5DYBA

Crystal structure of the er-alpha ligand-binding domain in complex with the cyclofenil derivative 4,4'-(3,4-dihydronaphthalen-2(1h)-ylidenemethanediyl)diphenol
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
244
structure length
229
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Predictive features of ligand-specific signaling through the estrogen receptor.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Transcription
source organism Homo sapiens
total genus 88
structure length 229
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5dybA00
2QH6A 1K4WA 3WMHA 3FUGA 1XB7A 3A78A 4J24A 1NQ2A 4YPQA 3PBAA 2NXXE 3RY9A 3OLLA 4QJRA 5FQRA 1YUCA 2HFPA 3R8DA 1QKMA 1X78A 1XV9B 3VT4A 5DP0A 2GWXA 2R6YA 2ZKCA 1NAVA 3L0JA 3X1HA 5I4VA 5DI7A 2Q59B 2AA7A 4OIUA 2XYXA 2P1VA 4DK8A 3KMGA 2NV7A 3B65A 1M7WA 2GPOA 2QA8B 4IS8A 4MG6A 4OZRE 1T7FA 5DZ1A 5DMCA 5K13A 2Q70A 3OSIA 2G0HA 3A9EB 5KROA 3CTBA 4Y29A 1KKQA 4Q13A 4ZNHA 3LMPA 1SQNA 2VSRA 2VV2A 1H9UA 4IA1A 3R5NA 4IA2A 4ZNUA 3ZQTA 1XP1A 1XV9A 1BSXA 1FM9A 2YLOA 1YOKA 3OMOA 5DWLA 5KCFA 2AMAA 5FQPA 4ZJWA 1OVLB 4JAZA 1K74A 3LBDA 1Y0SA 2Q6RA 2Q59A 2J4AA 2OVMA 3QT0A 1NQ7A 1OSVA 4KZIA 3HC5A 4F9MA 4JYGA 4OARA 2QA8A 5KCCA 1U3RA 3OOFA 4K4JA 3UP3A 2P7ZA 4NY9A 4OHAA 5L11A 3G8IA 4L98A 4PVUA 3A9EA 1PZLA 3G8OA 3VTDA 3DR1A 5AVIA 4G21A 4OEYA 4ZN7A 1RKGA 3MNEA 5KRMA 5DUHA 3OOKA 4MG9A 2J14A 1I38A 2YLQA 2QTUA 5DTVA 5KYAA 1QKUA 5GIEA 5E15A 4OC7A 3AN3A 2PIXA 4UDCA 2QMVA 1X7BA 3VTBA 5M96A 4LNWA 3WT6A 3KMZA 1NQ0A 4ZJRA 4N1YA 4QE8A 2B1ZA 5G43A 4RZGA 1YY4A 2ZXZA 1MVCA 5DL4A 1NHZA 5DKEA 4ITEA 4XTAA 3N00A 1YINA 3P89A 5HYRA 1YYEA 4IWCA 4J5XA 3ZRAA 4G1YA 1S0ZA 1ZDUA 2ZY0A 2NXXA 3FXVA 4QE6A 4XUHA 3KYTA 5KRKA 5DV8A 2V7CA 3WJ4A 1S9QA 2ABIA 2BJ4B 2J7YA 2OUZA 3B0WA 5JI0D 3HVLA 2ZLAA 2Q1HA 1ILGA 2QA6A 1X7RA 3UUDB 1T73A 4OEAA 1R20D 2AYRA 1R5KA 3PO9A 5APJA 5HCVA 4FN9A 4NUFA 4ZI1A 2AA5A 3IPUA 1L2IA 1RK3A 2POGA 3V3QA 5DVVA 4REFA 3GYTA 2I0GA 3ET0A 4FHIA 5G3JA 3WJ5A 4OILA 3CWDA 3B0TA 4CI4A 1R6GA 5C4SA 1A52A 4IU7A 3R2AA 5DXEA 1DKFB 2HC4A 3UUDA 4ITFA 3AURA 4DORA 1GWQA 3O1EA 4X1FA 5KCUA 3D57A 2OZ7A 3BC5A 3FALA 1S0XA 3KDTA 5DRJA 1YOWA 2YHDA 5APKA 5HJPB 5G46A 3P0UA 1FM6D 1N46A 3FEIA 5DZ3A 4A4WA 4G1ZA 1HG4A 4KZJA 3AZ1A 4IQRA 5JJMB 2ZBSA 1SKXA 4IA3A 3W0HA 3ET2A 2ZNPA 4PP5A 3GWXA 5DLRA 3RLJA 3VT5A 3X36A 1M2ZA 4E4QA 2E2RA 3OMPA 4RFWA 3A2JA 2HB8A 4OZTU 1ILHA 1DKFA 4E4KA 1MV9A 1R20A 2GTKA 5C4TA 4APUA 3GBKA 1Q4XA 2ZK0A 4G2IA 3UVVB 3CDPA 1FM9D 2P15A 5HJPA 3VSOA 1K74D 3S9SA 4CI5A 5KRIA 2JJ3A 2ZMIA 3RVFA 5L7HA 4RUJA 1PRGA 3B1MA 3B66A 2PINA 1ZDTA 3AUQA 3OLFA 5JJMA 5DX3B 4K6IA 3CJWA 4MDDA 1LV2A 4S0TA 5KD9A 2P1TA 3OS9A 3JZCA 3AZ2A 5AZTA 2QGWA 1RDTD 1L2JA 3FEJA 4WPFA 3OMKA 1PCGA 4OEZA 3W5PA 2AMBA 4ZOMA 1QKNA 5C4OA 4DM8A 3ET1A 3B0QA 3UVVA 2HB7A 3B0RA 4ZNWA 4UDBA 4UDDA 3W0AA 2ZL9A 5KRCA 2YLPA 4MGDB 1FM6A 3M7RA 5DKSA 1G2NA 2P7AA 4G1DA 1KV6A 3V49A 4DK7A 3R29A 3OS8C 5DZIA 2GP7A 3NSQA 2R6WA 1GS4A 5AK2A 1XJ7A 2ACLB 4J26A 5DX3A 3WT7A 5GICA 4IV2A 4YNKA 3VT6A 2P1UA 1XP6A 4BCRA 3E00D 2PIUA 5DKGA 2AAXA 1VJBA 3L3XA 3OMMA 2H77A 2FVJA 4R6SA 5KRFA 1FCYA 4TUZB 3W5TA 4MG9B 5DMFA 4RMEA 4POJA 3W0GA 2POBA 1NYXA 1K7LA 3ADSA 1UPWA 1T79A 4R06A 4IVWA 4XLDA 4ONIA 2HASA 2XKWA 4MGDA 4YT1A 2AB2A 3B3KA 2VV1A 3RLLA 2VV0A 3WFFA 2AX8A 5G44A 1XNNA 3L0LA 3X31A 1XIUA 1ZGYA 2GPVA 3VJIA 2ACLA 1YJEA 5GIDA 2PITA 4B7WA 3OMQA 5E0WA 2Q7IA 3F7DA 3HLVA 1RDTA 1T7MA 5KRHA 4TUZA 4OJ4A 1S9PA 3W0JA 3W0IA 5DXMA 1HJ1A 5FQSA 3T03A 4IWFA 1FCXA 5IZ0A 3VT8A 3OGTA 5FQVA 5AAVA 5KCDA 2I0JA 4JL4A 3IXPA 3Q95B 2ZVTA 3UUCA 5L7EA 2XHSA 2QW4A 5DSHA 1FD0A 1U3SA 3DZUA 1LBDA 3VRVA 3E00A 2ZK5A 5DUGA 4RMCA 3PEQA 5KCEA 3FS1A 2Q3YA 3VRUA 2AWHA 5IAWA 2PIOA 5DIGA 5EGVA 5FQTA 2PKLA 3AZ3A 5E0XA 2G5OA 2JF9A 2PIQA 2R40D 4N8RA 2OAXA 4J5WC 3CLDA 3Q95A 4WLBA 3FALB 3R5MA 3IPQA 1T74A 5LGAA 2ZFXA 3V4AA 5KR9A 3DCUA 5EJVA 2QGTA 4RZFA 2JFAA 3E7CA 2HVCA 2PJLA 3G0WA 5DK9A 3R8AA 2YFEA 5L7GA 5AWKA 1XPCA 5AYGA 3W0CA 1ERRA 4ZO1B 1EREA 3U9QA 4PLEA 3D5FA 5DWEA 5KRAA 3VJHA 2HAMA 1EXXA 1OT7A 1XVPB 2HWRA 2ZK3A 3HODA 4LSJA 2HARA 3WWRA 5DXKA 3AX8A 2QABA 1XOWA 2QXMA 2Q6SA 3FC6B 5G45A 5DUEA 1A28A 3K8SA 5G42A 3VSPA 4DQMA 3OZJA 2YATA 3VHWA 3X1IA 4OKWA 2ZNOA 3VJSA 3ZRBA 1UOMA 3KFCA 2Q1VA 3W5QA 2AX6A 5IXKA 2VV4B 1U3QA 3IA6A 4PPPA 2Q7KA 5DIEA 2LBDA 1TXIA 2AXAA 4OFRA 3HQ5A 5DWJA 3DZYA 2FAIA 1UHLA 2NPAA 3OS8A 1XVPA 5DWIA 2B50A 2HWQA 1T7RA 1GWRA 2QNVA 3WGPA 2QZOB 5GT4A 1I7GA 3CS4A 3HC6A 3PCUA 4NQAB 2YLYA 3FC6A 4DMAA 1TFCA 4UDAA 2R40A 5DYDA 2P4YA 5DXBA 3KMRA 5C4UA 5KCTA 3V9TA 1P93A 3D24A 3FURA 3H52A 3A40X 2EWPA 2Q5GA 2VV3A 3L1BA 4IW6A 5DXQA 3R8IA 3TKMA 5JY3A 5DY8A 1FCZA 2QPYA 2VV4A 4KZMA 2ZK2A 3O1DA 1XQ3A 2Q5PA 1Z95A 5KYJA 1WM0X 5AVLA 5B5BA 2PIVA 4OJ9A 5LWPA 2ZXMA 5ICKA 4MG5A 1MZNA 2O4RA 4PRGA 2J7XA 4HEEX 4N5GA 3WFGA 1SR7A 2NW4A 1N83A 2QZOA 4O8FA 2IOKA 2ZMJA 4A2JA 1RJKA 2G44A 2V0VA 2ZMHA 4OZTE 3ERDA 2Q7LA 4FHHA 4PLDA 5DVCA 2VSTA 2O9IA 3MNPA 4MGCA 1RKHA 3VHVA 5E14A 4OFUA 1DB1A 3ADUA 3B68A 4E2JA 1UPVA 3AUNA 2I4JA 3IXPD 4EMAA 3ADXA 3KWYA 1X7JA 2VV1B 4ZO1X 1PQ6A 4RWVA 5EHJA 2GIUA 1M13A 5EC9A 2P54A 5DU5A 3VT3A 3KPZA 1ZEOA 4WHFA 1SJ0A 3VTCA 1XLSA 2AA6A 1ZH7A 3GWSX 2B1VA 2QXSA 3DZUD 3UU7B 2IOGA 4G20A 1ZKYA 4TV1B 2XYJA 1YIMA 5KRLA 3IMYA 1U9EA 1T7TA 4HLWA 4EM9A 4OKXA 4LBDA 2Q7JA 5DZ0A 3MNOA 4MG8B 2W8YA 3K22A 4PWLA 5AAVB 3V9YA 3GYUA 3FLIA 4IV4A 3DY6A 4N73A 1ZAFA 4REEA 5KRJA 4RE8A 3OAPA 1XNXA 3ADVA 3CDSA 1PK5A 5DRMA 2PNUA 2B23A 4JGVA 4OEDA 4J5WA 4JYIA 2I4PA 2O4JA 3DT3A 4XAOA 4MGBB 5APHA 3SP9A 3NSPA 1T63A 4WVDA 1X7EA 3UU7A 3SZ1A 4ZNSA 1XP9A 3NOAA 3HZFA 1Z5XU 4PP6A 4LTWA 1PQ9A 3ADTA 4TV1A 4DOSA 1G5YA 2Z4BA 2ZASA 1T5ZA 4S15A 4PP3A 4MG8A 3JZBA 4POHA 2AX9A 5CJ6A 4IA7A 3OLSA 4XT9A 5ACCA 3A3ZX 3H0AD 2P7GA 