5DXQA 5E0WA 1T7MA 3D6DA 5FQTA 3W5PA 1E3GA 2P7GA 2HFPA 1I7GA 2QSEA 4P6XA 4XT9A 2Q60A 4IU7A 5DIGA 5KCCA 1E3KA 4QE6A 5KCUA 1NAXA 3AX8A 3OKIA 3ADTA 2YATA 3T03A 3DCUA 1XPCA 3FALB 3NOAA 3NSQA 2I0GA 2HBHA 1L2JA 3OMKA 4TUZA 4DM8A 2B50A 4HLWA 4R06A 2FAIA 4IW8A 4MGAB 2PINA 2EWPA 4G1YA 4OK1A 4OEYA 2HVCA 2R6WA 3CDSA 4RUPA 3GWSX 5E14A 3L03A 4TV1A 1Y0XX 4J5WC 4XUMA 2BAWA 3UUDA 4G20A 5JJMB 4HEEX 1IE8A 3FXVA 4OLMA 2ZNOA 3CJWA 4P6WA 4J5WA 2PIVA 1ILHA 4UDAA 3V9VA 5AZTA 3B3KA 2ZXNA 1YYEA 5KCEA 1R5KA 3ERTA 4N8RA 1ZEOA 5DKGA 4IWFA 3UVVB 1ZGYA 2ZK6A 1RDTA 1YP0A 3CS8A 4IV4A 4OJ4A 1FM9A 4ZNHA 3BEJA 2JFAB 1T65A 3A40X 3KPZA 4LSJA 3VTDA 3ADXA 1P8DA 2P7ZA 4OJ9A 2H77A 3A9EB 4OARA 5KRAA 1PQ6A 3WFFA 5GICA 2YLQA 2ACLA 2HB8A 2Z4BA 3R5NA 2Q8SA 4IA7A 2VV4A 4IUIA 4ITEA 5G43A 1FCXA 5K13A 3CQVA 1X76A 3OZ0A 5C4OA 3VTCA 2O4RA 5L7EA 2P7AA 3FC6A 1NAVA 3H0AA 5B5BA 1RDTD 3JZBA 1P93A 2GPOA 3B68A 3O1EA 5EJVA 5IXKA 1UPWA 4XUHA 2IOKA 4F9MA 2ZBSA 4MG7B 3CS6A 5HYKA 5DWJA 3KBAA 5JY3A 4Y29A 3OKHA 2Q7KA 2VV1B 4RUOX 4WVDA 1HJ1A 5DRJA 4ZNTA 3OSWA 1YMTA 4UDDA 3H0AD 4MGBB 3WMHA 5DVSA 3TX7B 1XNNA 2QNVA 5DXRA 3OLLA 1M2ZA 2Q7JA 1U3RA 4OKBA 4J5XC 2QE4A 2AA7A 3OSIA 4Q0AC 2QPYA 3W0GA 3R8DA 2ZL9A 3SP9A 4J5XA 1NQ1A 1TFCA 5IAWA 1XLSE 4MGDB 5EC9A 3ZR7A 2FSZA 2A3IA 4ITFA 4LNWA 5KYAA 3B66A 4E2JA 2O9IA 1RKHA 3DZUA 3RVFA 3DR1A 4L96A 3X1IA 2QA8B 2QTUA 4FHHA 4G2HA 2OVMA 4PLEA 2NV7A 3WT7A 2Q5PA 3KYTA 1ZKYA 1Y0SA 3B1MA 3RUUA 4MG9A 5AVLA 1Z5XE 1K74A 2AB2A 5DWLA 4OEZA 2ZNQA 3A78A 3R2AA 1XZXX 3UU7B 5HYRA 2YHDA 3RLJA 4ZO1B 5DXBA 1M7WA 4POHA 1PRGA 5KR9A 2G44A 1NDEA 2ZK3A 2B1ZA 5KRHA 5KRMA 4IVWA 1I37A 3BC5A 3R8IA 1EREA 3ET3A 4PF3A 3W0YA 3P88A 3ET2A 1UOMA 1YOWA 1K7LA 3DZYA 3D57A 3DT3A 5DKBA 3B0QA 1Z5XU 5CJ6A 3VSPA 1T5ZA 4OEDA 1T63A 2QH6A 3A2IA 3B65A 3F5CB 2F4BA 4Q50A 1T79A 2YJDA 4OEAA 4G2IA 4ZJWA 3WGPA 2VSTA 3OLFA 3KWYA 2AA6A 5DZ3A 3OGTA 3X36A 3U9QA 5G42A 2V0VA 4IQRA 3AUQA 4MG8A 1ZDTA 4DQMA 2PIOA 5ACCA 1U3SA 3FS1A 2HB7A 5E0XA 3VT9A 1A28A 5C4TA 3G8IA 3W5QA 1U3QA 2ZK2A 2AAXA 3CDPA 4RAKA 2YFEA 3K23A 3D5FA 1NUOA 2Q59A 4S0SA 3ET0A 5DZ1A 3MNOA 5EGVA 4APUA 1X7EA 2O4JA 2B23A 2ZXZA 4FGYA 4S0TA 5DKEA 5GT4A 4MGCA 5IZ0A 3X31A 1YINA 2QZOB 5DX3A 5FQVA 4IV2A 1G5YA 4XLDA 3VTBA 3KDUA 3X1HA 5DXPA 1PCGA 3WWRA 4PPSA 5AYGA 2BJ4A 3AZ1A 1A52A 2NPAA 2OCFA 2Q5SA 3HZFA 5SYZA 1IE9A 5AWKA 4FHIA 5G5WA 2PIUA 1LBDA 1PK5A 3VSOA 4NB6A 3HC5A 1UHLA 2NW4A 2OAXA 2P15A 5AZVA 5KCTA 1SKXA 2JJ3A 4QK4A 4WHFA 5DMCA 1RJKA 1G2NA 4G21A 2HCDA 3V4AA 5DWIA 5DI7A 1YUCA 2ZXMA 2Q7IA 3AZ2A 2AYRA 3CTBA 4JYGA 1R20A 4PP6A 3VN2A 1KNUA 1FCYA 1XV9A 2AX8A 4QE8A 3OS8C 1ZDUA 4NUFA 3B5RA 3K8SA 3CWDA 2W8YA 3PO9A 5DRMA 5DUEA 5DYBA 4RMEA 2QGTA 5C4UA 5DZIA 5G44A 3ERDA 1XVPB 1XDKA 3L3ZA 3K6PA 5KCDA 5AAVA 4IW6A 3Q95B 3VRUA 2V7CA 4KZJA 4X1FA 4MG6A 3FLIA 4IA2A 3W0HA 5E19A 3ADWA 4JL4A 3ILZA 3ADVA 4LNXA 4DM6A 5DUGA 3VT5A 4FNEA 2I0JA 2Q7LA 2HWQA 1LV2A 5E1CA 3PRGA 3OMQA 1FM9D 4IA3A 1OSVA 3AURA 2GPPA 3UUAA 2XYWA 5KRCA 4N1YA 1QKUA 1S0XA 5HCVA 4R2UA 2Q6SA 2AX7A 1FD0A 1T73A 5APJA 1NYXA 3P89A 4JYIA 2G0GA 3KMRA 1SR7A 1WM0X 4ZN9A 3W5RA 2AM9A 1XQ3A 3OZJA 4NY9A 2ZFXA 1NQ2A 5KCFA 5C4SA 1R1KA 3V49A 5L11A 5AVIA 5B41A 1GWRA 2ZLCA 1S9PA 2AXAA 1DKFA 3L3XA 4TUZB 2GPVA 4WQPA 1GS4A 5DP0A 5APHA 5EITA 1OVLA 2QMVA 4RZFA 2ZK0A 4A4WA 4DK8A 1EXAA 4LBDA 4X1GA 4O8FA 4OGHA 1ILGA 4ZOMA 3ADUA 3G0WA 1I38A 3VJTA 3HLVA 2E2RA 1R6GA 2VV3A 1M13A 1N83A 4TV1B 1YIMA
chains in the Genus database with same CATH superfamily
2Q3YA 3MNEA 1YA3A 3FEIA 2G5OA 3WT6A 5HJPA 1XP6A 3N00A 5AAUA 3LMPA 3W5TA 1S19A 4JGVA 2J14A 2REWA 2J4AA 5DXKA 3VI8A 1XB7A 2GWXA 4OZRE 5KROA 1XOWA 3E7CA 1PDUA 5DU5A 4K4JA 4REFA 3ADSA 5DWGA 4YPQA 1ERRA 3DZUD 1U9EA 3MNPA 1YY4A 4POJA 2YJAB 4G1DA 3FEJA 5GIEA 2QZOA 5L7HA 2ACLB 5G45A 2VV4B 3B0RA 5APKA 1I7IA 4EM9A 2Q5GA 5KRIA 2Q1VA 3FALA 3OMMA 3FC6B 1K74D 1KV6A 1YJEA 4OH6A 3JZCA 4OILA 4OZRU 4MGAA 2PIXA 4QL8A 3VHWA 3M7RA 3WT5A 4RMDA 1MZNA 3G9EA 4R6SA 3B67A 1T74A 3GWXA 4N73A 3HC6A 2Q61A 3CS4A 2QA6A 2P1UA 4WLBA 1NQ7A 5DTVA 3OAPA 5JJMA 3CLDA 3DZYD 3KDTA 3UP3A 2ZNNA 2ZK1A 3VT3A 4XTAA 1ZH7A 2ZVTA 3TY0A 4OKWA 4PVUA 4XAOA 4ONIA 2XHSA 4OHAA 3E00A 4JAZA 3IXPA 1XNXA 5DLRA 4M8HA 2Q6JA 5FQSA 3V9YA 4E4KA 1XQCA 1SJ0A 3NSPA 1PZLA 4ZNSA 5EI1A 4RE8A 2QXMA 5FQRA 1G50A 3GBKA 3AN4A 3HM1A 3UVVA 3SP6A 3F7DA 1ZAFA 2Z4JA 3HVLA 3OOKA 2VSRA 2JFAA 2VV0A 1NRLA 2OUZA 3HQ5A 4PP3A 4YNKA 4RZGA 3A3ZX 3GYUA 3VHVA 1DB1A 4YMQA 4QJRA 3A9EA 5DXMA 1Q4XA 2ATHA 3ZQTA 3R8AA 2PNUA 1N46A 4PXMA 1ZUCA 2PJLA 3WJ4A 3TKMA 5DXGA 5DIDA 4S14A 1RK3A 4DMAA 3L0JA 3VJHA 4ZJRA 3EYBA 3P0UA 3H52A 3OMPA 2PIQA 4MG9B 3TKCA 2QABA 3ZRBA 2R6YA 2AA5A 4FN9A 4MG7A 1T7FA 1XP9A 4L98A 4DORA 2P4YA 2QXSA 5DXBB 2AO6A 2FVJA 5G46A 2VV1A 2HARA 2YLOA 2P54A 5DVVA 5ICKA 4ZNUA 1S0ZA 1YOKA 5LWPA 4RZEA 5KRJA 2I4JA 4MGBA 2AX6A 4UDCA 1K4WA 2P1VA 4PRGA 4QM0A 2XKWA 3WFGA 5I4VA 2OZ7A 3IPSA 4XHDA 5DSHA 5JI0D 2LBDA 5DKSA 2QR9A 3OS8A 3V3EA 2ZASA 3VT6A 1GWQA 4OIUA 5DIEA 4S15A 1XAPA 2I4ZA 2H79A 2POBA 4MGDA 5KYJA 1R20D 3IA6A 5DZHA 3UP0A 1H9UA 2GIUA 1FBYA 3IMYA 5DUHA 3OLSA 3E94A 2ZMIA 3AFRA 4J26A 4MG8B 3DCTA 3A2JA 4IVYA 2VV2A 2QA8A 1TXIA 3A2HA 3KFCA 5DYDA 2J7XA 2QGWA 4M8EA 3RUTA 3V9TA 4YT1A 4ZN7A 1QKNA 4K7AA 2AMAA 1T76A 4EMAA 3VRVA 4ZO1X 2ZK5A 4OFUA 5KCWA 2PKLA 4OIVA 4IWCA 2Q59B 3OMOA 3R29A 4IA1A 4CI4A 2GP7A 2PIPL 3PEQA 3UU7A 1S9QA 3W0IA 1XLSA 4KZIA 3ZRAA 4CSJA 1MVCA 2YLYA 5KRFA 2ZY0A 5DX3B 5EHJA 3W0JA 2Q1HA 4N5GA 4OZTE 3VRWA 1UPVA 2YLPA 5AK2A 1KKQA 2BJ4B 1XP1A 2IHQA 2POGA 2Q70A 1QKMA 2OM9A 2XYXA 2ZMHA 3AUNA 4J24A 4LTWA 4PLDA 3RY9A 3OOFA 3PBAA 3W0CA 5KD9A 4ZNWA 5A86A 1UHLB 1XJ7A 2JF9A 2G0HA 3GN8A 1NQ0A 3DY6A 1NHZA 4OKXA 5DXEA 3ET1A 5DV8A 3F5CA 5DY8A 4A2JA 3FURA 1R1KD 3IPQA 3UUCA 2R40A 3PCUA 4UDBA 3HO0A 4OZTU 2ZLAA 5DL4A 3SZ1A 1PQCA 4RUJA 2AX9A 5DK9A 1XV9B 4Q13A 5LGAA 4G1ZA 3UUDB 3FUGA 3B0TA 3D90A 2HC4A 4NIEA 1OT7A 1SQNA 2NXXA 4E4QA 1HG4A 4JYHA 5DWEA 3VRTA 4WPFA 5E7VA 4MG5A 2R40D 1Y9RA 1XDKB 2ZKCA 4DOSA 2ABIA 1RKGA 2PIWA 1FCZA 3BQDA 