3VT9A 1T65A 2QR9A 2REWA 4OK1A 2BAWA 2ZK4A 1G50A 5AZVA 1I7IA 2ZNNA 4WQPA 3CS6A 2JFAB 1XDKB 4FNEA 4XHDA 3VI8A 3UUAB 3VRWA 4ZN9A 4MGBA 5DXRA 3BQDA 5DKBA 4MG7B 1QKTA 3TX7B 3UP0A 3DZYD 1EXAA 2Z4JA 4OLMA 2GPPA 3RUTA 2YJAB 3F5CB 2Q5SA 2AO6A 2PIWA 1NDEA 4QL8A 1Z5XE 3ZR7A 1E3GA 2IHQA 4Q0AC 3K23A 4FGYA 4NIEA 3B67A 3V3EA 2Q61A 4ZNVA 4P6XA 3A2HA 4RMDA 2AA2A 1OVLA 3CQVA 3KBAA 4NB6A 4OIVA 5E19A 1E3KA 4S0SA 4QK4A 3E94A 1PQCA 4PF3A 2I4ZA 3WTQA 5HYKA 2AX7A 1NRLA 3ERTA 1XDKA 4ZNTA 5HJSA 4L96A 3UUAA 4MGAB 5DZHA 1FBYA 3L03A 4MG7A 2ZXNA 3GZ9A 3OSWA 1S19A 1UHLB 2PIPL 3BEJA 3ET3A 2QSEA 3F5CA 3OKHA 1XLSE 3P88A 2ZK1A 4CSJA 3ADWA 3PLZA 1XZXX 1R1KD 2Q8SA 3D90A 1NAXA 5A86A 3TY0A 4RZEA 2Q60A 3VT7A 3EYBA 3GN8A 4Q50A 5DVSA 1Y0XX 5SYZA 4YMQA 4IUIA 3B5RA 3PRGA 3OSAA 2HBHA 3ILZA 5DXBB 3VN2A 4M8EA 5AAUA 3H0AA 2Q6JA 4OKBA 5DYBA 4WHGA 1X76A 2PIRA 2ZK6A 3L3ZA 4IVYA 4OJBA 4OH6A 3V9VA 2QE4A 4QM0A 3WT5A 4MGAA 3D6DA 2AM9A 4DM6A 4A4VA 5B41A 2GPUA 4K7AA 4RUOX 2HCDA 3L0EA 2BJ4A 1NQ1A 3TKCA 4LNXA 3DCTA 2H79A 4P6WA 5DV6A 5G5WA 1ZUCA 4JYHA 1KNUA 4OKTA 3HO0A 2OCFA 4S14A 1IE8A 1Y9RA 5EITA 3VRTA 3W5RA 3G9EA 4J5XC 5F9BA 2FSZA 5HZCA 1OSHA 1YMTA 1YP0A 2G0GA 3P8XA 5DWGA 5AWJA 4G2HA 3VHUA 1I37A 4X1GA 1PDUA 5E7VA 2OM9A 2XYWA 2GL8A 1YA3A 2PRGA 4OGHA 3RUUA 5E1CA 2OVHA 1R1KA 2ZLCA 3IPSA 1G1UA 3VJTA 3AN4A 3HM1A 2ATHA 4OH5A 4R2UA 1XQCA 3K6PA 4RUPA 5DIDA 5H1EA 3GD2A 1T76A 3KDUA 2F4BA 3OKIA 3A2IA 4M8HA 5DXGA 4PPSA 1N4HA 5EI1A 4IW8A 5DXPA 2A3IA 1GWXA 1IE9A 3W0YA 4XUMA 2YJDA 5KCWA 4PXMA 1P8DA 5DV3A 4XI3A 3SP6A 4OZRU 4RAKA 2ZNQA 3OZ0A 1XAPA 3AFRA 5ETHA 3CS8A 1NUOA
chains in the Genus database with same CATH superfamily
2QH6A 1K4WA 3WMHA 3FUGA 1XB7A 3A78A 4J24A 1NQ2A 4YPQA 3PBAA 2NXXE 3RY9A 3OLLA 4QJRA 5FQRA 1YUCA 2HFPA 3R8DA 1QKMA 1X78A 1XV9B 3VT4A 5DP0A 2GWXA 2R6YA 2ZKCA 1NAVA 3L0JA 3X1HA 5I4VA 5DI7A 2Q59B 2AA7A 4OIUA 2XYXA 2P1VA 4DK8A 3KMGA 2NV7A 3B65A 1M7WA 2GPOA 2QA8B 4IS8A 4MG6A 4OZRE 1T7FA 5DZ1A 5DMCA 5K13A 2Q70A 3OSIA 2G0HA 3A9EB 5KROA 3CTBA 4Y29A 1KKQA 4Q13A 4ZNHA 3LMPA 1SQNA 2VSRA 2VV2A 1H9UA 4IA1A 3R5NA 4IA2A 4ZNUA 3ZQTA 1XP1A 1XV9A 1BSXA 1FM9A 2YLOA 1YOKA 3OMOA 5DWLA 5KCFA 2AMAA 5FQPA 4ZJWA 1OVLB 4JAZA 1K74A 3LBDA 1Y0SA 2Q6RA 2Q59A 2J4AA 2OVMA 3QT0A 1NQ7A 1OSVA 4KZIA 3HC5A 4F9MA 4JYGA 4OARA 2QA8A 5KCCA 1U3RA 3OOFA 4K4JA 3UP3A 2P7ZA 4NY9A 4OHAA 5L11A 3G8IA 4L98A 4PVUA 3A9EA 1PZLA 3G8OA 3VTDA 3DR1A 5AVIA 4G21A 4OEYA 4ZN7A 1RKGA 3MNEA 5KRMA 5DUHA 3OOKA 4MG9A 2J14A 1I38A 2YLQA 2QTUA 5DTVA 5KYAA 1QKUA 5GIEA 5E15A 4OC7A 3AN3A 2PIXA 4UDCA 2QMVA 1X7BA 3VTBA 5M96A 4LNWA 3WT6A 3KMZA 1NQ0A 4ZJRA 4N1YA 4QE8A 2B1ZA 5G43A 4RZGA 1YY4A 2ZXZA 1MVCA 5DL4A 1NHZA 5DKEA 4ITEA 4XTAA 3N00A 1YINA 3P89A 5HYRA 1YYEA 4IWCA 4J5XA 3ZRAA 4G1YA 1S0ZA 1ZDUA 2ZY0A 2NXXA 3FXVA 4QE6A 4XUHA 3KYTA 5KRKA 5DV8A 2V7CA 3WJ4A 1S9QA 2ABIA 2BJ4B 2J7YA 2OUZA 3B0WA 5JI0D 3HVLA 2ZLAA 2Q1HA 1ILGA 2QA6A 1X7RA 3UUDB 1T73A 4OEAA 1R20D 2AYRA 1R5KA 3PO9A 5APJA 5HCVA 4FN9A 4NUFA 4ZI1A 2AA5A 3IPUA 1L2IA 1RK3A 2POGA 3V3QA 5DVVA 4REFA 3GYTA 2I0GA 3ET0A 4FHIA 5G3JA 3WJ5A 4OILA 3CWDA 3B0TA 4CI4A 1R6GA 5C4SA 1A52A 4IU7A 3R2AA 5DXEA 1DKFB 2HC4A 3UUDA 4ITFA 3AURA 4DORA 1GWQA 3O1EA 4X1FA 5KCUA 3D57A 2OZ7A 3BC5A 3FALA 1S0XA 3KDTA 5DRJA 1YOWA 2YHDA 5APKA 5HJPB 5G46A 3P0UA 1FM6D 1N46A 3FEIA 5DZ3A 4A4WA 4G1ZA 1HG4A 4KZJA 3AZ1A 4IQRA 5JJMB 2ZBSA 1SKXA 4IA3A 3W0HA 3ET2A 2ZNPA 4PP5A 3GWXA 5DLRA 3RLJA 3VT5A 3X36A 1M2ZA 4E4QA 2E2RA 3OMPA 4RFWA 3A2JA 2HB8A 4OZTU 1ILHA 1DKFA 4E4KA 1MV9A 1R20A 2GTKA 5C4TA 4APUA 3GBKA 1Q4XA 2ZK0A 4G2IA 3UVVB 3CDPA 1FM9D 2P15A 5HJPA 3VSOA 1K74D 3S9SA 4CI5A 5KRIA 2JJ3A 2ZMIA 3RVFA 5L7HA 4RUJA 1PRGA 3B1MA 3B66A 2PINA 1ZDTA 3AUQA 3OLFA 5JJMA 5DX3B 4K6IA 3CJWA 4MDDA 1LV2A 4S0TA 5KD9A 2P1TA 3OS9A 3JZCA 3AZ2A 5AZTA 2QGWA 1RDTD 1L2JA 3FEJA 4WPFA 3OMKA 1PCGA 4OEZA 3W5PA 2AMBA 4ZOMA 1QKNA 5C4OA 4DM8A 3ET1A 3B0QA 3UVVA 2HB7A 3B0RA 4ZNWA 4UDBA 4UDDA 3W0AA 2ZL9A 5KRCA 2YLPA 4MGDB 1FM6A 3M7RA 5DKSA 1G2NA 2P7AA 4G1DA 1KV6A 3V49A 4DK7A 3R29A 3OS8C 5DZIA 2GP7A 3NSQA 2R6WA 1GS4A 5AK2A 1XJ7A 2ACLB 4J26A 5DX3A 3WT7A 5GICA 4IV2A 4YNKA 3VT6A 2P1UA 1XP6A 4BCRA 3E00D 2PIUA 5DKGA 2AAXA 1VJBA 3L3XA 3OMMA 2H77A 2FVJA 4R6SA 5KRFA 1FCYA 4TUZB 3W5TA 4MG9B 5DMFA 4RMEA 4POJA 3W0GA 2POBA 1NYXA 1K7LA 3ADSA 1UPWA 1T79A 4R06A 4IVWA 4XLDA 4ONIA 2HASA 2XKWA 4MGDA 4YT1A 2AB2A 3B3KA 2VV1A 3RLLA 2VV0A 3WFFA 2AX8A 5G44A 1XNNA 3L0LA 3X31A 1XIUA 1ZGYA 2GPVA 3VJIA 2ACLA 1YJEA 5GIDA 2PITA 4B7WA 3OMQA 5E0WA 2Q7IA 3F7DA 3HLVA 1RDTA 1T7MA 5KRHA 4TUZA 4OJ4A 1S9PA 3W0JA 3W0IA 5DXMA 1HJ1A 5FQSA 3T03A 4IWFA 1FCXA 5IZ0A 3VT8A 3OGTA 5FQVA 5AAVA 5KCDA 2I0JA 4JL4A 3IXPA 3Q95B 2ZVTA 3UUCA 5L7EA 2XHSA 2QW4A 5DSHA 1FD0A 1U3SA 3DZUA 1LBDA 3VRVA 3E00A 2ZK5A 5DUGA 4RMCA 3PEQA 5KCEA 3FS1A 2Q3YA 3VRUA 2AWHA 5IAWA 2PIOA 5DIGA 5EGVA 5FQTA 2PKLA 3AZ3A 5E0XA 2G5OA 2JF9A 2PIQA 2R40D 4N8RA 2OAXA 4J5WC 3CLDA 3Q95A 4WLBA 3FALB 3R5MA 3IPQA 1T74A 5LGAA 2ZFXA 3V4AA 5KR9A 3DCUA 5EJVA 2QGTA 4RZFA 2JFAA 3E7CA 2HVCA 2PJLA 3G0WA 5DK9A 3R8AA 2YFEA 5L7GA 5AWKA 1XPCA 5AYGA 3W0CA 1ERRA 4ZO1B 1EREA 3U9QA 4PLEA 3D5FA 5DWEA 5KRAA 3VJHA 2HAMA 1EXXA 1OT7A 1XVPB 2HWRA 2ZK3A 3HODA 4LSJA 2HARA 3WWRA 5DXKA 3AX8A 2QABA 1XOWA 2QXMA 2Q6SA 3FC6B 5G45A 5DUEA 1A28A 3K8SA 5G42A 3VSPA 4DQMA 3OZJA 2YATA 3VHWA 3X1IA 4OKWA 2ZNOA 3VJSA 3ZRBA 1UOMA 3KFCA 2Q1VA 3W5QA 2AX6A 5IXKA 2VV4B 1U3QA 3IA6A 4PPPA 2Q7KA 5DIEA 2LBDA 1TXIA 2AXAA 4OFRA 3HQ5A 5DWJA 3DZYA 2FAIA 1UHLA 2NPAA 3OS8A 1XVPA 5DWIA 2B50A 2HWQA 1T7RA 1GWRA 2QNVA 3WGPA 2QZOB 5GT4A 1I7GA 3CS4A 3HC6A 3PCUA 4NQAB 2YLYA 3FC6A 4DMAA 1TFCA 4UDAA 2R40A 5DYDA 2P4YA 5DXBA 3KMRA 5C4UA 5KCTA 3V9TA 1P93A 3D24A 3FURA 3H52A 3A40X 2EWPA 2Q5GA 2VV3A 3L1BA 4IW6A 5DXQA 3R8IA 3TKMA 5JY3A 5DY8A 1FCZA 2QPYA 2VV4A 4KZMA 2ZK2A 3O1DA 1XQ3A 2Q5PA 1Z95A 5KYJA 1WM0X 5AVLA 5B5BA 2PIVA 4OJ9A 5LWPA 2ZXMA 5ICKA 4MG5A 1MZNA 2O4RA 4PRGA 2J7XA 4HEEX 4N5GA 3WFGA 1SR7A 2NW4A 1N83A 2QZOA 4O8FA 2IOKA 2ZMJA 4A2JA 1RJKA 2G44A 2V0VA 2ZMHA 4OZTE 3ERDA 2Q7LA 4FHHA 4PLDA 5DVCA 2VSTA 2O9IA 3MNPA 4MGCA 1RKHA 3VHVA 5E14A 4OFUA 1DB1A 3ADUA 3B68A 4E2JA 1UPVA 3AUNA 2I4JA 3IXPD 4EMAA 3ADXA 3KWYA 1X7JA 2VV1B 4ZO1X 1PQ6A 4RWVA 5EHJA 2GIUA 1M13A 5EC9A 2P54A 5DU5A 3VT3A 3KPZA 1ZEOA 4WHFA 1SJ0A 3VTCA 1XLSA 2AA6A 1ZH7A 3GWSX 2B1VA 2QXSA 3DZUD 3UU7B 2IOGA 4G20A 1ZKYA 4TV1B 2XYJA 1YIMA 5KRLA 3IMYA 1U9EA 1T7TA 4HLWA 4EM9A 4OKXA 4LBDA 2Q7JA 5DZ0A 3MNOA 4MG8B 2W8YA 3K22A 4PWLA 5AAVB 3V9YA 3GYUA 3FLIA 4IV4A 3DY6A 4N73A 1ZAFA 4REEA 5KRJA 4RE8A 3OAPA 1XNXA 3ADVA 3CDSA 1PK5A 5DRMA 2PNUA 2B23A 4JGVA 4OEDA 4J5WA 4JYIA 2I4PA 2O4JA 3DT3A 4XAOA 4MGBB 5APHA 3SP9A 3NSPA 1T63A 4WVDA 1X7EA 3UU7A 3SZ1A 4ZNSA 1XP9A 3NOAA 3HZFA 1Z5XU 4PP6A 4LTWA 1PQ9A 3ADTA 4TV1A 4DOSA 1G5YA 2Z4BA 2ZASA 1T5ZA 4S15A 4PP3A 4MG8A 3JZBA 4POHA 2AX9A 5CJ6A 4IA7A 3OLSA 4XT9A 5ACCA 3A3ZX 3H0AD 2P7GA 3VT9A 1T65A 2QR9A 2REWA 4OK1A 2BAWA 2ZK4A 1G50A 5AZVA 1I7IA 2ZNNA 4WQPA 3CS6A 2JFAB 1XDKB 4FNEA 4XHDA 3VI8A 3UUAB 3VRWA 4ZN9A 4MGBA 5DXRA 3BQDA 5DKBA 4MG7B 1QKTA 3TX7B 3UP0A 3DZYD 1EXAA 2Z4JA 4OLMA 2GPPA 3RUTA 2YJAB 3F5CB 2Q5SA 2AO6A 2PIWA 1NDEA 4QL8A 1Z5XE 3ZR7A 1E3GA 2IHQA 4Q0AC 3K23A 4FGYA 4NIEA 3B67A 3V3EA 2Q61A 4ZNVA 4P6XA 3A2HA 4RMDA 2AA2A 1OVLA 3CQVA 3KBAA 4NB6A 4OIVA 5E19A 1E3KA 4S0SA 4QK4A 3E94A 1PQCA 4PF3A 2I4ZA 3WTQA 5HYKA 2AX7A 1NRLA 3ERTA 1XDKA 4ZNTA 5HJSA 4L96A 3UUAA 4MGAB 5DZHA 1FBYA 3L03A 4MG7A 2ZXNA 3GZ9A 3OSWA 1S19A 1UHLB 2PIPL 3BEJA 3ET3A 2QSEA 3F5CA 3OKHA 1XLSE 3P88A 2ZK1A 4CSJA 3ADWA 3PLZA 1XZXX 1R1KD 2Q8SA 3D90A 1NAXA 5A86A 3TY0A 4RZEA 2Q60A 3VT7A 3EYBA 3GN8A 4Q50A 5DVSA 1Y0XX 5SYZA 4YMQA 4IUIA 3B5RA 3PRGA 3OSAA 2HBHA 3ILZA 5DXBB 3VN2A 4M8EA 5AAUA 3H0AA 2Q6JA 4OKBA 5DYBA 4WHGA 1X76A 2PIRA 2ZK6A 3L3ZA 4IVYA 4OJBA 4OH6A 3V9VA 2QE4A 4QM0A 3WT5A 4MGAA 3D6DA 2AM9A 4DM6A 4A4VA 5B41A 2GPUA 4K7AA 4RUOX 2HCDA 3L0EA 2BJ4A 1NQ1A 3TKCA 4LNXA 3DCTA 2H79A 4P6WA 5DV6A 5G5WA 1ZUCA 4JYHA 1KNUA 4OKTA 3HO0A 2OCFA 4S14A 1IE8A 1Y9RA 5EITA 3VRTA 3W5RA 3G9EA 4J5XC 5F9BA 2FSZA 5HZCA 1OSHA 1YMTA 1YP0A 2G0GA 3P8XA 5DWGA 5AWJA 4G2HA 3VHUA 1I37A 4X1GA 1PDUA 5E7VA 2OM9A 2XYWA 2GL8A 1YA3A 2PRGA 4OGHA 3RUUA 5E1CA 2OVHA 1R1KA 2ZLCA 3IPSA 1G1UA 3VJTA 3AN4A 3HM1A 2ATHA 4OH5A 4R2UA 1XQCA 3K6PA 4RUPA 5DIDA 5H1EA 3GD2A 1T76A 3KDUA 2F4BA 3OKIA 3A2IA 4M8HA 5DXGA 4PPSA 1N4HA 5EI1A 4IW8A 5DXPA 2A3IA 1GWXA 1IE9A 3W0YA 4XUMA 2YJDA 5KCWA 4PXMA 1P8DA 5DV3A 4XI3A 3SP6A 4OZRU 4RAKA 2ZNQA 3OZ0A 1XAPA 3AFRA 5ETHA 3CS8A 1NUOA
chains in the Genus database with same CATH topology
2QH6A 1K4WA 3WMHA 3FUGA 1XB7A 3A78A 4J24A 1NQ2A 4YPQA 3PBAA 2NXXE 3RY9A 3OLLA 4QJRA 5FQRA 1YUCA 2HFPA 3R8DA 1QKMA 1X78A 1XV9B 3VT4A 5DP0A 2GWXA 2R6YA 2ZKCA 1NAVA 3L0JA 3X1HA 5I4VA 5DI7A 2Q59B 2AA7A 4OIUA 2XYXA 2P1VA 4DK8A 3KMGA 2NV7A 3B65A 1M7WA 2GPOA 2QA8B 4IS8A 4MG6A 4OZRE 1T7FA 5DZ1A 5DMCA 5K13A 2Q70A 3OSIA 2G0HA 3A9EB 5KROA 3CTBA 4Y29A 1KKQA 4Q13A 4ZNHA 3LMPA 1SQNA 2VSRA 2VV2A 1H9UA 4IA1A 3R5NA 4IA2A 4ZNUA 3ZQTA 1XP1A 1XV9A 1BSXA 1FM9A 2YLOA 1YOKA 3OMOA 5DWLA 5KCFA 2AMAA 5FQPA 4ZJWA 1OVLB 4JAZA 1K74A 3LBDA 1Y0SA 2Q6RA 2Q59A 2J4AA 2OVMA 3QT0A 1NQ7A 1OSVA 4KZIA 3HC5A 4F9MA 4JYGA 4OARA 2QA8A 5KCCA 1U3RA 3OOFA 4K4JA 3UP3A 2P7ZA 4NY9A 4OHAA 5L11A 3G8IA 4L98A 4PVUA 3A9EA 1PZLA 3G8OA 3VTDA 3DR1A 5AVIA 4G21A 4OEYA 4ZN7A 1RKGA 3MNEA 5KRMA 5DUHA 3OOKA 4MG9A 2J14A 1I38A 2YLQA 2QTUA 5DTVA 5KYAA 1QKUA 5GIEA 5E15A 4OC7A 3AN3A 2PIXA 4UDCA 2QMVA 1X7BA 3VTBA 5M96A 4LNWA 3WT6A 3KMZA 1NQ0A 4ZJRA 4N1YA 4QE8A 2B1ZA 5G43A 4RZGA 1YY4A 2ZXZA 1MVCA 5DL4A 1NHZA 5DKEA 4ITEA 4XTAA 3N00A 1YINA 3P89A 5HYRA 1YYEA 4IWCA 4J5XA 3ZRAA 4G1YA 1S0ZA 1ZDUA 2ZY0A 2NXXA 3FXVA 4QE6A 4XUHA 3KYTA 5KRKA 5DV8A 2V7CA 3WJ4A 1S9QA 2ABIA 2BJ4B 2J7YA 2OUZA 3B0WA 5JI0D 3HVLA 2ZLAA 2Q1HA 1ILGA 2QA6A 1X7RA 3UUDB 1T73A 4OEAA 1R20D 2AYRA 1R5KA 3PO9A 5APJA 5HCVA 4FN9A 4NUFA 4ZI1A 2AA5A 3IPUA 1L2IA 1RK3A 2POGA 3V3QA 5DVVA 4REFA 3GYTA 2I0GA 3ET0A 4FHIA 5G3JA 3WJ5A 4OILA 3CWDA 3B0TA 4CI4A 1R6GA 5C4SA 1A52A 4IU7A 3R2AA 5DXEA 1DKFB 2HC4A 3UUDA 4ITFA 3AURA 4DORA 1GWQA 3O1EA 4X1FA 5KCUA 3D57A 2OZ7A 3BC5A 3FALA 1S0XA 3KDTA 5DRJA 1YOWA 2YHDA 5APKA 5HJPB 5G46A 3P0UA 1FM6D 1N46A 3FEIA 5DZ3A 4A4WA 4G1ZA 1HG4A 4KZJA 3AZ1A 4IQRA 5JJMB 2ZBSA 1SKXA 4IA3A 3W0HA 3ET2A 2ZNPA 4PP5A 3GWXA 5DLRA 3RLJA 3VT5A 3X36A 1M2ZA 4E4QA 2E2RA 3OMPA 4RFWA 3A2JA 2HB8A 4OZTU 1ILHA 1DKFA 4E4KA 1MV9A 1R20A 2GTKA 5C4TA 4APUA 3GBKA 1Q4XA 2ZK0A 4G2IA 3UVVB 3CDPA 1FM9D 2P15A 5HJPA 3VSOA 1K74D 3S9SA 4CI5A 5KRIA 2JJ3A 2ZMIA 3RVFA 5L7HA 4RUJA 1PRGA 3B1MA 3B66A 2PINA 1ZDTA 3AUQA 3OLFA 5JJMA 5DX3B 4K6IA 3CJWA 4MDDA 1LV2A 4S0TA 5KD9A 2P1TA 3OS9A 3JZCA 3AZ2A 5AZTA 2QGWA 1RDTD 1L2JA 3FEJA 4WPFA 3OMKA 1PCGA 4OEZA 3W5PA 2AMBA 4ZOMA 1QKNA 5C4OA 4DM8A 3ET1A 3B0QA 3UVVA 2HB7A 3B0RA 4ZNWA 4UDBA 4UDDA 3W0AA 2ZL9A 5KRCA 2YLPA 4MGDB 1FM6A 3M7RA 5DKSA 1G2NA 2P7AA 4G1DA 1KV6A 3V49A 4DK7A 3R29A 3OS8C 5DZIA 2GP7A 3NSQA 2R6WA 1GS4A 5AK2A 1XJ7A 2ACLB 4J26A 5DX3A 3WT7A 5GICA 4IV2A 4YNKA 3VT6A 2P1UA 1XP6A 4BCRA 3E00D 2PIUA 5DKGA 2AAXA 1VJBA 3L3XA 3OMMA 2H77A 2FVJA 4R6SA 5KRFA 1FCYA 4TUZB 3W5TA 4MG9B 5DMFA 4RMEA 4POJA 3W0GA 2POBA 1NYXA 1K7LA 3ADSA 1UPWA 1T79A 4R06A 4IVWA 4XLDA 4ONIA 2HASA 2XKWA 4MGDA 4YT1A 2AB2A 3B3KA 2VV1A 3RLLA 2VV0A 3WFFA 2AX8A 5G44A 1XNNA 3L0LA 3X31A 1XIUA 1ZGYA 2GPVA 3VJIA 2ACLA 1YJEA 5GIDA 2PITA 4B7WA 3OMQA 5E0WA 2Q7IA 3F7DA 3HLVA 1RDTA 1T7MA 5KRHA 4TUZA 4OJ4A 1S9PA 3W0JA 3W0IA 5DXMA 1HJ1A 5FQSA 3T03A 4IWFA 1FCXA 5IZ0A 3VT8A 3OGTA 5FQVA 5AAVA 5KCDA 2I0JA 4JL4A 3IXPA 3Q95B 2ZVTA 3UUCA 5L7EA 2XHSA 2QW4A 5DSHA 1FD0A 1U3SA 