5DV6A 3VT8A 3R5MA 1BSXA 2I4PA 4REEA 5DMFA 3RLLA 1VJBA 5L7GA 1MV9A 4A4VA 5M96A 3IPUA 5AWJA 5DV3A 2B1VA 2AA2A 4OJBA 3KMZA 3LBDA 4RMCA 2PITA 1T7RA 2AWHA 2GL8A 2XYJA 4PP5A 5E15A 5G3JA 1L2IA 2GPUA 3UUAB 1X7JA 1EXXA 4XI3A 3AN3A 5FQPA 3OS9A 4BCRA 1FM6A 4RFWA 4NQAB 4MDDA 4CI5A 2HWRA 2HASA 3WTQA 3K22A 4KZMA 4OH5A 1OSHA 1QKTA 3HODA 2ZK4A 4DK7A 3VT4A 3KMGA 4OFRA 5HJSA 4PPPA 4WHGA 3V3QA 5KRKA 2GTKA 1G1UA 1GWXA 3D24A 5HZCA 1XIUA 3L0EA 4PWLA 5GIDA 3VJIA 2QW4A 1X7BA 1PQ9A 5DVCA 1DKFB 3VT7A 4B7WA 2ZMJA 5AAVB 3S9SA 3GYTA 1OVLB 1FM6D 4IS8A 4OKTA 2NXXE 3QT0A 5KRLA 2ZNPA 1Z95A 4RWVA 3AZ3A 5DZ0A 1T7TA 2PRGA 3PLZA 1X78A 4OC7A 1XVPA 4ZNVA 3VJSA 3OSAA 5H1EA 2OVHA 3L1BA 3Q95A 4ZI1A 2P1TA 2AMBA 3L0LA 3O1DA 5ETHA 3E00D 1N4HA 2IOGA 3IXPD 4K6IA 2PIRA 5F9BA 1X7RA 3B0WA 5HJPB 3G8OA 3W0AA 3P8XA 3GD2A 3VHUA 3GZ9A 2HAMA 3WJ5A 2Q6RA 2J7YA 5DXQA 5E0WA 1T7MA 3D6DA 5FQTA 3W5PA 1E3GA 2P7GA 2HFPA 1I7GA 2QSEA 4P6XA 4XT9A 2Q60A 4IU7A 5DIGA 5KCCA 1E3KA 4QE6A 5KCUA 1NAXA 3AX8A 3OKIA 3ADTA 2YATA 3T03A 3DCUA 1XPCA 3FALB 3NOAA 3NSQA 2I0GA 2HBHA 1L2JA 3OMKA 4TUZA 4DM8A 2B50A 4HLWA 4R06A 2FAIA 4IW8A 4MGAB 2PINA 2EWPA 4G1YA 4OK1A 4OEYA 2HVCA 2R6WA 3CDSA 4RUPA 3GWSX 5E14A 3L03A 4TV1A 1Y0XX 4J5WC 4XUMA 2BAWA 3UUDA 4G20A 5JJMB 4HEEX 1IE8A 3FXVA 4OLMA 2ZNOA 3CJWA 4P6WA 4J5WA 2PIVA 1ILHA 4UDAA 3V9VA 5AZTA 3B3KA 2ZXNA 1YYEA 5KCEA 1R5KA 3ERTA 4N8RA 1ZEOA 5DKGA 4IWFA 3UVVB 1ZGYA 2ZK6A 1RDTA 1YP0A 3CS8A 4IV4A 4OJ4A 1FM9A 4ZNHA 3BEJA 2JFAB 1T65A 3A40X 3KPZA 4LSJA 3VTDA 3ADXA 1P8DA 2P7ZA 4OJ9A 2H77A 3A9EB 4OARA 5KRAA 1PQ6A 3WFFA 5GICA 2YLQA 2ACLA 2HB8A 2Z4BA 3R5NA 2Q8SA 4IA7A 2VV4A 4IUIA 4ITEA 5G43A 1FCXA 5K13A 3CQVA 1X76A 3OZ0A 5C4OA 3VTCA 2O4RA 5L7EA 2P7AA 3FC6A 1NAVA 3H0AA 5B5BA 1RDTD 3JZBA 1P93A 2GPOA 3B68A 3O1EA 5EJVA 5IXKA 1UPWA 4XUHA 2IOKA 4F9MA 2ZBSA 4MG7B 3CS6A 5HYKA 5DWJA 3KBAA 5JY3A 4Y29A 3OKHA 2Q7KA 2VV1B 4RUOX 4WVDA 1HJ1A 5DRJA 4ZNTA 3OSWA 1YMTA 4UDDA 3H0AD 4MGBB 3WMHA 5DVSA 3TX7B 1XNNA 2QNVA 5DXRA 3OLLA 1M2ZA 2Q7JA 1U3RA 4OKBA 4J5XC 2QE4A 2AA7A 3OSIA 4Q0AC 2QPYA 3W0GA 3R8DA 2ZL9A 3SP9A 4J5XA 1NQ1A 1TFCA 5IAWA 1XLSE 4MGDB 5EC9A 3ZR7A 2FSZA 2A3IA 4ITFA 4LNWA 5KYAA 3B66A 4E2JA 2O9IA 1RKHA 3DZUA 3RVFA 3DR1A 4L96A 3X1IA 2QA8B 2QTUA 4FHHA 4G2HA 2OVMA 4PLEA 2NV7A 3WT7A 2Q5PA 3KYTA 1ZKYA 1Y0SA 3B1MA 3RUUA 4MG9A 5AVLA 1Z5XE 1K74A 2AB2A 5DWLA 4OEZA 2ZNQA 3A78A 3R2AA 1XZXX 3UU7B 5HYRA 2YHDA 3RLJA 4ZO1B 5DXBA 1M7WA 4POHA 1PRGA 5KR9A 2G44A 1NDEA 2ZK3A 2B1ZA 5KRHA 5KRMA 4IVWA 1I37A 3BC5A 3R8IA 1EREA 3ET3A 4PF3A 3W0YA 3P88A 3ET2A 1UOMA 1YOWA 1K7LA 3DZYA 3D57A 3DT3A 5DKBA 3B0QA 1Z5XU 5CJ6A 3VSPA 1T5ZA 4OEDA 1T63A 2QH6A 3A2IA 3B65A 3F5CB 2F4BA 4Q50A 1T79A 2YJDA 4OEAA 4G2IA 4ZJWA 3WGPA 2VSTA 3OLFA 3KWYA 2AA6A 5DZ3A 3OGTA 3X36A 3U9QA 5G42A 2V0VA 4IQRA 3AUQA 4MG8A 1ZDTA 4DQMA 2PIOA 5ACCA 1U3SA 3FS1A 2HB7A 5E0XA 3VT9A 1A28A 5C4TA 3G8IA 3W5QA 1U3QA 2ZK2A 2AAXA 3CDPA 4RAKA 2YFEA 3K23A 3D5FA 1NUOA 2Q59A 4S0SA 3ET0A 5DZ1A 3MNOA 5EGVA 4APUA 1X7EA 2O4JA 2B23A 2ZXZA 4FGYA 4S0TA 5DKEA 5GT4A 4MGCA 5IZ0A 3X31A 1YINA 2QZOB 5DX3A 5FQVA 4IV2A 1G5YA 4XLDA 3VTBA 3KDUA 3X1HA 5DXPA 1PCGA 3WWRA 4PPSA 5AYGA 2BJ4A 3AZ1A 1A52A 2NPAA 2OCFA 2Q5SA 3HZFA 5SYZA 1IE9A 5AWKA 4FHIA 5G5WA 2PIUA 1LBDA 1PK5A 3VSOA 4NB6A 3HC5A 1UHLA 2NW4A 2OAXA 2P15A 5AZVA 5KCTA 1SKXA 2JJ3A 4QK4A 4WHFA 5DMCA 1RJKA 1G2NA 4G21A 2HCDA 3V4AA 5DWIA 5DI7A 1YUCA 2ZXMA 2Q7IA 3AZ2A 2AYRA 3CTBA 4JYGA 1R20A 4PP6A 3VN2A 1KNUA 1FCYA 1XV9A 2AX8A 4QE8A 3OS8C 1ZDUA 4NUFA 3B5RA 3K8SA 3CWDA 2W8YA 3PO9A 5DRMA 5DUEA 5DYBA 4RMEA 2QGTA 5C4UA 5DZIA 5G44A 3ERDA 1XVPB 1XDKA 3L3ZA 3K6PA 5KCDA 5AAVA 4IW6A 3Q95B 3VRUA 2V7CA 4KZJA 4X1FA 4MG6A 3FLIA 4IA2A 3W0HA 5E19A 3ADWA 4JL4A 3ILZA 3ADVA 4LNXA 4DM6A 5DUGA 3VT5A 4FNEA 2I0JA 2Q7LA 2HWQA 1LV2A 5E1CA 3PRGA 3OMQA 1FM9D 4IA3A 1OSVA 3AURA 2GPPA 3UUAA 2XYWA 5KRCA 4N1YA 1QKUA 1S0XA 5HCVA 4R2UA 2Q6SA 2AX7A 1FD0A 1T73A 5APJA 1NYXA 3P89A 4JYIA 2G0GA 3KMRA 1SR7A 1WM0X 4ZN9A 3W5RA 2AM9A 1XQ3A 3OZJA 4NY9A 2ZFXA 1NQ2A 5KCFA 5C4SA 1R1KA 3V49A 5L11A 5AVIA 5B41A 1GWRA 2ZLCA 1S9PA 2AXAA 1DKFA 3L3XA 4TUZB 2GPVA 4WQPA 1GS4A 5DP0A 5APHA 5EITA 1OVLA 2QMVA 4RZFA 2ZK0A 4A4WA 4DK8A 1EXAA 4LBDA 4X1GA 4O8FA 4OGHA 1ILGA 4ZOMA 3ADUA 3G0WA 1I38A 3VJTA 3HLVA 2E2RA 1R6GA 2VV3A 1M13A 1N83A 4TV1B 1YIMA
chains in the Genus database with same CATH topology
2Q3YA 3MNEA 1YA3A 3FEIA 2G5OA 3WT6A 5HJPA 1XP6A 3N00A 5AAUA 3LMPA 3W5TA 1S19A 4JGVA 2J14A 2REWA 2J4AA 5DXKA 3VI8A 1XB7A 2GWXA 4OZRE 5KROA 1XOWA 3E7CA 1PDUA 5DU5A 4K4JA 4REFA 3ADSA 5DWGA 4YPQA 1ERRA 3DZUD 1U9EA 3MNPA 1YY4A 4POJA 2YJAB 4G1DA 3FEJA 5GIEA 2QZOA 5L7HA 2ACLB 5G45A 2VV4B 3B0RA 5APKA 1I7IA 4EM9A 2Q5GA 5KRIA 2Q1VA 3FALA 3OMMA 3FC6B 1K74D 1KV6A 1YJEA 4OH6A 3JZCA 4OILA 4OZRU 4MGAA 2PIXA 4QL8A 3VHWA 3M7RA 3WT5A 4RMDA 1MZNA 3G9EA 4R6SA 3B67A 1T74A 3GWXA 4N73A 3HC6A 2Q61A 3CS4A 2QA6A 2P1UA 4WLBA 1NQ7A 5DTVA 3OAPA 5JJMA 3CLDA 3DZYD 3KDTA 3UP3A 2ZNNA 2ZK1A 3VT3A 4XTAA 1ZH7A 2ZVTA 3TY0A 4OKWA 4PVUA 4XAOA 4ONIA 2XHSA 4OHAA 3E00A 4JAZA 3IXPA 1XNXA 5DLRA 4M8HA 2Q6JA 5FQSA 3V9YA 4E4KA 1XQCA 1SJ0A 3NSPA 1PZLA 4ZNSA 5EI1A 4RE8A 2QXMA 5FQRA 1G50A 3GBKA 3AN4A 3HM1A 3UVVA 3SP6A 3F7DA 1ZAFA 2Z4JA 3HVLA 3OOKA 2VSRA 2JFAA 2VV0A 1NRLA 2OUZA 3HQ5A 4PP3A 4YNKA 4RZGA 3A3ZX 3GYUA 3VHVA 1DB1A 4YMQA 4QJRA 3A9EA 5DXMA 1Q4XA 2ATHA 3ZQTA 3R8AA 2PNUA 1N46A 4PXMA 1ZUCA 2PJLA 3WJ4A 3TKMA 5DXGA 5DIDA 4S14A 1RK3A 4DMAA 3L0JA 3VJHA 4ZJRA 3EYBA 3P0UA 3H52A 3OMPA 2PIQA 4MG9B 3TKCA 2QABA 3ZRBA 2R6YA 2AA5A 4FN9A 4MG7A 1T7FA 1XP9A 4L98A 4DORA 2P4YA 2QXSA 5DXBB 2AO6A 2FVJA 5G46A 2VV1A 2HARA 2YLOA 2P54A 5DVVA 5ICKA 4ZNUA 1S0ZA 1YOKA 5LWPA 4RZEA 5KRJA 2I4JA 4MGBA 2AX6A 4UDCA 1K4WA 2P1VA 4PRGA 4QM0A 2XKWA 3WFGA 5I4VA 2OZ7A 3IPSA 4XHDA 5DSHA 5JI0D 2LBDA 5DKSA 2QR9A 3OS8A 3V3EA 2ZASA 3VT6A 1GWQA 4OIUA 5DIEA 4S15A 1XAPA 2I4ZA 2H79A 2POBA 4MGDA 5KYJA 1R20D 3IA6A 5DZHA 3UP0A 1H9UA 2GIUA 1FBYA 3IMYA 5DUHA 3OLSA 3E94A 2ZMIA 3AFRA 4J26A 4MG8B 3DCTA 3A2JA 4IVYA 2VV2A 2QA8A 1TXIA 