3DZUA 1LBDA 3VRVA 3E00A 2ZK5A 5DUGA 4RMCA 3PEQA 5KCEA 3FS1A 2Q3YA 3VRUA 2AWHA 5IAWA 2PIOA 5DIGA 5EGVA 5FQTA 2PKLA 3AZ3A 5E0XA 2G5OA 2JF9A 2PIQA 2R40D 4N8RA 2OAXA 4J5WC 3CLDA 3Q95A 4WLBA 3FALB 3R5MA 3IPQA 1T74A 5LGAA 2ZFXA 3V4AA 5KR9A 3DCUA 5EJVA 2QGTA 4RZFA 2JFAA 3E7CA 2HVCA 2PJLA 3G0WA 5DK9A 3R8AA 2YFEA 5L7GA 5AWKA 1XPCA 5AYGA 3W0CA 1ERRA 4ZO1B 1EREA 3U9QA 4PLEA 3D5FA 5DWEA 5KRAA 3VJHA 2HAMA 1EXXA 1OT7A 1XVPB 2HWRA 2ZK3A 3HODA 4LSJA 2HARA 3WWRA 5DXKA 3AX8A 2QABA 1XOWA 2QXMA 2Q6SA 3FC6B 5G45A 5DUEA 1A28A 3K8SA 5G42A 3VSPA 4DQMA 3OZJA 2YATA 3VHWA 3X1IA 4OKWA 2ZNOA 3VJSA 3ZRBA 1UOMA 3KFCA 2Q1VA 3W5QA 2AX6A 5IXKA 2VV4B 1U3QA 3IA6A 4PPPA 2Q7KA 5DIEA 2LBDA 1TXIA 2AXAA 4OFRA 3HQ5A 5DWJA 3DZYA 2FAIA 1UHLA 2NPAA 3OS8A 1XVPA 5DWIA 2B50A 2HWQA 1T7RA 1GWRA 2QNVA 3WGPA 2QZOB 5GT4A 1I7GA 3CS4A 3HC6A 3PCUA 4NQAB 2YLYA 3FC6A 4DMAA 1TFCA 4UDAA 2R40A 5DYDA 2P4YA 5DXBA 3KMRA 5C4UA 5KCTA 3V9TA 1P93A 3D24A 3FURA 3H52A 3A40X 2EWPA 2Q5GA 2VV3A 3L1BA 4IW6A 5DXQA 3R8IA 3TKMA 5JY3A 5DY8A 1FCZA 2QPYA 2VV4A 4KZMA 2ZK2A 3O1DA 1XQ3A 2Q5PA 1Z95A 5KYJA 1WM0X 5AVLA 5B5BA 2PIVA 4OJ9A 5LWPA 2ZXMA 5ICKA 4MG5A 1MZNA 2O4RA 4PRGA 2J7XA 4HEEX 4N5GA 3WFGA 1SR7A 2NW4A 1N83A 2QZOA 4O8FA 2IOKA 2ZMJA 4A2JA 1RJKA 2G44A 2V0VA 2ZMHA 4OZTE 3ERDA 2Q7LA 4FHHA 4PLDA 5DVCA 2VSTA 2O9IA 3MNPA 4MGCA 1RKHA 3VHVA 5E14A 4OFUA 1DB1A 3ADUA 3B68A 4E2JA 1UPVA 3AUNA 2I4JA 3IXPD 4EMAA 3ADXA 3KWYA 1X7JA 2VV1B 4ZO1X 1PQ6A 4RWVA 5EHJA 2GIUA 1M13A 5EC9A 2P54A 5DU5A 3VT3A 3KPZA 1ZEOA 4WHFA 1SJ0A 3VTCA 1XLSA 2AA6A 1ZH7A 3GWSX 2B1VA 2QXSA 3DZUD 3UU7B 2IOGA 4G20A 1ZKYA 4TV1B 2XYJA 1YIMA 5KRLA 3IMYA 1U9EA 1T7TA 4HLWA 4EM9A 4OKXA 4LBDA 2Q7JA 5DZ0A 3MNOA 4MG8B 2W8YA 3K22A 4PWLA 5AAVB 3V9YA 3GYUA 3FLIA 4IV4A 3DY6A 4N73A 1ZAFA 4REEA 5KRJA 4RE8A 3OAPA 1XNXA 3ADVA 3CDSA 1PK5A 5DRMA 2PNUA 2B23A 4JGVA 4OEDA 4J5WA 4JYIA 2I4PA 2O4JA 3DT3A 4XAOA 4MGBB 5APHA 3SP9A 3NSPA 1T63A 4WVDA 1X7EA 3UU7A 3SZ1A 4ZNSA 1XP9A 3NOAA 3HZFA 1Z5XU 4PP6A 4LTWA 1PQ9A 3ADTA 4TV1A 4DOSA 1G5YA 2Z4BA 2ZASA 1T5ZA 4S15A 4PP3A 4MG8A 3JZBA 4POHA 2AX9A 5CJ6A 4IA7A 3OLSA 4XT9A 5ACCA 3A3ZX 3H0AD 2P7GA 3VT9A 1T65A 2QR9A 2REWA 4OK1A 2BAWA 2ZK4A 1G50A 5AZVA 1I7IA 2ZNNA 4WQPA 3CS6A 2JFAB 1XDKB 4FNEA 4XHDA 3VI8A 3UUAB 3VRWA 4ZN9A 4MGBA 5DXRA 3BQDA 5DKBA 4MG7B 1QKTA 3TX7B 3UP0A 3DZYD 1EXAA 2Z4JA 4OLMA 2GPPA 3RUTA 2YJAB 3F5CB 2Q5SA 2AO6A 2PIWA 1NDEA 4QL8A 1Z5XE 3ZR7A 1E3GA 2IHQA 4Q0AC 3K23A 4FGYA 4NIEA 3B67A 3V3EA 2Q61A 4ZNVA 4P6XA 3A2HA 4RMDA 2AA2A 1OVLA 3CQVA 3KBAA 4NB6A 4OIVA 5E19A 1E3KA 4S0SA 4QK4A 3E94A 1PQCA 4PF3A 2I4ZA 3WTQA 5HYKA 2AX7A 1NRLA 3ERTA 1XDKA 4ZNTA 5HJSA 4L96A 3UUAA 4MGAB 5DZHA 1FBYA 3L03A 4MG7A 2ZXNA 3GZ9A 3OSWA 1S19A 1UHLB 2PIPL 3BEJA 3ET3A 2QSEA 3F5CA 3OKHA 1XLSE 3P88A 2ZK1A 4CSJA 3ADWA 3PLZA 1XZXX 1R1KD 2Q8SA 3D90A 1NAXA 5A86A 3TY0A 4RZEA 2Q60A 3VT7A 3EYBA 3GN8A 4Q50A 5DVSA 1Y0XX 5SYZA 4YMQA 4IUIA 3B5RA 3PRGA 3OSAA 2HBHA 3ILZA 5DXBB 3VN2A 4M8EA 5AAUA 3H0AA 2Q6JA 4OKBA 5DYBA 4WHGA 1X76A 2PIRA 2ZK6A 3L3ZA 4IVYA 4OJBA 4OH6A 3V9VA 2QE4A 4QM0A 3WT5A 4MGAA 3D6DA 2AM9A 4DM6A 4A4VA 5B41A 2GPUA 4K7AA 4RUOX 2HCDA 3L0EA 2BJ4A 1NQ1A 3TKCA 4LNXA 3DCTA 2H79A 4P6WA 5DV6A 5G5WA 1ZUCA 4JYHA 1KNUA 4OKTA 3HO0A 2OCFA 4S14A 1IE8A 1Y9RA 5EITA 3VRTA 3W5RA 3G9EA 4J5XC 5F9BA 2FSZA 5HZCA 1OSHA 1YMTA 1YP0A 2G0GA 3P8XA 5DWGA 5AWJA 4G2HA 3VHUA 1I37A 4X1GA 1PDUA 5E7VA 2OM9A 2XYWA 2GL8A 1YA3A 2PRGA 4OGHA 3RUUA 5E1CA 2OVHA 1R1KA 2ZLCA 3IPSA 1G1UA 3VJTA 3AN4A 3HM1A 2ATHA 4OH5A 4R2UA 1XQCA 3K6PA 4RUPA 5DIDA 5H1EA 3GD2A 1T76A 3KDUA 2F4BA 3OKIA 3A2IA 4M8HA 5DXGA 4PPSA 1N4HA 5EI1A 4IW8A 5DXPA 2A3IA 1GWXA 1IE9A 3W0YA 4XUMA 2YJDA 5KCWA 4PXMA 1P8DA 5DV3A 4XI3A 3SP6A 4OZRU 4RAKA 2ZNQA 3OZ0A 1XAPA 3AFRA 5ETHA 3CS8A 1NUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QH6 A;  1K4W A;  3WMH A;  3FUG A;  1XB7 A;  3A78 A;  4J24 A;  1NQ2 A;  4YPQ A;  3PBA A;  2NXX E;  3RY9 A;  3OLL A;  4QJR A;  5FQR A;  1YUC A;  2HFP A;  3R8D A;  1QKM A;  1X78 A;  1XV9 B;  3VT4 A;  5DP0 A;  2GWX A;  2R6Y A;  2ZKC A;  1NAV A;  3L0J A;  3X1H A;  5I4V A;  5DI7 A;  2Q59 B;  2AA7 A;  4OIU A;  2XYX A;  2P1V A;  4DK8 A;  3KMG A;  2NV7 A;  3B65 A;  1M7W A;  2GPO A;  2QA8 B;  4IS8 A;  4MG6 A;  4OZR E;  1T7F A;  5DZ1 A;  5DMC A;  5K13 A;  2Q70 A;  3OSI A;  2G0H A;  3A9E B;  5KRO A;  3CTB A;  4Y29 A;  1KKQ A;  4Q13 A;  4ZNH A;  3LMP A;  1SQN A;  2VSR A;  2VV2 A;  1H9U A;  4IA1 A;  3R5N A;  4IA2 A;  4ZNU A;  3ZQT A;  1XP1 A;  1XV9 A;  1BSX A;  1FM9 A;  2YLO A;  1YOK A;  3OMO A;  5DWL A;  5KCF A;  2AMA A;  5FQP A;  4ZJW A;  1OVL B;  4JAZ A;  1K74 A;  3LBD A;  1Y0S A;  2Q6R A;  2Q59 A;  2J4A A;  2OVM A;  3QT0 A;  1NQ7 A;  1OSV A;  4KZI A;  3HC5 A;  4F9M A;  4JYG A;  4OAR A;  2QA8 A;  5KCC A;  1U3R A;  3OOF A;  4K4J A;  3UP3 A;  2P7Z A;  4NY9 A;  4OHA A;  5L11 A;  3G8I A;  4L98 A;  4PVU A;  3A9E A;  1PZL A;  3G8O A;  3VTD A;  3DR1 A;  5AVI A;  4G21 A;  4OEY A;  4ZN7 A;  1RKG A;  3MNE A;  5KRM A;  5DUH A;  3OOK A;  4MG9 A;  2J14 A;  1I38 A;  2YLQ A;  2QTU A;  5DTV A;  5KYA A;  1QKU A;  5GIE A;  5E15 A;  4OC7 A;  3AN3 A;  2PIX A;  4UDC A;  2QMV A;  1X7B A;  3VTB A;  5M96 A;  4LNW A;  3WT6 A;  3KMZ A;  1NQ0 A;  4ZJR A;  4N1Y A;  4QE8 A;  2B1Z A;  5G43 A;  4RZG A;  1YY4 A;  2ZXZ A;  1MVC A;  5DL4 A;  1NHZ A;  5DKE A;  4ITE A;  4XTA A;  3N00 A;  1YIN A;  3P89 A;  5HYR A;  1YYE A;  4IWC A;  4J5X A;  3ZRA A;  4G1Y A;  1S0Z A;  1ZDU A;  2ZY0 A;  2NXX A;  3FXV A;  4QE6 A;  4XUH A;  3KYT A;  5KRK A;  5DV8 A;  2V7C A;  3WJ4 A;  1S9Q A;  2ABI A;  2BJ4 B;  2J7Y A;  2OUZ A;  3B0W A;  5JI0 D;  3HVL A;  2ZLA A;  2Q1H A;  1ILG A;  2QA6 A;  1X7R A;  3UUD B;  1T73 A;  4OEA A;  1R20 D;  2AYR A;  1R5K A;  3PO9 A;  5APJ A;  5HCV A;  4FN9 A;  4NUF A;  4ZI1 A;  2AA5 A;  3IPU A;  1L2I A;  1RK3 A;  2POG A;  3V3Q A;  5DVV A;  4REF A;  3GYT A;  2I0G A;  3ET0 A;  4FHI A;  5G3J A;  3WJ5 A;  4OIL A;  3CWD A;  3B0T A;  4CI4 A;  1R6G A;  5C4S A;  1A52 A;  4IU7 A;  3R2A A;  5DXE A;  1DKF B;  2HC4 A;  3UUD A;  4ITF A;  3AUR A;  4DOR A;  1GWQ A;  3O1E A;  4X1F A;  5KCU A;  3D57 A;  2OZ7 A;  3BC5 A;  3FAL A;  1S0X A;  3KDT A;  5DRJ A;  1YOW A;  2YHD A;  5APK A;  5HJP B;  5G46 A;  3P0U A;  1FM6 D;  1N46 A;  3FEI A;  5DZ3 A;  4A4W A;  4G1Z A;  1HG4 A;  4KZJ A;  3AZ1 A;  4IQR A;  5JJM B;  2ZBS A;  1SKX A;  4IA3 A;  3W0H A;  3ET2 A;  2ZNP A;  4PP5 A;  3GWX A;  5DLR A;  3RLJ A;  3VT5 A;  3X36 A;  1M2Z A;  4E4Q A;  2E2R A;  3OMP A;  4RFW A;  3A2J A;  2HB8 A;  4OZT U;  1ILH A;  1DKF A;  4E4K A;  1MV9 A;  1R20 A;  2GTK A;  5C4T A;  4APU A;  3GBK A;  1Q4X A;  2ZK0 A;  4G2I A;  3UVV B;  3CDP A;  1FM9 D;  2P15 A;  5HJP A;  3VSO A;  1K74 D;  3S9S A;  4CI5 A;  5KRI A;  2JJ3 A;  2ZMI A;  3RVF A;  5L7H A;  4RUJ A;  1PRG A;  3B1M A;  3B66 A;  2PIN A;  1ZDT A;  3AUQ A;  3OLF A;  5JJM A;  5DX3 B;  4K6I A;  3CJW A;  4MDD A;  1LV2 A;  4S0T A;  5KD9 A;  2P1T A;  3OS9 A;  3JZC A;  3AZ2 A;  5AZT A;  2QGW A;  1RDT D;  1L2J A;  3FEJ A;  4WPF A;  3OMK A;  1PCG A;  4OEZ A;  3W5P A;  2AMB A;  4ZOM A;  1QKN A;  5C4O A;  4DM8 A;  3ET1 A;  3B0Q A;  3UVV A;  2HB7 A;  3B0R A;  4ZNW A;  4UDB A;  4UDD A;  3W0A A;  2ZL9 A;  5KRC A;  2YLP A;  4MGD B;  1FM6 A;  3M7R A;  5DKS A;  1G2N A;  2P7A A;  4G1D A;  1KV6 A;  3V49 A;  4DK7 A;  3R29 A;  3OS8 C;  5DZI A;  2GP7 A;  3NSQ A;  2R6W A;  1GS4 A;  5AK2 A;  1XJ7 A;  2ACL B;  4J26 A;  5DX3 A;  3WT7 A;  5GIC A;  4IV2 A;  4YNK A;  3VT6 A;  2P1U A;  1XP6 A;  4BCR A;  3E00 D;  2PIU A;  5DKG A;  2AAX A;  1VJB A;  3L3X A;  3OMM A;  2H77 A;  2FVJ A;  4R6S A;  5KRF A;  1FCY A;  4TUZ B;  3W5T A;  4MG9 B;  5DMF A;  4RME A;  4POJ A;  3W0G A;  2POB A;  1NYX A;  1K7L A;  3ADS A;  1UPW A;  1T79 A;  4R06 A;  4IVW A;  4XLD A;  4ONI A;  2HAS A;  2XKW A;  4MGD A;  4YT1 A;  2AB2 A;  3B3K A;  2VV1 A;  3RLL A;  2VV0 A;  3WFF A;  2AX8 A;  5G44 A;  1XNN A;  3L0L A;  3X31 A;  1XIU A;  1ZGY A;  2GPV A;  3VJI A;  2ACL A;  1YJE A;  5GID A;  2PIT A;  4B7W A;  3OMQ A;  5E0W A;  2Q7I A;  3F7D A;  3HLV A;  1RDT A;  1T7M A;  5KRH A;  4TUZ A;  4OJ4 A;  1S9P A;  3W0J A;  3W0I A;  5DXM A;  1HJ1 A;  5FQS A;  3T03 A;  4IWF A;  1FCX A;  5IZ0 A;  3VT8 A;  3OGT A;  5FQV A;  5AAV A;  5KCD A;  2I0J A;  4JL4 A;  3IXP A;  3Q95 B;  2ZVT A;  3UUC A;  5L7E A;  2XHS A;  2QW4 A;  5DSH A;  1FD0 A;  1U3S A;  3DZU A;  1LBD A;  3VRV A;  3E00 A;  2ZK5 A;  5DUG A;  4RMC A;  3PEQ A;  5KCE A;  3FS1 A;  2Q3Y A;  3VRU A;  2AWH A;  5IAW A;  2PIO A;  5DIG A;  5EGV A;  5FQT A;  2PKL A;  3AZ3 A;  5E0X A;  2G5O A;  2JF9 A;  2PIQ A;  2R40 D;  4N8R A;  2OAX A;  4J5W C;  3CLD A;  3Q95 A;  4WLB A;  3FAL B;  3R5M A;  3IPQ A;  1T74 A;  5LGA A;  2ZFX A;  3V4A A;  5KR9 A;  3DCU A;  5EJV A;  2QGT A;  4RZF A;  2JFA A;  3E7C A;  2HVC A;  2PJL A;  3G0W A;  5DK9 A;  3R8A A;  2YFE A;  5L7G A;  5AWK A;  1XPC A;  5AYG A;  3W0C A;  1ERR A;  4ZO1 B;  1ERE A;  3U9Q A;  4PLE A;  3D5F A;  5DWE A;  5KRA A;  3VJH A;  2HAM A;  1EXX A;  1OT7 A;  1XVP B;  2HWR A;  2ZK3 A;  3HOD A;  4LSJ A;  2HAR A;  3WWR A;  5DXK A;  3AX8 A;  2QAB A;  1XOW A;  2QXM A;  2Q6S A;  3FC6 B;  5G45 A;  5DUE A;  1A28 A;  3K8S A;  5G42 A;  3VSP A;  4DQM A;  3OZJ A;  2YAT A;  3VHW A;  3X1I A;  4OKW A;  2ZNO A;  3VJS A;  3ZRB A;  1UOM A;  3KFC A;  2Q1V A;  3W5Q A;  2AX6 A;  5IXK A;  2VV4 B;  1U3Q A;  3IA6 A;  4PPP A;  2Q7K A;  5DIE A;  2LBD A;  1TXI A;  2AXA A;  4OFR A;  3HQ5 A;  5DWJ A;  3DZY A;  2FAI A;  1UHL A;  2NPA A;  3OS8 A;  1XVP A;  5DWI A;  2B50 A;  2HWQ A;  1T7R A;  1GWR A;  2QNV A;  3WGP A;  2QZO B;  5GT4 A;  1I7G A;  3CS4 A;  3HC6 A;  3PCU A;  4NQA B;  2YLY A;  3FC6 A;  4DMA A;  1TFC A;  4UDA A;  2R40 A;  5DYD A;  2P4Y A;  5DXB A;  3KMR A;  5C4U A;  5KCT A;  3V9T A;  1P93 A;  3D24 A;  3FUR A;  3H52 A;  3A40 X;  2EWP A;  2Q5G A;  2VV3 A;  3L1B A;  4IW6 A;  5DXQ A;  3R8I A;  3TKM A;  5JY3 A;  5DY8 A;  1FCZ A;  2QPY A;  2VV4 A;  4KZM A;  2ZK2 A;  3O1D A;  1XQ3 A;  2Q5P A;  1Z95 A;  5KYJ A;  1WM0 X;  5AVL A;  5B5B A;  2PIV A;  4OJ9 A;  5LWP A;  2ZXM A;  5ICK A;  4MG5 A;  1MZN A;  2O4R A;  4PRG A;  2J7X A;  4HEE X;  4N5G A;  3WFG A;  1SR7 A;  2NW4 A;  1N83 A;  2QZO A;  4O8F A;  2IOK A;  2ZMJ A;  4A2J A;  1RJK A;  2G44 A;  2V0V A;  2ZMH A;  4OZT E;  3ERD A;  2Q7L A;  4FHH A;  4PLD A;  5DVC A;  2VST A;  2O9I A;  3MNP A;  4MGC A;  1RKH A;  3VHV A;  5E14 A;  4OFU A;  1DB1 A;  3ADU A;  3B68 A;  4E2J A;  1UPV A;  3AUN A;  2I4J A;  3IXP D;  4EMA A;  3ADX A;  3KWY A;  1X7J A;  2VV1 B;  4ZO1 X;  1PQ6 A;  4RWV A;  5EHJ A;  2GIU A;  1M13 A;  5EC9 A;  2P54 A;  5DU5 A;  3VT3 A;  3KPZ A;  1ZEO A;  4WHF A;  1SJ0 A;  3VTC A;  1XLS A;  2AA6 A;  1ZH7 A;  3GWS X;  2B1V A;  2QXS A;  3DZU D;  3UU7 B;  2IOG A;  4G20 A;  1ZKY A;  4TV1 B;  2XYJ A;  1YIM A;  5KRL A;  3IMY A;  1U9E A;  1T7T A;  4HLW A;  4EM9 A;  4OKX A;  4LBD A;  2Q7J A;  5DZ0 A;  3MNO A;  4MG8 B;  2W8Y A;  3K22 A;  4PWL A;  5AAV B;  3V9Y A;  3GYU A;  3FLI A;  4IV4 A;  3DY6 A;  4N73 A;  1ZAF A;  4REE A;  5KRJ A;  4RE8 A;  3OAP A;  1XNX A;  3ADV A;  3CDS A;  1PK5 A;  5DRM A;  2PNU A;  2B23 A;  4JGV A;  4OED A;  4J5W A;  4JYI A;  2I4P A;  2O4J A;  3DT3 A;  4XAO A;  4MGB B;  5APH A;  3SP9 A;  3NSP A;  1T63 A;  4WVD A;  1X7E A;  3UU7 A;  3SZ1 A;  4ZNS A;  1XP9 A;  3NOA A;  3HZF A;  1Z5X U;  4PP6 A;  4LTW A;  1PQ9 A;  3ADT A;  4TV1 A;  4DOS A;  1G5Y A;  2Z4B A;  2ZAS A;  1T5Z A;  4S15 A;  4PP3 A;  4MG8 A;  3JZB A;  4POH A;  2AX9 A;  5CJ6 A;  4IA7 A;  3OLS A;  4XT9 A;  5ACC A;  3A3Z X;  3H0A D;  2P7G