3A2HA 3KFCA 5DYDA 2J7XA 2QGWA 4M8EA 3RUTA 3V9TA 4YT1A 4ZN7A 1QKNA 4K7AA 2AMAA 1T76A 4EMAA 3VRVA 4ZO1X 2ZK5A 4OFUA 5KCWA 2PKLA 4OIVA 4IWCA 2Q59B 3OMOA 3R29A 4IA1A 4CI4A 2GP7A 2PIPL 3PEQA 3UU7A 1S9QA 3W0IA 1XLSA 4KZIA 3ZRAA 4CSJA 1MVCA 2YLYA 5KRFA 2ZY0A 5DX3B 5EHJA 3W0JA 2Q1HA 4N5GA 4OZTE 3VRWA 1UPVA 2YLPA 5AK2A 1KKQA 2BJ4B 1XP1A 2IHQA 2POGA 2Q70A 1QKMA 2OM9A 2XYXA 2ZMHA 3AUNA 4J24A 4LTWA 4PLDA 3RY9A 3OOFA 3PBAA 3W0CA 5KD9A 4ZNWA 5A86A 1UHLB 1XJ7A 2JF9A 2G0HA 3GN8A 1NQ0A 3DY6A 1NHZA 4OKXA 5DXEA 3ET1A 5DV8A 3F5CA 5DY8A 4A2JA 3FURA 1R1KD 3IPQA 3UUCA 2R40A 3PCUA 4UDBA 3HO0A 4OZTU 2ZLAA 5DL4A 3SZ1A 1PQCA 4RUJA 2AX9A 5DK9A 1XV9B 4Q13A 5LGAA 4G1ZA 3UUDB 3FUGA 3B0TA 3D90A 2HC4A 4NIEA 1OT7A 1SQNA 2NXXA 4E4QA 1HG4A 4JYHA 5DWEA 3VRTA 4WPFA 5E7VA 4MG5A 2R40D 1Y9RA 1XDKB 2ZKCA 4DOSA 2ABIA 1RKGA 2PIWA 1FCZA 3BQDA 5DV6A 3VT8A 3R5MA 1BSXA 2I4PA 4REEA 5DMFA 3RLLA 1VJBA 5L7GA 1MV9A 4A4VA 5M96A 3IPUA 5AWJA 5DV3A 2B1VA 2AA2A 4OJBA 3KMZA 3LBDA 4RMCA 2PITA 1T7RA 2AWHA 2GL8A 2XYJA 4PP5A 5E15A 5G3JA 1L2IA 2GPUA 3UUAB 1X7JA 1EXXA 4XI3A 3AN3A 5FQPA 3OS9A 4BCRA 1FM6A 4RFWA 4NQAB 4MDDA 4CI5A 2HWRA 2HASA 3WTQA 3K22A 4KZMA 4OH5A 1OSHA 1QKTA 3HODA 2ZK4A 4DK7A 3VT4A 3KMGA 4OFRA 5HJSA 4PPPA 4WHGA 3V3QA 5KRKA 2GTKA 1G1UA 1GWXA 3D24A 5HZCA 1XIUA 3L0EA 4PWLA 5GIDA 3VJIA 2QW4A 1X7BA 1PQ9A 5DVCA 1DKFB 3VT7A 4B7WA 2ZMJA 5AAVB 3S9SA 3GYTA 1OVLB 1FM6D 4IS8A 4OKTA 2NXXE 3QT0A 5KRLA 2ZNPA 1Z95A 4RWVA 3AZ3A 5DZ0A 1T7TA 2PRGA 3PLZA 1X78A 4OC7A 1XVPA 4ZNVA 3VJSA 3OSAA 5H1EA 2OVHA 3L1BA 3Q95A 4ZI1A 2P1TA 2AMBA 3L0LA 3O1DA 5ETHA 3E00D 1N4HA 2IOGA 3IXPD 4K6IA 2PIRA 5F9BA 1X7RA 3B0WA 5HJPB 3G8OA 3W0AA 3P8XA 3GD2A 3VHUA 3GZ9A 2HAMA 3WJ5A 2Q6RA 2J7YA 5DXQA 5E0WA 1T7MA 3D6DA 5FQTA 3W5PA 1E3GA 2P7GA 2HFPA 1I7GA 2QSEA 4P6XA 4XT9A 2Q60A 4IU7A 5DIGA 5KCCA 1E3KA 4QE6A 5KCUA 1NAXA 3AX8A 3OKIA 3ADTA 2YATA 3T03A 3DCUA 1XPCA 3FALB 3NOAA 3NSQA 2I0GA 2HBHA 1L2JA 3OMKA 4TUZA 4DM8A 2B50A 4HLWA 4R06A 2FAIA 4IW8A 4MGAB 2PINA 2EWPA 4G1YA 4OK1A 4OEYA 2HVCA 2R6WA 3CDSA 4RUPA 3GWSX 5E14A 3L03A 4TV1A 1Y0XX 4J5WC 4XUMA 2BAWA 3UUDA 4G20A 5JJMB 4HEEX 1IE8A 3FXVA 4OLMA 2ZNOA 3CJWA 4P6WA 4J5WA 2PIVA 1ILHA 4UDAA 3V9VA 5AZTA 3B3KA 2ZXNA 1YYEA 5KCEA 1R5KA 3ERTA 4N8RA 1ZEOA 5DKGA 4IWFA 3UVVB 1ZGYA 2ZK6A 1RDTA 1YP0A 3CS8A 4IV4A 4OJ4A 1FM9A 4ZNHA 3BEJA 2JFAB 1T65A 3A40X 3KPZA 4LSJA 3VTDA 3ADXA 1P8DA 2P7ZA 4OJ9A 2H77A 3A9EB 4OARA 5KRAA 1PQ6A 3WFFA 5GICA 2YLQA 2ACLA 2HB8A 2Z4BA 3R5NA 2Q8SA 4IA7A 2VV4A 4IUIA 4ITEA 5G43A 1FCXA 5K13A 3CQVA 1X76A 3OZ0A 5C4OA 3VTCA 2O4RA 5L7EA 2P7AA 3FC6A 1NAVA 3H0AA 5B5BA 1RDTD 3JZBA 1P93A 2GPOA 3B68A 3O1EA 5EJVA 5IXKA 1UPWA 4XUHA 2IOKA 4F9MA 2ZBSA 4MG7B 3CS6A 5HYKA 5DWJA 3KBAA 5JY3A 4Y29A 3OKHA 2Q7KA 2VV1B 4RUOX 4WVDA 1HJ1A 5DRJA 4ZNTA 3OSWA 1YMTA 4UDDA 3H0AD 4MGBB 3WMHA 5DVSA 3TX7B 1XNNA 2QNVA 5DXRA 3OLLA 1M2ZA 2Q7JA 1U3RA 4OKBA 4J5XC 2QE4A 2AA7A 3OSIA 4Q0AC 2QPYA 3W0GA 3R8DA 2ZL9A 3SP9A 4J5XA 1NQ1A 1TFCA 5IAWA 1XLSE 4MGDB 5EC9A 3ZR7A 2FSZA 2A3IA 4ITFA 4LNWA 5KYAA 3B66A 4E2JA 2O9IA 1RKHA 3DZUA 3RVFA 3DR1A 4L96A 3X1IA 2QA8B 2QTUA 4FHHA 4G2HA 2OVMA 4PLEA 2NV7A 3WT7A 2Q5PA 3KYTA 1ZKYA 1Y0SA 3B1MA 3RUUA 4MG9A 5AVLA 1Z5XE 1K74A 2AB2A 5DWLA 4OEZA 2ZNQA 3A78A 3R2AA 1XZXX 3UU7B 5HYRA 2YHDA 3RLJA 4ZO1B 5DXBA 1M7WA 4POHA 1PRGA 5KR9A 2G44A 1NDEA 2ZK3A 2B1ZA 5KRHA 5KRMA 4IVWA 1I37A 3BC5A 3R8IA 1EREA 3ET3A 4PF3A 3W0YA 3P88A 3ET2A 1UOMA 1YOWA 1K7LA 3DZYA 3D57A 3DT3A 5DKBA 3B0QA 1Z5XU 5CJ6A 3VSPA 1T5ZA 4OEDA 1T63A 2QH6A 3A2IA 3B65A 3F5CB 2F4BA 4Q50A 1T79A 2YJDA 4OEAA 4G2IA 4ZJWA 3WGPA 2VSTA 3OLFA 3KWYA 2AA6A 5DZ3A 3OGTA 3X36A 3U9QA 5G42A 2V0VA 4IQRA 3AUQA 4MG8A 1ZDTA 4DQMA 2PIOA 5ACCA 1U3SA 3FS1A 2HB7A 5E0XA 3VT9A 1A28A 5C4TA 3G8IA 3W5QA 1U3QA 2ZK2A 2AAXA 3CDPA 4RAKA 2YFEA 3K23A 3D5FA 1NUOA 2Q59A 4S0SA 3ET0A 5DZ1A 3MNOA 5EGVA 4APUA 1X7EA 2O4JA 2B23A 2ZXZA 4FGYA 4S0TA 5DKEA 5GT4A 4MGCA 5IZ0A 3X31A 1YINA 2QZOB 5DX3A 5FQVA 4IV2A 1G5YA 4XLDA 3VTBA 3KDUA 3X1HA 5DXPA 1PCGA 3WWRA 4PPSA 5AYGA 2BJ4A 3AZ1A 1A52A 2NPAA 2OCFA 2Q5SA 3HZFA 5SYZA 1IE9A 5AWKA 4FHIA 5G5WA 2PIUA 1LBDA 1PK5A 3VSOA 4NB6A 3HC5A 1UHLA 2NW4A 2OAXA 2P15A 5AZVA 5KCTA 1SKXA 2JJ3A 4QK4A 4WHFA 5DMCA 1RJKA 1G2NA 4G21A 2HCDA 3V4AA 5DWIA 5DI7A 1YUCA 2ZXMA 2Q7IA 3AZ2A 2AYRA 3CTBA 4JYGA 1R20A 4PP6A 3VN2A 1KNUA 1FCYA 1XV9A 2AX8A 4QE8A 3OS8C 1ZDUA 4NUFA 3B5RA 3K8SA 3CWDA 2W8YA 3PO9A 5DRMA 5DUEA 5DYBA 4RMEA 2QGTA 5C4UA 5DZIA 5G44A 3ERDA 1XVPB 1XDKA 3L3ZA 3K6PA 5KCDA 5AAVA 4IW6A 3Q95B 3VRUA 2V7CA 4KZJA 4X1FA 4MG6A 3FLIA 4IA2A 3W0HA 5E19A 3ADWA 4JL4A 3ILZA 3ADVA 4LNXA 4DM6A 5DUGA 3VT5A 4FNEA 2I0JA 2Q7LA 2HWQA 1LV2A 5E1CA 3PRGA 3OMQA 1FM9D 4IA3A 1OSVA 3AURA 2GPPA 3UUAA 2XYWA 5KRCA 4N1YA 1QKUA 1S0XA 5HCVA 4R2UA 2Q6SA 2AX7A 1FD0A 1T73A 5APJA 1NYXA 3P89A 4JYIA 2G0GA 3KMRA 1SR7A 1WM0X 4ZN9A 3W5RA 2AM9A 1XQ3A 3OZJA 4NY9A 2ZFXA 1NQ2A 5KCFA 5C4SA 1R1KA 3V49A 5L11A 5AVIA 5B41A 1GWRA 2ZLCA 1S9PA 2AXAA 1DKFA 3L3XA 4TUZB 2GPVA 4WQPA 1GS4A 5DP0A 5APHA 5EITA 1OVLA 2QMVA 4RZFA 2ZK0A 4A4WA 4DK8A 1EXAA 4LBDA 4X1GA 4O8FA 4OGHA 1ILGA 4ZOMA 3ADUA 3G0WA 1I38A 3VJTA 3HLVA 2E2RA 1R6GA 2VV3A 1M13A 1N83A 4TV1B 1YIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q3Y A;  3MNE A;  1YA3 A;  3FEI A;  2G5O A;  3WT6 A;  5HJP A;  1XP6 A;  3N00 A;  5AAU A;  3LMP A;  3W5T A;  1S19 A;  4JGV A;  2J14 A;  2REW A;  2J4A A;  5DXK A;  3VI8 A;  1XB7 A;  2GWX A;  4OZR E;  5KRO A;  1XOW A;  3E7C A;  1PDU A;  5DU5 A;  4K4J A;  4REF A;  3ADS A;  5DWG A;  4YPQ A;  1ERR A;  3DZU D;  1U9E A;  3MNP A;  1YY4 A;  4POJ A;  2YJA B;  4G1D A;  3FEJ A;  5GIE A;  2QZO A;  5L7H A;  2ACL B;  5G45 A;  2VV4 B;  3B0R A;  5APK A;  1I7I A;  4EM9 A;  2Q5G A;  5KRI A;  2Q1V A;  3FAL A;  3OMM A;  3FC6 B;  1K74 D;  1KV6 A;  1YJE A;  4OH6 A;  3JZC A;  4OIL A;  4OZR U;  4MGA A;  2PIX A;  4QL8 A;  3VHW A;  3M7R A;  3WT5 A;  4RMD A;  1MZN A;  3G9E A;  4R6S A;  3B67 A;  1T74 A;  3GWX A;  4N73 A;  3HC6 A;  2Q61 A;  3CS4 A;  2QA6 A;  2P1U A;  