A;  3VT9 A;  1T65 A;  2QR9 A;  2REW A;  4OK1 A;  2BAW A;  2ZK4 A;  1G50 A;  5AZV A;  1I7I A;  2ZNN A;  4WQP A;  3CS6 A;  2JFA B;  1XDK B;  4FNE A;  4XHD A;  3VI8 A;  3UUA B;  3VRW A;  4ZN9 A;  4MGB A;  5DXR A;  3BQD A;  5DKB A;  4MG7 B;  1QKT A;  3TX7 B;  3UP0 A;  3DZY D;  1EXA A;  2Z4J A;  4OLM A;  2GPP A;  3RUT A;  2YJA B;  3F5C B;  2Q5S A;  2AO6 A;  2PIW A;  1NDE A;  4QL8 A;  1Z5X E;  3ZR7 A;  1E3G A;  2IHQ A;  4Q0A C;  3K23 A;  4FGY A;  4NIE A;  3B67 A;  3V3E A;  2Q61 A;  4ZNV A;  4P6X A;  3A2H A;  4RMD A;  2AA2 A;  1OVL A;  3CQV A;  3KBA A;  4NB6 A;  4OIV A;  5E19 A;  1E3K A;  4S0S A;  4QK4 A;  3E94 A;  1PQC A;  4PF3 A;  2I4Z A;  3WTQ A;  5HYK A;  2AX7 A;  1NRL A;  3ERT A;  1XDK A;  4ZNT A;  5HJS A;  4L96 A;  3UUA A;  4MGA B;  5DZH A;  1FBY A;  3L03 A;  4MG7 A;  2ZXN A;  3GZ9 A;  3OSW A;  1S19 A;  1UHL B;  2PIP L;  3BEJ A;  3ET3 A;  2QSE A;  3F5C A;  3OKH A;  1XLS E;  3P88 A;  2ZK1 A;  4CSJ A;  3ADW A;  3PLZ A;  1XZX X;  1R1K D;  2Q8S A;  3D90 A;  1NAX A;  5A86 A;  3TY0 A;  4RZE A;  2Q60 A;  3VT7 A;  3EYB A;  3GN8 A;  4Q50 A;  5DVS A;  1Y0X X;  5SYZ A;  4YMQ A;  4IUI A;  3B5R A;  3PRG A;  3OSA A;  2HBH A;  3ILZ A;  5DXB B;  3VN2 A;  4M8E A;  5AAU A;  3H0A A;  2Q6J A;  4OKB A;  5DYB A;  4WHG A;  1X76 A;  2PIR A;  2ZK6 A;  3L3Z A;  4IVY A;  4OJB A;  4OH6 A;  3V9V A;  2QE4 A;  4QM0 A;  3WT5 A;  4MGA A;  3D6D A;  2AM9 A;  4DM6 A;  4A4V A;  5B41 A;  2GPU A;  4K7A A;  4RUO X;  2HCD A;  3L0E A;  2BJ4 A;  1NQ1 A;  3TKC A;  4LNX A;  3DCT A;  2H79 A;  4P6W A;  5DV6 A;  5G5W A;  1ZUC A;  4JYH A;  1KNU A;  4OKT A;  3HO0 A;  2OCF A;  4S14 A;  1IE8 A;  1Y9R A;  5EIT A;  3VRT A;  3W5R A;  3G9E A;  4J5X C;  5F9B A;  2FSZ A;  5HZC A;  1OSH A;  1YMT A;  1YP0 A;  2G0G A;  3P8X A;  5DWG A;  5AWJ A;  4G2H A;  3VHU A;  1I37 A;  4X1G A;  1PDU A;  5E7V A;  2OM9 A;  2XYW A;  2GL8 A;  1YA3 A;  2PRG A;  4OGH A;  3RUU A;  5E1C A;  2OVH A;  1R1K A;  2ZLC A;  3IPS A;  1G1U A;  3VJT A;  3AN4 A;  3HM1 A;  2ATH A;  4OH5 A;  4R2U A;  1XQC A;  3K6P A;  4RUP A;  5DID A;  5H1E A;  3GD2 A;  1T76 A;  3KDU A;  2F4B A;  3OKI A;  3A2I A;  4M8H A;  5DXG A;  4PPS A;  1N4H A;  5EI1 A;  4IW8 A;  5DXP A;  2A3I A;  1GWX A;  1IE9 A;  3W0Y A;  4XUM A;  2YJD A;  5KCW A;  4PXM A;  1P8D A;  5DV3 A;  4XI3 A;  3SP6 A;  4OZR U;  4RAK A;  2ZNQ A;  3OZ0 A;  1XAP A;  3AFR A;  5ETH A;  3CS8 A;  1NUO A; 
#chains in the Genus database with same CATH topology
 2QH6 A;  1K4W A;  3WMH A;  3FUG A;  1XB7 A;  3A78 A;  4J24 A;  1NQ2 A;  4YPQ A;  3PBA A;  2NXX E;  3RY9 A;  3OLL A;  4QJR A;  5FQR A;  1YUC A;  2HFP A;  3R8D A;  1QKM A;  1X78 A;  1XV9 B;  3VT4 A;  5DP0 A;  2GWX A;  2R6Y A;  2ZKC A;  1NAV A;  3L0J A;  3X1H A;  5I4V A;  5DI7 A;  2Q59 B;  2AA7 A;  4OIU A;  2XYX A;  2P1V A;  4DK8 A;  3KMG A;  2NV7 A;  3B65 A;  1M7W A;  2GPO A;  2QA8 B;  4IS8 A;  4MG6 A;  4OZR E;  1T7F A;  5DZ1 A;  5DMC A;  5K13 A;  2Q70 A;  3OSI A;  2G0H A;  3A9E B;  5KRO A;  3CTB A;  4Y29 A;  1KKQ A;  4Q13 A;  4ZNH A;  3LMP A;  1SQN A;  2VSR A;  2VV2 A;  1H9U A;  4IA1 A;  3R5N A;  4IA2 A;  4ZNU A;  3ZQT A;  1XP1 A;  1XV9 A;  1BSX A;  1FM9 A;  2YLO A;  1YOK A;  3OMO A;  5DWL A;  5KCF A;  2AMA A;  5FQP A;  4ZJW A;  1OVL B;  4JAZ A;  1K74 A;  3LBD A;  1Y0S A;  2Q6R A;  2Q59 A;  2J4A A;  2OVM A;  3QT0 A;  1NQ7 A;  1OSV A;  4KZI A;  3HC5 A;  4F9M A;  4JYG A;  4OAR A;  2QA8 A;  5KCC A;  1U3R A;  3OOF A;  4K4J A;  3UP3 A;  2P7Z A;  4NY9 A;  4OHA A;  5L11 A;  3G8I A;  4L98 A;  4PVU A;  3A9E A;  1PZL A;  3G8O A;  3VTD A;  3DR1 A;  5AVI A;  4G21 A;  4OEY A;  4ZN7 A;  1RKG A;  3MNE A;  5KRM A;  5DUH A;  3OOK A;  4MG9 A;  2J14 A;  1I38 A;  2YLQ A;  2QTU A;  5DTV A;  5KYA A;  1QKU A;  5GIE A;  5E15 A;  4OC7 A;  3AN3 A;  2PIX A;  4UDC A;  2QMV A;  1X7B A;  3VTB A;  5M96 A;  4LNW A;  3WT6 A;  3KMZ A;  1NQ0 A;  4ZJR A;  4N1Y A;  4QE8 A;  2B1Z A;  5G43 A;  4RZG A;  1YY4 A;  2ZXZ A;  1MVC A;  5DL4 A;  1NHZ A;  5DKE A;  4ITE A;  4XTA A;  3N00 A;  1YIN A;  3P89 A;  5HYR A;  1YYE A;  4IWC A;  4J5X A;  3ZRA A;  4G1Y A;  1S0Z A;  1ZDU A;  2ZY0 A;  2NXX A;  3FXV A;  4QE6 A;  4XUH A;  3KYT A;  5KRK A;  5DV8 A;  2V7C A;  3WJ4 A;  1S9Q A;  2ABI A;  2BJ4 B;  2J7Y A;  2OUZ A;  3B0W A;  5JI0 D;  3HVL A;  2ZLA A;  2Q1H A;  1ILG A;  2QA6 A;  1X7R A;  3UUD B;  1T73 A;  4OEA A;  1R20 D;  2AYR A;  1R5K A;  3PO9 A;  5APJ A;  5HCV A;  4FN9 A;  4NUF A;  4ZI1 A;  2AA5 A;  3IPU A;  1L2I A;  1RK3 A;  2POG A;  3V3Q A;  5DVV A;  4REF A;  3GYT A;  2I0G A;  3ET0 A;  4FHI A;  5G3J A;  3WJ5 A;  4OIL A;  3CWD A;  3B0T A;  4CI4 A;  1R6G A;  5C4S A;  1A52 A;  4IU7 A;  3R2A A;  5DXE A;  1DKF B;  2HC4 A;  3UUD A;  4ITF A;  3AUR A;  4DOR A;  1GWQ A;  3O1E A;  4X1F A;  5KCU A;  3D57 A;  2OZ7 A;  3BC5 A;  3FAL A;  1S0X A;  3KDT A;  5DRJ A;  1YOW A;  2YHD A;  5APK A;  5HJP B;  5G46 A;  3P0U A;  1FM6 D;  1N46 A;  3FEI A;  5DZ3 A;  4A4W A;  4G1Z A;  1HG4 A;  4KZJ A;  3AZ1 A;  4IQR A;  5JJM B;  2ZBS A;  1SKX A;  4IA3 A;  3W0H A;  3ET2 A;  2ZNP A;  4PP5 A;  3GWX A;  5DLR A;  3RLJ A;  3VT5 A;  3X36 A;  1M2Z A;  4E4Q A;  2E2R A;  3OMP A;  4RFW A;  3A2J A;  2HB8 A;  4OZT U;  1ILH A;  1DKF A;  4E4K A;  1MV9 A;  1R20 A;  2GTK A;  5C4T A;  4APU A;  3GBK A;  1Q4X A;  2ZK0 A;  4G2I A;  3UVV B;  3CDP A;  1FM9 D;  2P15 A;  5HJP A;  3VSO A;  1K74 D;  3S9S A;  4CI5 A;  5KRI A;  2JJ3 A;  2ZMI A;  3RVF A;  5L7H A;  4RUJ A;  1PRG A;  3B1M A;  3B66 A;  2PIN A;  1ZDT A;  3AUQ A;  3OLF A;  5JJM A;  5DX3 B;  4K6I A;  3CJW A;  4MDD A;  1LV2 A;  4S0T A;  5KD9 A;  2P1T A;  3OS9 A;  3JZC A;  3AZ2 A;  5AZT A;  2QGW A;  1RDT D;  1L2J A;  3FEJ A;  4WPF A;  3OMK A;  1PCG A;  4OEZ A;  3W5P A;  2AMB A;  4ZOM A;  1QKN A;  5C4O A;  4DM8 