4WLB A;  1NQ7 A;  5DTV A;  3OAP A;  5JJM A;  3CLD A;  3DZY D;  3KDT A;  3UP3 A;  2ZNN A;  2ZK1 A;  3VT3 A;  4XTA A;  1ZH7 A;  2ZVT A;  3TY0 A;  4OKW A;  4PVU A;  4XAO A;  4ONI A;  2XHS A;  4OHA A;  3E00 A;  4JAZ A;  3IXP A;  1XNX A;  5DLR A;  4M8H A;  2Q6J A;  5FQS A;  3V9Y A;  4E4K A;  1XQC A;  1SJ0 A;  3NSP A;  1PZL A;  4ZNS A;  5EI1 A;  4RE8 A;  2QXM A;  5FQR A;  1G50 A;  3GBK A;  3AN4 A;  3HM1 A;  3UVV A;  3SP6 A;  3F7D A;  1ZAF A;  2Z4J A;  3HVL A;  3OOK A;  2VSR A;  2JFA A;  2VV0 A;  1NRL A;  2OUZ A;  3HQ5 A;  4PP3 A;  4YNK A;  4RZG A;  3A3Z X;  3GYU A;  3VHV A;  1DB1 A;  4YMQ A;  4QJR A;  3A9E A;  5DXM A;  1Q4X A;  2ATH A;  3ZQT A;  3R8A A;  2PNU A;  1N46 A;  4PXM A;  1ZUC A;  2PJL A;  3WJ4 A;  3TKM A;  5DXG A;  5DID A;  4S14 A;  1RK3 A;  4DMA A;  3L0J A;  3VJH A;  4ZJR A;  3EYB A;  3P0U A;  3H52 A;  3OMP A;  2PIQ A;  4MG9 B;  3TKC A;  2QAB A;  3ZRB A;  2R6Y A;  2AA5 A;  4FN9 A;  4MG7 A;  1T7F A;  1XP9 A;  4L98 A;  4DOR A;  2P4Y A;  2QXS A;  5DXB B;  2AO6 A;  2FVJ A;  5G46 A;  2VV1 A;  2HAR A;  2YLO A;  2P54 A;  5DVV A;  5ICK A;  4ZNU A;  1S0Z A;  1YOK A;  5LWP A;  4RZE A;  5KRJ A;  2I4J A;  4MGB A;  2AX6 A;  4UDC A;  1K4W A;  2P1V A;  4PRG A;  4QM0 A;  2XKW A;  3WFG A;  5I4V A;  2OZ7 A;  3IPS A;  4XHD A;  5DSH A;  5JI0 D;  2LBD A;  5DKS A;  2QR9 A;  3OS8 A;  3V3E A;  2ZAS A;  3VT6 A;  1GWQ A;  4OIU A;  5DIE A;  4S15 A;  1XAP A;  2I4Z A;  2H79 A;  2POB A;  4MGD A;  5KYJ A;  1R20 D;  3IA6 A;  5DZH A;  3UP0 A;  1H9U A;  2GIU A;  1FBY A;  3IMY A;  5DUH A;  3OLS A;  3E94 A;  2ZMI A;  3AFR A;  4J26 A;  4MG8 B;  3DCT A;  3A2J A;  4IVY A;  2VV2 A;  2QA8 A;  1TXI A;  3A2H A;  3KFC A;  5DYD A;  2J7X A;  2QGW A;  4M8E A;  3RUT A;  3V9T A;  4YT1 A;  4ZN7 A;  1QKN A;  4K7A A;  2AMA A;  1T76 A;  4EMA A;  3VRV A;  4ZO1 X;  2ZK5 A;  4OFU A;  5KCW A;  2PKL A;  4OIV A;  4IWC A;  2Q59 B;  3OMO A;  3R29 A;  4IA1 A;  4CI4 A;  2GP7 A;  2PIP L;  3PEQ A;  3UU7 A;  1S9Q A;  3W0I A;  1XLS A;  4KZI A;  3ZRA A;  4CSJ A;  1MVC A;  2YLY A;  5KRF A;  2ZY0 A;  5DX3 B;  5EHJ A;  3W0J A;  2Q1H A;  4N5G A;  4OZT E;  3VRW A;  1UPV A;  2YLP A;  5AK2 A;  1KKQ A;  2BJ4 B;  1XP1 A;  2IHQ A;  2POG A;  2Q70 A;  1QKM A;  2OM9 A;  2XYX A;  2ZMH A;  3AUN A;  4J24 A;  4LTW A;  4PLD A;  3RY9 A;  3OOF A;  3PBA A;  3W0C A;  5KD9 A;  4ZNW A;  5A86 A;  1UHL B;  1XJ7 A;  2JF9 A;  2G0H A;  3GN8 A;  1NQ0 A;  3DY6 A;  1NHZ A;  4OKX A;  5DXE A;  3ET1 A;  5DV8 A;  3F5C A;  5DY8 A;  4A2J A;  3FUR A;  1R1K D;  3IPQ A;  3UUC A;  2R40 A;  3PCU A;  4UDB A;  3HO0 A;  4OZT U;  2ZLA A;  5DL4 A;  3SZ1 A;  1PQC A;  4RUJ A;  2AX9 A;  5DK9 A;  1XV9 B;  4Q13 A;  5LGA A;  4G1Z A;  3UUD B;  3FUG A;  3B0T A;  3D90 A;  2HC4 A;  4NIE A;  1OT7 A;  1SQN A;  2NXX A;  4E4Q A;  1HG4 A;  4JYH A;  5DWE A;  3VRT A;  4WPF A;  5E7V A;  4MG5 A;  2R40 D;  1Y9R A;  1XDK B;  2ZKC A;  4DOS A;  2ABI A;  1RKG A;  2PIW A;  1FCZ A;  3BQD A;  5DV6 A;  3VT8 A;  3R5M A;  1BSX A;  2I4P A;  4REE A;  5DMF A;  3RLL A;  1VJB A;  5L7G A;  1MV9 A;  4A4V A;  5M96 A;  3IPU A;  5AWJ A;  5DV3 A;  2B1V A;  2AA2 A;  4OJB A;  3KMZ A;  3LBD A;  4RMC A;  2PIT A;  1T7R A;  2AWH A;  2GL8 A;  2XYJ A;  4PP5 A;  5E15 A;  5G3J A;  1L2I A;  2GPU A;  3UUA B;  1X7J A;  1EXX A;  4XI3 A;  3AN3 A;  5FQP A;  3OS9 A;  4BCR A;  1FM6 A;  4RFW A;  4NQA B;  4MDD A;  4CI5 A;  2HWR A;  2HAS A;  3WTQ A;  3K22 A;  4KZM A;  4OH5 A;  1OSH A;  1QKT A;  3HOD A;  2ZK4 A;  4DK7 A;  3VT4 A;  3KMG A;  4OFR A;  5HJS A;  4PPP A;  4WHG A;  3V3Q A;  5KRK A;  2GTK A;  1G1U A;  1GWX A;  3D24 A;  5HZC A;  1XIU A;  3L0E A;  4PWL A;  5GID A;  3VJI A;  2QW4 A;  1X7B A;  1PQ9 A;  5DVC A;  1DKF B;  3VT7 A;  4B7W A;  2ZMJ A;  5AAV B;  3S9S A;  3GYT A;  1OVL B;  1FM6 D;  4IS8 A;  4OKT A;  2NXX E;  3QT0 A;  5KRL A;  2ZNP A;  1Z95 A;  4RWV A;  3AZ3 A;  5DZ0 A;  1T7T A;  2PRG A;  3PLZ A;  1X78 A;  4OC7 A;  1XVP A;  4ZNV A;  3VJS A;  3OSA A;  5H1E A;  2OVH A;  3L1B A;  3Q95 A;  4ZI1 A;  2P1T A;  2AMB A;  3L0L A;  3O1D A;  5ETH A;  3E00 D;  1N4H A;  2IOG A;  3IXP D;  4K6I A;  2PIR A;  5F9B A;  1X7R A;  3B0W A;  5HJP B;  3G8O A;  3W0A A;  3P8X A;  3GD2 A;  3VHU A;  3GZ9 A;  2HAM A;  3WJ5 A;  2Q6R A;  2J7Y A;  5DXQ A;  5E0W A;  1T7M A;  3D6D A;  5FQT A;  3W5P A;  1E3G A;  2P7G A;  2HFP A;  1I7G A;  2QSE A;  4P6X A;  4XT9 A;  2Q60 A;  4IU7 A;  5DIG A;  5KCC A;  1E3K A;  4QE6 A;  5KCU A;  1NAX A;  3AX8 A;  3OKI A;  3ADT A;  2YAT A;  3T03 A;  3DCU A;  1XPC A;  3FAL B;  3NOA A;  3NSQ A;  2I0G A;  2HBH A;  1L2J A;  3OMK A;  4TUZ A;  4DM8 A;  2B50 A;  4HLW A;  4R06 A;  2FAI A;  4IW8 A;  4MGA B;  2PIN A;  2EWP A;  4G1Y A;  4OK1 A;  4OEY A;  2HVC A;  2R6W A;  3CDS A;  4RUP A;  3GWS X;  5E14 A;  3L03 A;  4TV1 A;  1Y0X X;  4J5W C;  4XUM A;  2BAW A;  3UUD A;  4G20 A;  5JJM B;  4HEE X;  1IE8 A;  3FXV A;  4OLM A;  2ZNO A;  3CJW A;  4P6W A;  4J5W A;  2PIV A;  1ILH A;  4UDA A;  3V9V A;  5AZT A;  3B3K A;  2ZXN A;  1YYE A;  5KCE A;  1R5K A;  3ERT A;  4N8R A;  1ZEO A;  5DKG A;  4IWF A;  3UVV B;  1ZGY A;  2ZK6 A;  1RDT A;  1YP0 A;  3CS8 A;  4IV4 A;  4OJ4 A;  1FM9 A;  4ZNH A;  3BEJ A;  2JFA B;  1T65 A;  3A40 X;  3KPZ A;  4LSJ A;  3VTD A;  3ADX A;  1P8D A;  2P7Z A;  4OJ9 A;  2H77 A;  3A9E B;  4OAR A;  5KRA A;  1PQ6 A;  3WFF A;  5GIC A;  2YLQ A;  2ACL A;  2HB8 A;  2Z4B A;  3R5N A;  2Q8S A;  4IA7 A;  2VV4 A;  4IUI A;  4ITE A;  5G43 A;  1FCX A;  5K13 A;  3CQV A;  1X76 A;  3OZ0 A;  5C4O A;  3VTC A;  2O4R A;  5L7E A;  2P7A A;  3FC6 A;  1NAV A;  3H0A A;  5B5B A;  1RDT D;  3JZB A;  1P93 A;  2GPO A;  3B68 A;  3O1E A;  5EJV A;  5IXK A;  1UPW A;  4XUH A;  2IOK A;  4F9M A;  2ZBS A;  4MG7 B;  3CS6 A;  5HYK A;  5DWJ A;  3KBA A;  5JY3 A;  4Y29 A;  3OKH A;  2Q7K A;  2VV1 B;  4RUO X;  4WVD A;  1HJ1 A;  5DRJ A;  4ZNT A;  3OSW A;  1YMT A;  4UDD A;  3H0A D;  4MGB B;  3WMH A;  5DVS A;  3TX7 B;  1XNN A;  2QNV A;  5DXR A;  3OLL A;  1M2Z A;  2Q7J A;  