A;  3ET1 A;  3B0Q A;  3UVV A;  2HB7 A;  3B0R A;  4ZNW A;  4UDB A;  4UDD A;  3W0A A;  2ZL9 A;  5KRC A;  2YLP A;  4MGD B;  1FM6 A;  3M7R A;  5DKS A;  1G2N A;  2P7A A;  4G1D A;  1KV6 A;  3V49 A;  4DK7 A;  3R29 A;  3OS8 C;  5DZI A;  2GP7 A;  3NSQ A;  2R6W A;  1GS4 A;  5AK2 A;  1XJ7 A;  2ACL B;  4J26 A;  5DX3 A;  3WT7 A;  5GIC A;  4IV2 A;  4YNK A;  3VT6 A;  2P1U A;  1XP6 A;  4BCR A;  3E00 D;  2PIU A;  5DKG A;  2AAX A;  1VJB A;  3L3X A;  3OMM A;  2H77 A;  2FVJ A;  4R6S A;  5KRF A;  1FCY A;  4TUZ B;  3W5T A;  4MG9 B;  5DMF A;  4RME A;  4POJ A;  3W0G A;  2POB A;  1NYX A;  1K7L A;  3ADS A;  1UPW A;  1T79 A;  4R06 A;  4IVW A;  4XLD A;  4ONI A;  2HAS A;  2XKW A;  4MGD A;  4YT1 A;  2AB2 A;  3B3K A;  2VV1 A;  3RLL A;  2VV0 A;  3WFF A;  2AX8 A;  5G44 A;  1XNN A;  3L0L A;  3X31 A;  1XIU A;  1ZGY A;  2GPV A;  3VJI A;  2ACL A;  1YJE A;  5GID A;  2PIT A;  4B7W A;  3OMQ A;  5E0W A;  2Q7I A;  3F7D A;  3HLV A;  1RDT A;  1T7M A;  5KRH A;  4TUZ A;  4OJ4 A;  1S9P A;  3W0J A;  3W0I A;  5DXM A;  1HJ1 A;  5FQS A;  3T03 A;  4IWF A;  1FCX A;  5IZ0 A;  3VT8 A;  3OGT A;  5FQV A;  5AAV A;  5KCD A;  2I0J A;  4JL4 A;  3IXP A;  3Q95 B;  2ZVT A;  3UUC A;  5L7E A;  2XHS A;  2QW4 A;  5DSH A;  1FD0 A;  1U3S A;  3DZU A;  1LBD A;  3VRV A;  3E00 A;  2ZK5 A;  5DUG A;  4RMC A;  3PEQ A;  5KCE A;  3FS1 A;  2Q3Y A;  3VRU A;  2AWH A;  5IAW A;  2PIO A;  5DIG A;  5EGV A;  5FQT A;  2PKL A;  3AZ3 A;  5E0X A;  2G5O A;  2JF9 A;  2PIQ A;  2R40 D;  4N8R A;  2OAX A;  4J5W C;  3CLD A;  3Q95 A;  4WLB A;  3FAL B;  3R5M A;  3IPQ A;  1T74 A;  5LGA A;  2ZFX A;  3V4A A;  5KR9 A;  3DCU A;  5EJV A;  2QGT A;  4RZF A;  2JFA A;  3E7C A;  2HVC A;  2PJL A;  3G0W A;  5DK9 A;  3R8A A;  2YFE A;  5L7G A;  5AWK A;  1XPC A;  5AYG A;  3W0C A;  1ERR A;  4ZO1 B;  1ERE A;  3U9Q A;  4PLE A;  3D5F A;  5DWE A;  5KRA A;  3VJH A;  2HAM A;  1EXX A;  1OT7 A;  1XVP B;  2HWR A;  2ZK3 A;  3HOD A;  4LSJ A;  2HAR A;  3WWR A;  5DXK A;  3AX8 A;  2QAB A;  1XOW A;  2QXM A;  2Q6S A;  3FC6 B;  5G45 A;  5DUE A;  1A28 A;  3K8S A;  5G42 A;  3VSP A;  4DQM A;  3OZJ A;  2YAT A;  3VHW A;  3X1I A;  4OKW A;  2ZNO A;  3VJS A;  3ZRB A;  1UOM A;  3KFC A;  2Q1V A;  3W5Q A;  2AX6 A;  5IXK A;  2VV4 B;  1U3Q A;  3IA6 A;  4PPP A;  2Q7K A;  5DIE A;  2LBD A;  1TXI A;  2AXA A;  4OFR A;  3HQ5 A;  5DWJ A;  3DZY A;  2FAI A;  1UHL A;  2NPA A;  3OS8 A;  1XVP A;  5DWI A;  2B50 A;  2HWQ A;  1T7R A;  1GWR A;  2QNV A;  3WGP A;  2QZO B;  5GT4 A;  1I7G A;  3CS4 A;  3HC6 A;  3PCU A;  4NQA B;  2YLY A;  3FC6 A;  4DMA A;  1TFC A;  4UDA A;  2R40 A;  5DYD A;  2P4Y A;  5DXB A;  3KMR A;  5C4U A;  5KCT A;  3V9T A;  1P93 A;  3D24 A;  3FUR A;  3H52 A;  3A40 X;  2EWP A;  2Q5G A;  2VV3 A;  3L1B A;  4IW6 A;  5DXQ A;  3R8I A;  3TKM A;  5JY3 A;  5DY8 A;  1FCZ A;  2QPY A;  2VV4 A;  4KZM A;  2ZK2 A;  3O1D A;  1XQ3 A;  2Q5P A;  1Z95 A;  5KYJ A;  1WM0 X;  5AVL A;  5B5B A;  2PIV A;  4OJ9 A;  5LWP A;  2ZXM A;  5ICK A;  4MG5 A;  1MZN A;  2O4R A;  4PRG A;  2J7X A;  4HEE X;  4N5G A;  3WFG A;  1SR7 A;  2NW4 A;  1N83 A;  2QZO A;  4O8F A;  2IOK A;  2ZMJ A;  4A2J A;  1RJK A;  2G44 A;  2V0V A;  2ZMH A;  4OZT E;  3ERD A;  2Q7L A;  4FHH A;  4PLD A;  5DVC A;  2VST A;  2O9I A;  3MNP A;  4MGC A;  1RKH A;  3VHV A;  5E14 A;  4OFU A;  1DB1 A;  3ADU A;  3B68 A;  4E2J A;  1UPV A;  3AUN A;  2I4J A;  3IXP D;  4EMA A;  3ADX A;  3KWY A;  1X7J A;  2VV1 B;  4ZO1 X;  1PQ6 A;  4RWV A;  5EHJ A;  2GIU A;  1M13 A;  5EC9 A;  2P54 A;  5DU5 A;  3VT3 A;  3KPZ A;  1ZEO A;  4WHF A;  1SJ0 A;  3VTC A;  1XLS A;  2AA6 A;  1ZH7 A;  3GWS X;  2B1V A;  2QXS A;  3DZU D;  3UU7 B;  2IOG A;  4G20 A;  1ZKY A;  4TV1 B;  2XYJ A;  1YIM A;  5KRL A;  3IMY A;  1U9E A;  1T7T A;  4HLW A;  4EM9 A;  4OKX A;  4LBD A;  2Q7J A;  5DZ0 A;  3MNO A;  4MG8 B;  2W8Y A;  3K22 A;  4PWL A;  5AAV B;  3V9Y A;  3GYU A;  3FLI A;  4IV4 A;  3DY6 A;  4N73 A;  1ZAF A;  4REE A;  5KRJ A;  4RE8 A;  3OAP A;  1XNX A;  3ADV A;  3CDS A;  1PK5 A;  5DRM A;  2PNU A;  2B23 A;  4JGV A;  4OED A;  4J5W A;  4JYI A;  2I4P A;  2O4J A;  3DT3 A;  4XAO A;  4MGB B;  5APH A;  3SP9 A;  3NSP A;  1T63 A;  4WVD A;  1X7E A;  3UU7 A;  3SZ1 A;  4ZNS A;  1XP9 A;  3NOA A;  3HZF A;  1Z5X U;  4PP6 A;  4LTW A;  1PQ9 A;  3ADT A;  4TV1 A;  4DOS A;  1G5Y A;  2Z4B A;  2ZAS A;  1T5Z A;  4S15 A;  4PP3 A;  4MG8 A;  3JZB A;  4POH A;  2AX9 A;  5CJ6 A;  4IA7 A;  3OLS A;  4XT9 A;  5ACC A;  3A3Z X;  3H0A D;  2P7G A;  3VT9 A;  1T65 A;  2QR9 A;  2REW A;  4OK1 A;  2BAW A;  2ZK4 A;  1G50 A;  5AZV A;  1I7I A;  2ZNN A;  4WQP A;  3CS6 A;  2JFA B;  1XDK B;  4FNE A;  4XHD A;  3VI8 A;  3UUA B;  3VRW A;  4ZN9 A;  4MGB A;  5DXR A;  3BQD A;  5DKB A;  4MG7 B;  1QKT A;  3TX7 B;  3UP0 A;  3DZY D;  1EXA A;  2Z4J A;  4OLM A;  2GPP A;  3RUT A;  2YJA B;  3F5C B;  2Q5S A;  2AO6 A;  2PIW A;  1NDE A;  4QL8 A;  1Z5X E;  3ZR7 A;  1E3G A;  2IHQ A;  4Q0A C;  3K23 A;  4FGY A;  4NIE A;  3B67 A;  3V3E A;  2Q61 A;  4ZNV A;  4P6X A;  3A2H A;  4RMD A;  2AA2 A;  1OVL A;  3CQV A;  3KBA A;  4NB6 A;  4OIV A;  5E19 A;  1E3K A;  4S0S A;  4QK4 A;  3E94 A;  1PQC A;  4PF3 A;  2I4Z A;  3WTQ A;  5HYK A;  2AX7 A;  1NRL A;  3ERT A;  1XDK A;  4ZNT A;  5HJS A;  4L96 A;  3UUA A;  4MGA B;  5DZH A;  1FBY A;  3L03 A;  4MG7 A;  2ZXN A;  3GZ9 A;  3OSW A;  1S19 A;  1UHL B;  2PIP L;  3BEJ A;  3ET3 A;  2QSE A;  3F5C A;  3OKH A;  1XLS E;  3P88 A;  2ZK1 A;  4CSJ A;  3ADW A;  3PLZ A;  1XZX X;  1R1K D;  2Q8S A;  3D90 A;  1NAX A;  5A86 A;  3TY0 A;  4RZE A;  2Q60 A;  3VT7 A;  3EYB A;  3GN8 A;  4Q50 A;  5DVS A;  1Y0X X;  5SYZ A;  4YMQ A;  4IUI A;  3B5R A;  3PRG A;  3OSA A;  2HBH A;  3ILZ A;  5DXB B;  3VN2 A;  4M8E A;  5AAU A;  3H0A A;  2Q6J A;  4OKB A;  5DYB A;  4WHG A;  1X76 A;  2PIR A;  2ZK6 A;  