1U3R A;  4OKB A;  4J5X C;  2QE4 A;  2AA7 A;  3OSI A;  4Q0A C;  2QPY A;  3W0G A;  3R8D A;  2ZL9 A;  3SP9 A;  4J5X A;  1NQ1 A;  1TFC A;  5IAW A;  1XLS E;  4MGD B;  5EC9 A;  3ZR7 A;  2FSZ A;  2A3I A;  4ITF A;  4LNW A;  5KYA A;  3B66 A;  4E2J A;  2O9I A;  1RKH A;  3DZU A;  3RVF A;  3DR1 A;  4L96 A;  3X1I A;  2QA8 B;  2QTU A;  4FHH A;  4G2H A;  2OVM A;  4PLE A;  2NV7 A;  3WT7 A;  2Q5P A;  3KYT A;  1ZKY A;  1Y0S A;  3B1M A;  3RUU A;  4MG9 A;  5AVL A;  1Z5X E;  1K74 A;  2AB2 A;  5DWL A;  4OEZ A;  2ZNQ A;  3A78 A;  3R2A A;  1XZX X;  3UU7 B;  5HYR A;  2YHD A;  3RLJ A;  4ZO1 B;  5DXB A;  1M7W A;  4POH A;  1PRG A;  5KR9 A;  2G44 A;  1NDE A;  2ZK3 A;  2B1Z A;  5KRH A;  5KRM A;  4IVW A;  1I37 A;  3BC5 A;  3R8I A;  1ERE A;  3ET3 A;  4PF3 A;  3W0Y A;  3P88 A;  3ET2 A;  1UOM A;  1YOW A;  1K7L A;  3DZY A;  3D57 A;  3DT3 A;  5DKB A;  3B0Q A;  1Z5X U;  5CJ6 A;  3VSP A;  1T5Z A;  4OED A;  1T63 A;  2QH6 A;  3A2I A;  3B65 A;  3F5C B;  2F4B A;  4Q50 A;  1T79 A;  2YJD A;  4OEA A;  4G2I A;  4ZJW A;  3WGP A;  2VST A;  3OLF A;  3KWY A;  2AA6 A;  5DZ3 A;  3OGT A;  3X36 A;  3U9Q A;  5G42 A;  2V0V A;  4IQR A;  3AUQ A;  4MG8 A;  1ZDT A;  4DQM A;  2PIO A;  5ACC A;  1U3S A;  3FS1 A;  2HB7 A;  5E0X A;  3VT9 A;  1A28 A;  5C4T A;  3G8I A;  3W5Q A;  1U3Q A;  2ZK2 A;  2AAX A;  3CDP A;  4RAK A;  2YFE A;  3K23 A;  3D5F A;  1NUO A;  2Q59 A;  4S0S A;  3ET0 A;  5DZ1 A;  3MNO A;  5EGV A;  4APU A;  1X7E A;  2O4J A;  2B23 A;  2ZXZ A;  4FGY A;  4S0T A;  5DKE A;  5GT4 A;  4MGC A;  5IZ0 A;  3X31 A;  1YIN A;  2QZO B;  5DX3 A;  5FQV A;  4IV2 A;  1G5Y A;  4XLD A;  3VTB A;  3KDU A;  3X1H A;  5DXP A;  1PCG A;  3WWR A;  4PPS A;  5AYG A;  2BJ4 A;  3AZ1 A;  1A52 A;  2NPA A;  2OCF A;  2Q5S A;  3HZF A;  5SYZ A;  1IE9 A;  5AWK A;  4FHI A;  5G5W A;  2PIU A;  1LBD A;  1PK5 A;  3VSO A;  4NB6 A;  3HC5 A;  1UHL A;  2NW4 A;  2OAX A;  2P15 A;  5AZV A;  5KCT A;  1SKX A;  2JJ3 A;  4QK4 A;  4WHF A;  5DMC A;  1RJK A;  1G2N A;  4G21 A;  2HCD A;  3V4A A;  5DWI A;  5DI7 A;  1YUC A;  2ZXM A;  2Q7I A;  3AZ2 A;  2AYR A;  3CTB A;  4JYG A;  1R20 A;  4PP6 A;  3VN2 A;  1KNU A;  1FCY A;  1XV9 A;  2AX8 A;  4QE8 A;  3OS8 C;  1ZDU A;  4NUF A;  3B5R A;  3K8S A;  3CWD A;  2W8Y A;  3PO9 A;  5DRM A;  5DUE A;  5DYB A;  4RME A;  2QGT A;  5C4U A;  5DZI A;  5G44 A;  3ERD A;  1XVP B;  1XDK A;  3L3Z A;  3K6P A;  5KCD A;  5AAV A;  4IW6 A;  3Q95 B;  3VRU A;  2V7C A;  4KZJ A;  4X1F A;  4MG6 A;  3FLI A;  4IA2 A;  3W0H A;  5E19 A;  3ADW A;  4JL4 A;  3ILZ A;  3ADV A;  4LNX A;  4DM6 A;  5DUG A;  3VT5 A;  4FNE A;  2I0J A;  2Q7L A;  2HWQ A;  1LV2 A;  5E1C A;  3PRG A;  3OMQ A;  1FM9 D;  4IA3 A;  1OSV A;  3AUR A;  2GPP A;  3UUA A;  2XYW A;  5KRC A;  4N1Y A;  1QKU A;  1S0X A;  5HCV A;  4R2U A;  2Q6S A;  2AX7 A;  1FD0 A;  1T73 A;  5APJ A;  1NYX A;  3P89 A;  4JYI A;  2G0G A;  3KMR A;  1SR7 A;  1WM0 X;  4ZN9 A;  3W5R A;  2AM9 A;  1XQ3 A;  3OZJ A;  4NY9 A;  2ZFX A;  1NQ2 A;  5KCF A;  5C4S A;  1R1K A;  3V49 A;  5L11 A;  5AVI A;  5B41 A;  1GWR A;  2ZLC A;  1S9P A;  2AXA A;  1DKF A;  3L3X A;  4TUZ B;  2GPV A;  4WQP A;  1GS4 A;  5DP0 A;  5APH A;  5EIT A;  1OVL A;  2QMV A;  4RZF A;  2ZK0 A;  4A4W A;  4DK8 A;  1EXA A;  4LBD A;  4X1G A;  4O8F A;  4OGH A;  1ILG A;  4ZOM A;  3ADU A;  3G0W A;  1I38 A;  3VJT A;  3HLV A;  2E2R A;  1R6G A;  2VV3 A;  1M13 A;  1N83 A;  4TV1 B;  1YIM A; 
#chains in the Genus database with same CATH topology
 2Q3Y A;  3MNE A;  1YA3 A;  3FEI A;  2G5O A;  3WT6 A;  5HJP A;  1XP6 A;  3N00 A;  5AAU A;  3LMP A;  3W5T A;  1S19 A;  4JGV A;  2J14 A;  2REW A;  2J4A A;  5DXK A;  3VI8 A;  1XB7 A;  2GWX A;  4OZR E;  5KRO A;  1XOW A;  3E7C A;  1PDU A;  5DU5 A;  4K4J A;  4REF A;  3ADS A;  5DWG A;  4YPQ A;  1ERR A;  3DZU D;  1U9E A;  3MNP A;  1YY4 A;  4POJ A;  2YJA B;  4G1D A;  3FEJ A;  5GIE A;  2QZO A;  5L7H A;  2ACL B;  5G45 A;  2VV4 B;  3B0R A;  5APK A;  1I7I A;  4EM9 A;  2Q5G A;  5KRI A;  2Q1V A;  3FAL A;  3OMM A;  3FC6 B;  1K74 D;  1KV6 A;  1YJE A;  4OH6 A;  3JZC A;  4OIL A;  4OZR U;  4MGA A;  2PIX A;  4QL8 A;  3VHW A;  3M7R A;  3WT5 A;  4RMD A;  1MZN A;  3G9E A;  4R6S A;  3B67 A;  1T74 A;  3GWX A;  4N73 A;  3HC6 A;  2Q61 A;  3CS4 A;  2QA6 A;  2P1U A;  4WLB A;  1NQ7 A;  5DTV A;  3OAP A;  5JJM A;  3CLD A;  3DZY D;  3KDT A;  3UP3 A;  2ZNN A;  2ZK1 A;  3VT3 A;  4XTA A;  1ZH7 A;  2ZVT A;  3TY0 A;  4OKW A;  4PVU A;  4XAO A;  4ONI A;  2XHS A;  4OHA A;  3E00 A;  4JAZ A;  3IXP A;  1XNX A;  5DLR A;  4M8H A;  2Q6J A;  5FQS A;  3V9Y A;  4E4K A;  1XQC A;  1SJ0 A;  3NSP A;  1PZL A;  4ZNS A;  5EI1 A;  4RE8 A;  2QXM A;  5FQR A;  1G50 A;  3GBK A;  3AN4 A;  3HM1 A;  3UVV A;  3SP6 A;  3F7D A;  1ZAF A;  2Z4J A;  3HVL A;  3OOK A;  2VSR A;  2JFA A;  2VV0 A;  1NRL A;  2OUZ A;  3HQ5 A;  4PP3 A;  4YNK A;  4RZG A;  3A3Z X;  3GYU A;  3VHV A;  1DB1 A;  4YMQ A;  4QJR A;  3A9E A;  5DXM A;  1Q4X A;  2ATH A;  3ZQT A;  3R8A A;  2PNU A;  1N46 A;  4PXM A;  1ZUC A;  2PJL A;  3WJ4 A;  3TKM A;  5DXG A;  5DID A;  4S14 A;  1RK3 A;  4DMA A;  3L0J A;  3VJH A;  4ZJR A;  3EYB A;  3P0U A;  3H52 A;  3OMP A;  2PIQ A;  4MG9 B;  3TKC A;  2QAB A;  3ZRB A;  2R6Y A;  2AA5 A;  4FN9 A;  4MG7 A;  1T7F A;  1XP9 A;  4L98 A;  4DOR A;  2P4Y A;  2QXS A;  5DXB B;  2AO6 A;  2FVJ A;  5G46 A;  2VV1 A;  2HAR A;  2YLO A;  2P54 A;  5DVV A;  5ICK A;  4ZNU A;  1S0Z A;  1YOK A;  5LWP A;  4RZE A;  5KRJ A;  2I4J A;  4MGB A;  2AX6 A;  4UDC A;  1K4W A;  2P1V A;  4PRG A;  4QM0 A;  2XKW A;  3WFG A;  5I4V A;  2OZ7 A;  3IPS A;  4XHD A;  5DSH A;  5JI0 D;  2LBD A;  5DKS A;  2QR9 A;  3OS8 A;  3V3E A;  2ZAS A;  3VT6 A;  1GWQ A;  4OIU A;  5DIE A;  4S15 A;  1XAP A;  2I4Z A;  2H79 A;  2POB A;  4MGD A;  5KYJ A;  1R20 D;  3IA6 A;  5DZH A;  3UP0 A;  1H9U A;  2GIU A;  1FBY A;  3IMY A;  5DUH A;  3OLS A;  3E94 A;  2ZMI A;  3AFR A;  4J26 A;  4MG8 B;  3DCT A;  3A2J A;  4IVY A;  2VV2 A;  2QA8 A;  1TXI A;  3A2H A;  3KFC A;  5DYD A;  2J7X A;  2QGW A;  4M8E A;  3RUT A;  3V9T A;  4YT1 A;  4ZN7 A;  1QKN A;  4K7A A;  2AMA A;  1T76 A;  4EMA A;  3VRV A;  4ZO1 X;  2ZK5 A;  4OFU A;  5KCW A;  2PKL A;  4OIV A;  4IWC A;  2Q59 B;  3OMO A;  3R29 A;  4IA1 A;  4CI4 A;  2GP7 A;  2PIP L;  3PEQ A;  3UU7 A;  1S9Q A;  3W0I A;  1XLS A;  4KZI A;  3ZRA A;  4CSJ A;  1MVC A;  2YLY A;  5KRF A;  2ZY0 A;  5DX3 B;  5EHJ A;  3W0J A;  2Q1H A;  4N5G A;  4OZT E;  3VRW A;  1UPV A;  2YLP A;  5AK2 A;  1KKQ A;  2BJ4 B;  1XP1 A;  2IHQ A;  2POG A;  2Q70 A;  1QKM A;  2OM9 A;  2XYX A;  2ZMH A;  3AUN A;  4J24 A;  4LTW A;  4PLD A;  3RY9 A;  3OOF A;  3PBA A;  3W0C A;  5KD9 A;  4ZNW A;  5A86 A;  1UHL B;  1XJ7 A;  2JF9 A;  2G0H A;  3GN8 A;  1NQ0 A;  3DY6 A;  1NHZ A;  4OKX A;  5DXE A;  3ET1 A;  5DV8 A;  3F5C A;  5DY8 A;  4A2J A;  3FUR A;  1R1K D;  3IPQ A;  3UUC A;  2R40 A;  3PCU A;  4UDB A;  3HO0 A;  4OZT U;  2ZLA A;  5DL4 A;  3SZ1 A;  1PQC A;  4RUJ A;  2AX9 A;  5DK9 A;  1XV9 B;  4Q13 A;  5LGA A;  4G1Z A;  3UUD B;  3FUG A;  3B0T A;  3D90 A;  2HC4 A;  4NIE A;  1OT7 A;  1SQN A;  2NXX A;  4E4Q A;  1HG4 A;  4JYH A;  5DWE A;  3VRT A;  4WPF A;  5E7V A;  4MG5 A;  2R40 D;  1Y9R A;  1XDK B;  2ZKC A;  4DOS A;  2ABI A;  1RKG A;  2PIW A;  1FCZ A;  3BQD A;  5DV6 A;  3VT8 A;  3R5M A;  1BSX A;  2I4P A;  4REE A;  5DMF A;  3RLL A;  1VJB A;  5L7G A;  1MV9 A;  4A4V A;  5M96 A;  3IPU A;  5AWJ A;  5DV3 A;  2B1V A;  2AA2 A;  4OJB A;  3KMZ A;  3LBD A;  4RMC A;  2PIT A;  1T7R A;  2AWH A;  2GL8 A;  2XYJ A;  4PP5 A;  5E15 A;  5G3J A;  1L2I A;  2GPU A;  3UUA B;  1X7J A;  1EXX A;  4XI3 A;  3AN3 A;  5FQP A;  3OS9 A;  4BCR A;  1FM6 A;  4RFW A;  4NQA B;  4MDD A;  4CI5 A;  2HWR A;  2HAS A;  3WTQ A;  3K22 A;  4KZM A;  4OH5 A;  1OSH A;  1QKT A;  3HOD A;  2ZK4 A;  4DK7 A;  3VT4 A;  3KMG A;  4OFR A;  5HJS A;  4PPP A;  4WHG A;  3V3Q A;  5KRK A;  2GTK A;  1G1U A;  1GWX A;  3D24 A;  5HZC A;  1XIU A;  3L0E A;  4PWL A;  5GID A;  3VJI A;  2QW4 A;  1X7B A;  1PQ9 A;  5DVC A;  1DKF B;  3VT7 A;  4B7W A;  2ZMJ A;  5AAV B;  3S9S A;  3GYT A;  1OVL B;  1FM6 D;  4IS8 A;  4OKT A;  2NXX E;  3QT0 A;  5KRL A;  2ZNP A;  1Z95 A;  4RWV A;  3AZ3 A;  5DZ0 A;  1T7T A;  2PRG A;  3PLZ A;  1X78 A;  4OC7 A;  1XVP A;  4ZNV A;  3VJS A;  3OSA A;  5H1E A;  2OVH A;  3L1B A;  3Q95 A;  4ZI1 A;  2P1T A;  2AMB A;  3L0L A;  3O1D A;  5ETH A;  3E00 D;  1N4H A;  2IOG A;  3IXP D;  4K6I A;  2PIR A;  5F9B A;  1X7R A;  3B0W A;  5HJP B;  3G8O A;  3W0A A;  3P8X A;  3GD2 A;  3VHU A;  3GZ9 A;  2HAM A;  3WJ5 A;  2Q6R A;  2J7Y A;  5DXQ A;  5E0W A;  1T7M A;  3D6D A;  5FQT A;  3W5P A;  1E3G A;  2P7G A;  2HFP A;  1I7G A;  2QSE A;  4P6X A;  4XT9 A;  2Q60 A;  4IU7 A;  5DIG A;  5KCC A;  1E3K A;  4QE6 A;  5KCU A;  1NAX A;  3AX8 A;  3OKI A;  3ADT A;  2YAT A;  3T03 A;  3DCU A;  1XPC A;  3FAL B;  3NOA A;  3NSQ A;  2I0G A;  2HBH A;  1L2J A;  3OMK A;  4TUZ A;  4DM8 A;  2B50 A;  4HLW A;  4R06 A;  2FAI A;  4IW8 A;  4MGA B;  2PIN A;  2EWP A;  4G1Y A;  4OK1 A;  4OEY A;  2HVC A;  2R6W A;  3CDS A;  4RUP A;  3GWS X;  5E14 A;  3L03 A;  4TV1 A;  1Y0X X;  4J5W C;  4XUM A;  2BAW A;  3UUD A;  4G20 A;  5JJM B;  4HEE X;  1IE8 A;  3FXV A;  4OLM A;  2ZNO A;  3CJW A;  4P6W A;  4J5W A;  2PIV A;  1ILH A;  4UDA A;  3V9V A;  5AZT A;  3B3K A;  2ZXN A;  1YYE A;  5KCE A;  1R5K A;  3ERT A;  4N8R A;  1ZEO A;  5DKG A;  4IWF A;  3UVV B;  1ZGY A;  2ZK6 A;  1RDT A;  1YP0 A;  3CS8 A;  4IV4 A;  4OJ4 A;  1FM9 A;  4ZNH A;  3BEJ A;  2JFA B;  1T65 A;  3A40 X;  3KPZ A;  4LSJ A;  3VTD A;  3ADX A;  1P8D A;  2P7Z A;  4OJ9 A;  2H77 A;  3A9E B;  4OAR A;  5KRA A;  1PQ6 A;  3WFF A;  5GIC A;  2YLQ A;  2ACL A;  2HB8 A;  2Z4B A;  3R5N A;  2Q8S A;  4IA7 A;  2VV4 A;  4IUI A;  4ITE A;  5G43 A;  1FCX A;  5K13 A;  3CQV A;  1X76 A;  3OZ0 A;  5C4O A;  3VTC A;  2O4R A;  5L7E A;  2P7A A;  3FC6 A;  1NAV A;  3H0A A;  5B5B A;  1RDT D;  3JZB A;  1P93 A;  2GPO A;  3B68 A;  3O1E A;  5EJV A;  5IXK A;  1UPW A;  4XUH A;  2IOK A;  4F9M A;  2ZBS A;  4MG7 B;  3CS6 A;  5HYK A;  5DWJ A;  3KBA A;  5JY3 A;  4Y29 A;  3OKH A;  2Q7K A;  2VV1 B;  4RUO X;  4WVD A;  1HJ1 A;  5DRJ A;  4ZNT A;  3OSW A;  1YMT A;  4UDD A;  3H0A D;  4MGB B;  3WMH A;  5DVS A;  3TX7 B;  1XNN A;  2QNV A;  5DXR A;  3OLL A;  1M2Z A;  2Q7J A;  1U3R A;  4OKB A;  4J5X C;  2QE4 A;  2AA7 A;  3OSI A;  4Q0A C;  2QPY A;  3W0G A;  3R8D A;  2ZL9 A;  3SP9 A;  4J5X A;  1NQ1 A;  1TFC A;  5IAW A;  1XLS E;  4MGD B;  5EC9 A;  3ZR7 A;  2FSZ A;  2A3I A;  4ITF A;  4LNW A;  5KYA A;  3B66 A;  4E2J A;  2O9I A;  1RKH A;  3DZU A;  3RVF A;  3DR1 A;  4L96 A;  3X1I A;  2QA8 B;  2QTU A;  4FHH A;  4G2H A;  2OVM A;  4PLE A;  2NV7 A;  3WT7 A;  2Q5P A;  3KYT A;  1ZKY A;  1Y0S A;  3B1M A;  3RUU A;  4MG9 A;  5AVL A;  1Z5X E;  1K74 A;  2AB2 A;  5DWL A;  4OEZ A;  2ZNQ A;  3A78 A;  3R2A A;  1XZX X;  3UU7 B;  5HYR A;  2YHD A;  3RLJ A;  4ZO1 B;  5DXB A;  1M7W A;  4POH A;  1PRG A;  5KR9 A;  2G44 A;  1NDE A;  2ZK3 A;  2B1Z A;  5KRH A;  5KRM A;  4IVW A;  1I37 A;  3BC5 A;  3R8I A;  1ERE A;  3ET3 A;  4PF3 A;  3W0Y A;  3P88 A;  3ET2 A;  1UOM A;  1YOW A;  1K7L A;  3DZY A;  3D57 A;  3DT3 A;  5DKB A;  3B0Q A;  1Z5X U;  5CJ6 A;  3VSP A;  1T5Z A;  4OED A;  1T63 A;  2QH6 A;  3A2I A;  3B65 A;  3F5C B;  2F4B A;  4Q50 A;  1T79 A;  2YJD A;  4OEA A;  4G2I A;  4ZJW A;  3WGP A;  2VST A;  3OLF A;  3KWY A;  2AA6 A;  5DZ3 A;  3OGT A;  3X36 A;  3U9Q A;  5G42 A;  2V0V A;  4IQR A;  3AUQ A;  4MG8 A;  1ZDT A;  4DQM A;  2PIO A;  5ACC A;  1U3S A;  3FS1 A;  2HB7 A;  5E0X A;  3VT9 A;  1A28 A;  5C4T A;  3G8I A;  3W5Q A;  1U3Q A;  2ZK2 A;  2AAX A;  3CDP A;  4RAK A;  2YFE A;  3K23 A;  3D5F A;  1NUO A;  2Q59 A;  4S0S A;  3ET0 A;  5DZ1 A;  3MNO A;  5EGV A;  4APU A;  1X7E A;  2O4J A;  2B23 A;  2ZXZ A;  4FGY A;  4S0T A;  5DKE A;  5GT4 A;  4MGC A;  5IZ0 A;  3X31 A;  1YIN A;  2QZO B;  5DX3 A;  5FQV A;  4IV2 A;  1G5Y A;  4XLD A;  3VTB A;  3KDU A;  3X1H A;  5DXP A;  1PCG A;  3WWR A;  4PPS A;  5AYG A;  2BJ4 A;  3AZ1 A;  1A52 A;  2NPA A;  2OCF A;  2Q5S A;  3HZF A;  5SYZ A;  1IE9 A;  5AWK A;  4FHI A;  5G5W A;  2PIU A;  1LBD A;  1PK5 A;  3VSO A;  4NB6 A;  3HC5 A;  1UHL A;  2NW4 A;  2OAX A;  2P15 A;  5AZV A;  5KCT A;  1SKX A;  2JJ3 A;  4QK4 A;  4WHF A;  5DMC A;  1RJK A;  1G2N A;  4G21 A;  2HCD A;  3V4A A;  5DWI A;  5DI7 A;  1YUC A;  2ZXM A;  2Q7I A;  3AZ2 A;  2AYR A;  3CTB A;  4JYG A;  1R20 A;  4PP6 A;  3VN2 A;  1KNU A;  1FCY A;  1XV9 A;  2AX8 A;  4QE8 A;  3OS8 C;  1ZDU A;  4NUF A;  3B5R A;  3K8S A;  3CWD A;  2W8Y A;  3PO9 A;  5DRM A;  5DUE A;  5DYB A;  4RME A;  2QGT A;  5C4U A;  5DZI A;  5G44 A;  3ERD A;  1XVP B;  1XDK A;  3L3Z A;  3K6P A;  5KCD A;  5AAV A;  4IW6 A;  3Q95 B;  3VRU A;  2V7C A;  4KZJ A;  4X1F A;  4MG6 A;  3FLI A;  4IA2 A;  3W0H A;  5E19 A;  3ADW A;  4JL4 A;  3ILZ A;  3ADV A;  4LNX A;  4DM6 A;  5DUG A;  3VT5 A;  4FNE A;  2I0J A;  2Q7L A;  2HWQ A;  1LV2 A;  5E1C A;  3PRG A;  3OMQ A;  1FM9 D;  4IA3 A;  1OSV A;  3AUR A;  2GPP A;  3UUA A;  2XYW A;  5KRC A;  4N1Y A;  1QKU A;  1S0X A;  5HCV A;  4R2U A;  2Q6S A;  2AX7 A;  1FD0 A;  1T73 A;  5APJ A;  1NYX A;  3P89 A;  4JYI A;  2G0G A;  3KMR A;  1SR7 A;  1WM0 X;  4ZN9 A;  3W5R A;  2AM9 A;  1XQ3 A;  3OZJ A;  4NY9 A;  2ZFX A;  1NQ2 A;  5KCF A;  5C4S A;  1R1K A;  3V49 A;  5L11 A;  5AVI A;  5B41 A;  1GWR A;  2ZLC A;  1S9P A;  2AXA A;  1DKF A;  3L3X A;  4TUZ B;  2GPV A;  4WQP A;  1GS4 A;  5DP0 A;  5APH A;  5EIT A;  1OVL A;  2QMV A;  4RZF A;  2ZK0 A;  4A4W A;  4DK8 A;  1EXA A;  4LBD A;  4X1G A;  4O8F A;  4OGH A;  1ILG A;  4ZOM A;  3ADU A;  3G0W A;  1I38 A;  3VJT A;  3HLV A;  2E2R A;  1R6G A;  2VV3 A;  1M13 A;  1N83 A;  4TV1 B;  1YIM A; 
#chains in the Genus database with same CATH homology
 2Q3Y A;  3MNE A;  1YA3 A;  3FEI A;  2G5O A;  3WT6 A;  5HJP A;  1XP6 A;  3N00 A;  5AAU A;  3LMP A;  3W5T A;  1S19 A;  4JGV A;  2J14 A;  2REW A;  2J4A A;  5DXK A;  3VI8 A;  1XB7 A;  2GWX A;  4OZR E;  5KRO A;  1XOW A;  3E7C A;  1PDU A;  5DU5 A;  4K4J A;  4REF A;  3ADS A;  5DWG A;  4YPQ A;  1ERR A;  3DZU D;  1U9E A;  3MNP A;  1YY4 A;  4POJ A;  2YJA B;  4G1D A;  3FEJ A;  5GIE A;  2QZO A;  5L7H A;  2ACL B;  5G45 A;  2VV4 B;  3B0R A;  5APK A;  1I7I A;  4EM9 A;  2Q5G A;  5KRI A;  2Q1V A;  3FAL A;  3OMM A;  3FC6 B;  1K74 D;  1KV6 A;  1YJE A;  4OH6 A;  3JZC A;  4OIL A;  4OZR U;  4MGA A;  2PIX A;  4QL8 A;  3VHW A;  3M7R A;  3WT5 A;  4RMD A;  1MZN A;  3G9E A;  4R6S A;  3B67 A;  1T74 A;  3GWX A;  4N73 A;  3HC6 A;  2Q61 A;  3CS4 A;  2QA6 A;  2P1U A;  4WLB A;  1NQ7 A;  5DTV A;  3OAP A;  5JJM A;  3CLD A;  3DZY D;  3KDT A;  3UP3 A;  2ZNN A;  2ZK1 A;  3VT3 A;  4XTA A;  1ZH7 A;  2ZVT A;  3TY0 A;  4OKW A;  4PVU A;  4XAO A;  4ONI A;  2XHS A;  4OHA A;  3E00 A;  4JAZ A;  3IXP A;  1XNX A;  5DLR A;  4M8H A;  2Q6J A;  5FQS A;  3V9Y A;  4E4K A;  1XQC A;  1SJ0 A;  3NSP A;  1PZL A;  4ZNS A;  5EI1 A;  4RE8 A;  2QXM A;  5FQR A;  1G50 A;  3GBK A;  3AN4 A;  3HM1 A;  3UVV A;  3SP6 A;  3F7D A;  1ZAF A;  2Z4J A;  3HVL A;  3OOK A;  2VSR A;  2JFA A;  2VV0 A;  1NRL A;  2OUZ A;  3HQ5 A;  4PP3 A;  4YNK A;  4RZG A;  3A3Z X;  3GYU A;  3VHV A;  1DB1 A;  4YMQ A;  4QJR A;  3A9E A;  5DXM A;  1Q4X A;  2ATH A;  3ZQT A;  3R8A A;  2PNU A;  1N46 A;  4PXM A;  1ZUC A;  2PJL A;  3WJ4 A;  3TKM A;  5DXG A;  5DID A;  4S14 A;  1RK3 A;  4DMA A;  3L0J A;  3VJH A;  4ZJR A;  3EYB A;  3P0U A;  3H52 A;  3OMP A;  2PIQ A;  4MG9 B;  3TKC A;  2QAB A;  3ZRB A;  2R6Y A;  2AA5 A;  4FN9 A;  4MG7 A;  1T7F A;  1XP9 A;  4L98 A;  4DOR A;  2P4Y A;  2QXS A;  5DXB B;  2AO6 A;  2FVJ A;  5G46 A;  2VV1 A;  2HAR A;  2YLO A;  2P54 A;  5DVV A;  5ICK A;  4ZNU A;  1S0Z A;  1YOK A;  5LWP A;  4RZE A;  5KRJ A;  2I4J A;  4MGB A;  2AX6 A;  4UDC A;  1K4W A;  2P1V A;  4PRG A;  4QM0 A;  2XKW A;  3WFG A;  5I4V A;  2OZ7 A;  3IPS A;  4XHD A;  5DSH A;  5JI0 D;  2LBD A;  5DKS A;  2QR9 A;  3OS8 A;  3V3E A;  2ZAS A;  3VT6 A;  1GWQ A;  4OIU A;  5DIE A;  4S15 A;  1XAP A;  2I4Z A;  2H79 A;  2POB A;  4MGD A;  5KYJ A;  1R20 D;  3IA6 A;  5DZH A;  3UP0 A;  1H9U A;  2GIU A;  1FBY A;  3IMY A;  5DUH A;  3OLS A;  3E94 A;  2ZMI A;  3AFR A;  4J26 A;  4MG8 B;  3DCT A;  3A2J A;  4IVY A;  2VV2 A;  2QA8 A;  1TXI A;  3A2H A;  3KFC A;  5DYD A;  2J7X A;  2QGW A;  4M8E A;  3RUT A;  3V9T A;  4YT1 A;  4ZN7 A;  1QKN A;  4K7A A;  2AMA A;  1T76 A;  4EMA A;  3VRV A;  4ZO1 X;  2ZK5 A;  4OFU A;  5KCW A;  2PKL A;  4OIV A;  4IWC A;  2Q59 B;  3OMO A;  3R29 A;  4IA1 A;  4CI4 A;  2GP7 A;  2PIP L;  3PEQ A;  3UU7 A;  1S9Q A;  3W0I A;  1XLS A;  4KZI A;  3ZRA A;  4CSJ A;  1MVC A;  2YLY A;  5KRF A;  2ZY0 A;  5DX3 B;  5EHJ A;  3W0J A;  2Q1H A;  4N5G A;  4OZT E;  3VRW A;  1UPV A;  2YLP A;  5AK2 A;  1KKQ A;  2BJ4 B;  1XP1 A;  2IHQ A;  2POG A;  2Q70 A;  1QKM A;  2OM9 A;  2XYX A;  2ZMH A;  3AUN A;  4J24 A;  4LTW A;  4PLD A;  3RY9 A;  3OOF A;  3PBA A;  3W0C A;  5KD9 A;  4ZNW A;  5A86 A;  1UHL B;  1XJ7 A;  2JF9 A;  2G0H A;  3GN8 A;  1NQ0 A;  3DY6 A;  1NHZ A;  4OKX A;  5DXE A;  3ET1 A;  5DV8 A;  3F5C A;  5DY8 A;  4A2J A;  3FUR A;  1R1K D;  3IPQ A;  3UUC A;  2R40 A;  3PCU A;  4UDB A;  3HO0 A;  4OZT U;  2ZLA A;  5DL4 A;  3SZ1 A;  1PQC A;  4RUJ A;  2AX9 A;  5DK9 A;  1XV9 B;  4Q13 A;  5LGA A;  4G1Z A;  3UUD B;  3FUG A;  3B0T A;  3D90 A;  2HC4 A;  4NIE A;  1OT7 A;  1SQN A;  2NXX A;  4E4Q A;  1HG4 A;  4JYH A;  5DWE A;  3VRT A;  4WPF A;  5E7V A;  4MG5 A;  2R40 D;  1Y9R A;  1XDK B;  2ZKC A;  4DOS A;  2ABI A;  1RKG A;  2PIW A;  1FCZ A;  3BQD A;  5DV6 A;  3VT8 A;  3R5M A;  1BSX A;  2I4P A;  4REE A;  5DMF A;  3RLL A;  1VJB A;  5L7G A;  1MV9 A;  4A4V A;  5M96 A;  3IPU A;  5AWJ A;  5DV3 A;  2B1V A;  2AA2 A;  4OJB A;  3KMZ A;  3LBD A;  4RMC A;  2PIT A;  1T7R A;  2AWH A;  2GL8 A;  2XYJ A;  4PP5 A;  5E15 A;  5G3J A;  1L2I A;  2GPU A;  3UUA B;  1X7J A;  1EXX A;  4XI3 A;  3AN3 A;  5FQP A;  3OS9 A;  4BCR A;  1FM6 A;  4RFW A;  4NQA B;  4MDD A;  4CI5 A;  2HWR A;  2HAS A;  3WTQ A;  3K22 A;  4KZM A;  4OH5 A;  1OSH A;  1QKT A;  3HOD A;  2ZK4 A;  4DK7 A;  3VT4 A;  3KMG A;  4OFR A;  5HJS A;  4PPP A;  4WHG A;  3V3Q A;  5KRK A;  2GTK A;  1G1U A;  1GWX A;  3D24 A;  5HZC A;  1XIU A;  3L0E A;  4PWL A;  5GID A;  3VJI A;  2QW4 A;  1X7B A;  1PQ9 A;  5DVC A;  1DKF B;  3VT7 A;  4B7W A;  2ZMJ A;  5AAV B;  3S9S A;  3GYT A;  1OVL B;  1FM6 D;  4IS8 A;  4OKT A;  2NXX E;  3QT0 A;  5KRL A;  2ZNP A;  1Z95 A;  4RWV A;  3AZ3 A;  5DZ0 A;  1T7T A;  2PRG A;  3PLZ A;  1X78 A;  4OC7 A;  1XVP A;  4ZNV A;  3VJS A;  3OSA A;  5H1E A;  2OVH A;  3L1B A;  3Q95 A;  4ZI1 A;  2P1T A;  2AMB A;  3L0L A;  3O1D A;  5ETH A;  3E00 D;  1N4H A;  2IOG A;  3IXP D;  4K6I A;  2PIR A;  5F9B A;  1X7R A;  3B0W A;  5HJP B;  3G8O A;  3W0A A;  3P8X A;  3GD2 A;  3VHU A;  3GZ9 A;  2HAM A;  3WJ5 A;  2Q6R A;  2J7Y A;  5DXQ A;  5E0W A;  1T7M A;  3D6D A;  5FQT A;  3W5P A;  1E3G A;  2P7G A;  2HFP A;  1I7G A;  2QSE A;  4P6X A;  4XT9 A;  2Q60 A;  4IU7 A;  5DIG A;  5KCC A;  1E3K A;  4QE6 A;  5KCU A;  1NAX A;  3AX8 A;  3OKI A;  3ADT A;  2YAT A;  3T03 A;  3DCU A;  1XPC A;  3FAL B;  3NOA A;  3NSQ A;  2I0G A;  2HBH A;  1L2J A;  3OMK A;  4TUZ A;  4DM8 A;  2B50 A;  4HLW A;  4R06 A;  2FAI A;  4IW8 A;  4MGA B;  2PIN A;  2EWP A;  4G1Y A;  4OK1 A;  4OEY A;  2HVC A;  2R6W A;  3CDS A;  4RUP A;  3GWS X;  5E14 A;  3L03 A;  4TV1 A;  1Y0X X;  4J5W C;  4XUM A;  2BAW A;  3UUD A;  4G20 A;  5JJM B;  4HEE X;  1IE8 A;  3FXV A;  4OLM A;  2ZNO A;  3CJW A;  4P6W A;  4J5W A;  2PIV A;  1ILH A;  4UDA A;  3V9V A;  5AZT A;  3B3K A;  2ZXN A;  1YYE A;  5KCE A;  1R5K A;  3ERT A;  4N8R A;  1ZEO A;  5DKG A;  4IWF A;  3UVV B;  1ZGY A;  2ZK6 A;  1RDT A;  1YP0 A;  3CS8 A;  4IV4 A;  4OJ4 A;  1FM9 A;  4ZNH A;  3BEJ A;  2JFA B;  1T65 A;  3A40 X;  3KPZ A;  4LSJ A;  3VTD A;  3ADX A;  1P8D A;  2P7Z A;  4OJ9 A;  2H77 A;  3A9E B;  4OAR A;  5KRA A;  1PQ6 A;  3WFF A;  5GIC A;  2YLQ A;  2ACL A;  2HB8 A;  2Z4B A;  3R5N A;  2Q8S A;  4IA7 A;  2VV4 A;  4IUI A;  4ITE A;  5G43 A;  1FCX A;  5K13 A;  3CQV A;  1X76 A;  3OZ0 A;  5C4O A;  3VTC A;  2O4R A;  5L7E A;  2P7A A;  3FC6 A;  1NAV A;  3H0A A;  5B5B A;  1RDT D;  3JZB A;  1P93 A;  2GPO A;  3B68 A;  3O1E A;  5EJV A;  5IXK A;  1UPW A;  4XUH A;  2IOK A;  4F9M A;  2ZBS A;  4MG7 B;  3CS6 A;  5HYK A;  5DWJ A;  3KBA A;  5JY3 A;  4Y29 A;  3OKH A;  2Q7K A;  2VV1 B;  4RUO X;  4WVD A;  1HJ1 A;  5DRJ A;  4ZNT A;  3OSW A;  1YMT A;  4UDD A;  3H0A D;  4MGB B;  3WMH A;  5DVS A;  3TX7 B;  1XNN A;  2QNV A;  5DXR A;  3OLL A;  1M2Z A;  2Q7J A;  1U3R A;  4OKB A;  4J5X C;  2QE4 A;  2AA7 A;  3OSI A;  4Q0A C;  2QPY A;  3W0G A;  3R8D A;  2ZL9 A;  3SP9 A;  4J5X A;  1NQ1 A;  1TFC A;  5IAW A;  1XLS E;  4MGD B;  5EC9 A;  3ZR7 A;  2FSZ A;  2A3I A;  4ITF A;  4LNW A;  5KYA A;  3B66 A;  4E2J A;  2O9I A;  1RKH A;  3DZU A;  3RVF A;  3DR1 A;  4L96 A;  3X1I A;  2QA8 B;  2QTU A;  4FHH A;  4G2H A;  2OVM A;  4PLE A;  2NV7 A;  3WT7 A;  2Q5P A;  3KYT A;  1ZKY A;  1Y0S A;  3B1M A;  3RUU A;  4MG9 A;  5AVL A;  1Z5X E;  1K74 A;  2AB2 A;  5DWL A;  4OEZ A;  2ZNQ A;  3A78 A;  3R2A A;  1XZX X;  3UU7 B;  5HYR A;  2YHD A;  3RLJ A;  4ZO1 B;  5DXB A;  1M7W A;  4POH A;  1PRG A;  5KR9 A;  2G44 A;  1NDE A;  2ZK3 A;  2B1Z A;  5KRH A;  5KRM A;  4IVW A;  1I37 A;  3BC5 A;  3R8I A;  1ERE A;  3ET3 A;  4PF3 A;  3W0Y A;  3P88 A;  3ET2 A;  1UOM A;  1YOW A;  1K7L A;  3DZY A;  3D57 A;  3DT3 A;  5DKB A;  3B0Q A;  1Z5X U;  5CJ6 A;  3VSP A;  1T5Z A;  4OED A;  1T63 A;  2QH6 A;  3A2I A;  3B65 A;  3F5C B;  2F4B A;  4Q50 A;  1T79 A;  2YJD A;  4OEA A;  4G2I A;  4ZJW A;  3WGP A;  2VST A;  3OLF A;  3KWY A;  2AA6 A;  5DZ3 A;  3OGT A;  3X36 A;  3U9Q A;  5G42 A;  2V0V A;  4IQR A;  3AUQ A;  4MG8 A;  1ZDT A;  4DQM A;  2PIO A;  5ACC A;  1U3S A;  3FS1 A;  2HB7 A;  5E0X A;  3VT9 A;  1A28 A;  5C4T A;  3G8I A;  3W5Q A;  1U3Q A;  2ZK2 A;  2AAX A;  3CDP A;  4RAK A;  2YFE A;  3K23 A;  3D5F A;  1NUO A;  2Q59 A;  4S0S A;  3ET0 A;  5DZ1 A;  3MNO A;  5EGV A;  4APU A;  1X7E A;  2O4J A;  2B23 A;  2ZXZ A;  4FGY A;  4S0T A;  5DKE A;  5GT4 A;  4MGC A;  5IZ0 A;  3X31 A;  1YIN A;  2QZO B;  5DX3 A;  5FQV A;  4IV2 A;  1G5Y A;  4XLD A;  3VTB A;  3KDU A;  3X1H A;  5DXP A;  1PCG A;  3WWR A;  4PPS A;  5AYG A;  2BJ4 A;  3AZ1 A;  1A52 A;  2NPA A;  2OCF A;  2Q5S A;  3HZF A;  5SYZ A;  1IE9 A;  5AWK A;  4FHI A;  5G5W A;  2PIU A;  1LBD A;  1PK5 A;  3VSO A;  4NB6 A;  3HC5 A;  1UHL A;  2NW4 A;  2OAX A;  2P15 A;  5AZV A;  5KCT A;  1SKX A;  2JJ3 A;  4QK4 A;  4WHF A;  5DMC A;  1RJK A;  1G2N A;  4G21 A;  2HCD A;  3V4A A;  5DWI A;  5DI7 A;  1YUC A;  2ZXM A;  2Q7I A;  3AZ2 A;  2AYR A;  3CTB A;  4JYG A;  1R20 A;  4PP6 A;  3VN2 A;  1KNU A;  1FCY A;  1XV9 A;  2AX8 A;  4QE8 A;  3OS8 C;  1ZDU A;  4NUF A;  3B5R A;  3K8S A;  3CWD A;  2W8Y A;  3PO9 A;  5DRM A;  5DUE A;  5DYB A;  4RME A;  2QGT A;  5C4U A;  5DZI A;  5G44 A;  3ERD A;  1XVP B;  1XDK A;  3L3Z A;  3K6P A;  5KCD A;  5AAV A;  4IW6 A;  3Q95 B;  3VRU A;  2V7C A;  4KZJ A;  4X1F A;  4MG6 A;  3FLI A;  4IA2 A;  3W0H A;  5E19 A;  3ADW A;  4JL4 A;  3ILZ A;  3ADV A;  4LNX A;  4DM6 A;  5DUG A;  3VT5 A;  4FNE A;  2I0J A;  2Q7L A;  2HWQ A;  1LV2 A;  5E1C A;  3PRG A;  3OMQ A;  1FM9 D;  4IA3 A;  1OSV A;  3AUR A;  2GPP A;  3UUA A;  2XYW A;  5KRC A;  4N1Y A;  1QKU A;  1S0X A;  5HCV A;  4R2U A;  2Q6S A;  2AX7 A;  1FD0 A;  1T73 A;  5APJ A;  1NYX A;  3P89 A;  4JYI A;  2G0G A;  3KMR A;  1SR7 A;  1WM0 X;  4ZN9 A;  3W5R A;  2AM9 A;  1XQ3 A;  3OZJ A;  4NY9 A;  2ZFX A;  1NQ2 A;  5KCF A;  5C4S A;  1R1K A;  3V49 A;  5L11 A;  5AVI A;  5B41 A;  1GWR A;  2ZLC A;  1S9P A;  2AXA A;  1DKF A;  3L3X A;  4TUZ B;  2GPV A;  4WQP A;  1GS4 A;  5DP0 A;  5APH A;  5EIT A;  1OVL A;  2QMV A;  4RZF A;  2ZK0 A;  4A4W A;  4DK8 A;  1EXA A;  4LBD A;  4X1G A;  4O8F A;  4OGH A;  1ILG A;  4ZOM A;  3ADU A;  3G0W A;  1I38 A;  3VJT A;  3HLV A;  2E2R A;  1R6G A;  2VV3 A;  1M13 A;  1N83 A;  4TV1 B;  1YIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...