3L3Z A;  4IVY A;  4OJB A;  4OH6 A;  3V9V A;  2QE4 A;  4QM0 A;  3WT5 A;  4MGA A;  3D6D A;  2AM9 A;  4DM6 A;  4A4V A;  5B41 A;  2GPU A;  4K7A A;  4RUO X;  2HCD A;  3L0E A;  2BJ4 A;  1NQ1 A;  3TKC A;  4LNX A;  3DCT A;  2H79 A;  4P6W A;  5DV6 A;  5G5W A;  1ZUC A;  4JYH A;  1KNU A;  4OKT A;  3HO0 A;  2OCF A;  4S14 A;  1IE8 A;  1Y9R A;  5EIT A;  3VRT A;  3W5R A;  3G9E A;  4J5X C;  5F9B A;  2FSZ A;  5HZC A;  1OSH A;  1YMT A;  1YP0 A;  2G0G A;  3P8X A;  5DWG A;  5AWJ A;  4G2H A;  3VHU A;  1I37 A;  4X1G A;  1PDU A;  5E7V A;  2OM9 A;  2XYW A;  2GL8 A;  1YA3 A;  2PRG A;  4OGH A;  3RUU A;  5E1C A;  2OVH A;  1R1K A;  2ZLC A;  3IPS A;  1G1U A;  3VJT A;  3AN4 A;  3HM1 A;  2ATH A;  4OH5 A;  4R2U A;  1XQC A;  3K6P A;  4RUP A;  5DID A;  5H1E A;  3GD2 A;  1T76 A;  3KDU A;  2F4B A;  3OKI A;  3A2I A;  4M8H A;  5DXG A;  4PPS A;  1N4H A;  5EI1 A;  4IW8 A;  5DXP A;  2A3I A;  1GWX A;  1IE9 A;  3W0Y A;  4XUM A;  2YJD A;  5KCW A;  4PXM A;  1P8D A;  5DV3 A;  4XI3 A;  3SP6 A;  4OZR U;  4RAK A;  2ZNQ A;  3OZ0 A;  1XAP A;  3AFR A;  5ETH A;  3CS8 A;  1NUO A; 
#chains in the Genus database with same CATH homology
 2QH6 A;  1K4W A;  3WMH A;  3FUG A;  1XB7 A;  3A78 A;  4J24 A;  1NQ2 A;  4YPQ A;  3PBA A;  2NXX E;  3RY9 A;  3OLL A;  4QJR A;  5FQR A;  1YUC A;  2HFP A;  3R8D A;  1QKM A;  1X78 A;  1XV9 B;  3VT4 A;  5DP0 A;  2GWX A;  2R6Y A;  2ZKC A;  1NAV A;  3L0J A;  3X1H A;  5I4V A;  5DI7 A;  2Q59 B;  2AA7 A;  4OIU A;  2XYX A;  2P1V A;  4DK8 A;  3KMG A;  2NV7 A;  3B65 A;  1M7W A;  2GPO A;  2QA8 B;  4IS8 A;  4MG6 A;  4OZR E;  1T7F A;  5DZ1 A;  5DMC A;  5K13 A;  2Q70 A;  3OSI A;  2G0H A;  3A9E B;  5KRO A;  3CTB A;  4Y29 A;  1KKQ A;  4Q13 A;  4ZNH A;  3LMP A;  1SQN A;  2VSR A;  2VV2 A;  1H9U A;  4IA1 A;  3R5N A;  4IA2 A;  4ZNU A;  3ZQT A;  1XP1 A;  1XV9 A;  1BSX A;  1FM9 A;  2YLO A;  1YOK A;  3OMO A;  5DWL A;  5KCF A;  2AMA A;  5FQP A;  4ZJW A;  1OVL B;  4JAZ A;  1K74 A;  3LBD A;  1Y0S A;  2Q6R A;  2Q59 A;  2J4A A;  2OVM A;  3QT0 A;  1NQ7 A;  1OSV A;  4KZI A;  3HC5 A;  4F9M A;  4JYG A;  4OAR A;  2QA8 A;  5KCC A;  1U3R A;  3OOF A;  4K4J A;  3UP3 A;  2P7Z A;  4NY9 A;  4OHA A;  5L11 A;  3G8I A;  4L98 A;  4PVU A;  3A9E A;  1PZL A;  3G8O A;  3VTD A;  3DR1 A;  5AVI A;  4G21 A;  4OEY A;  4ZN7 A;  1RKG A;  3MNE A;  5KRM A;  5DUH A;  3OOK A;  4MG9 A;  2J14 A;  1I38 A;  2YLQ A;  2QTU A;  5DTV A;  5KYA A;  1QKU A;  5GIE A;  5E15 A;  4OC7 A;  3AN3 A;  2PIX A;  4UDC A;  2QMV A;  1X7B A;  3VTB A;  5M96 A;  4LNW A;  3WT6 A;  3KMZ A;  1NQ0 A;  4ZJR A;  4N1Y A;  4QE8 A;  2B1Z A;  5G43 A;  4RZG A;  1YY4 A;  2ZXZ A;  1MVC A;  5DL4 A;  1NHZ A;  5DKE A;  4ITE A;  4XTA A;  3N00 A;  1YIN A;  3P89 A;  5HYR A;  1YYE A;  4IWC A;  4J5X A;  3ZRA A;  4G1Y A;  1S0Z A;  1ZDU A;  2ZY0 A;  2NXX A;  3FXV A;  4QE6 A;  4XUH A;  3KYT A;  5KRK A;  5DV8 A;  2V7C A;  3WJ4 A;  1S9Q A;  2ABI A;  2BJ4 B;  2J7Y A;  2OUZ A;  3B0W A;  5JI0 D;  3HVL A;  2ZLA A;  2Q1H A;  1ILG A;  2QA6 A;  1X7R A;  3UUD B;  1T73 A;  4OEA A;  1R20 D;  2AYR A;  1R5K A;  3PO9 A;  5APJ A;  5HCV A;  4FN9 A;  4NUF A;  4ZI1 A;  2AA5 A;  3IPU A;  1L2I A;  1RK3 A;  2POG A;  3V3Q A;  5DVV A;  4REF A;  3GYT A;  2I0G A;  3ET0 A;  4FHI A;  5G3J A;  3WJ5 A;  4OIL A;  3CWD A;  3B0T A;  4CI4 A;  1R6G A;  5C4S A;  1A52 A;  4IU7 A;  3R2A A;  5DXE A;  1DKF B;  2HC4 A;  3UUD A;  4ITF A;  3AUR A;  4DOR A;  1GWQ A;  3O1E A;  4X1F A;  5KCU A;  3D57 A;  2OZ7 A;  3BC5 A;  3FAL A;  1S0X A;  3KDT A;  5DRJ A;  1YOW A;  2YHD A;  5APK A;  5HJP B;  5G46 A;  3P0U A;  1FM6 D;  1N46 A;  3FEI A;  5DZ3 A;  4A4W A;  4G1Z A;  1HG4 A;  4KZJ A;  3AZ1 A;  4IQR A;  5JJM B;  2ZBS A;  1SKX A;  4IA3 A;  3W0H A;  3ET2 A;  2ZNP A;  4PP5 A;  3GWX A;  5DLR A;  3RLJ A;  3VT5 A;  3X36 A;  1M2Z A;  4E4Q A;  2E2R A;  3OMP A;  4RFW A;  3A2J A;  2HB8 A;  4OZT U;  1ILH A;  1DKF A;  4E4K A;  1MV9 A;  1R20 A;  2GTK A;  5C4T A;  4APU A;  3GBK A;  1Q4X A;  2ZK0 A;  4G2I A;  3UVV B;  3CDP A;  1FM9 D;  2P15 A;  5HJP A;  3VSO A;  1K74 D;  3S9S A;  4CI5 A;  5KRI A;  2JJ3 A;  2ZMI A;  3RVF A;  5L7H A;  4RUJ A;  1PRG A;  3B1M A;  3B66 A;  2PIN A;  1ZDT A;  3AUQ A;  3OLF A;  5JJM A;  5DX3 B;  4K6I A;  3CJW A;  4MDD A;  1LV2 A;  4S0T A;  5KD9 A;  2P1T A;  3OS9 A;  3JZC A;  3AZ2 A;  5AZT A;  2QGW A;  1RDT D;  1L2J A;  3FEJ A;  4WPF A;  3OMK A;  1PCG A;  4OEZ A;  3W5P A;  2AMB A;  4ZOM A;  1QKN A;  5C4O A;  4DM8 A;  3ET1 A;  3B0Q A;  3UVV A;  2HB7 A;  3B0R A;  4ZNW A;  4UDB A;  4UDD A;  3W0A A;  2ZL9 A;  5KRC A;  2YLP A;  4MGD B;  1FM6 A;  3M7R A;  5DKS A;  1G2N A;  2P7A A;  4G1D A;  1KV6 A;  3V49 A;  4DK7 A;  3R29 A;  3OS8 C;  5DZI A;  2GP7 A;  3NSQ A;  2R6W A;  1GS4 A;  5AK2 A;  1XJ7 A;  2ACL B;  4J26 A;  5DX3 A;  3WT7 A;  5GIC A;  4IV2 A;  4YNK A;  3VT6 A;  2P1U A;  1XP6 A;  4BCR A;  3E00 D;  2PIU A;  5DKG A;  2AAX A;  1VJB A;  3L3X A;  3OMM A;  2H77 A;  2FVJ A;  4R6S A;  5KRF A;  1FCY A;  4TUZ B;  3W5T A;  4MG9 B;  5DMF A;  4RME A;  4POJ A;  3W0G A;  2POB A;  1NYX A;  1K7L A;  3ADS A;  1UPW A;  1T79 A;  4R06 A;  4IVW A;  4XLD A;  4ONI A;  2HAS A;  2XKW A;  4MGD A;  4YT1 A;  2AB2 A;  3B3K A;  2VV1 A;  3RLL A;  2VV0 A;  3WFF A;  2AX8 A;  5G44 A;  1XNN A;  3L0L A;  3X31 A;  1XIU A;  1ZGY A;  2GPV A;  3VJI A;  2ACL A;  1YJE A;  5GID A;  2PIT A;  4B7W A;  3OMQ A;  5E0W A;  2Q7I A;  3F7D A;  3HLV A;  1RDT A;  1T7M A;  5KRH A;  4TUZ A;  4OJ4 A;  1S9P A;  3W0J A;  3W0I A;  5DXM A;  1HJ1 A;  5FQS A;  3T03 A;  4IWF A;  1FCX A;  5IZ0 A;  3VT8 A;  3OGT A;  5FQV A;  5AAV A;  5KCD A;  2I0J A;  4JL4 A;  3IXP A;  3Q95 B;  2ZVT A;  3UUC A;  5L7E A;  2XHS A;  2QW4 A;  5DSH A;  1FD0 A;  1U3S A;  3DZU A;  1LBD A;  3VRV A;  3E00 A;  2ZK5 A;  5DUG A;  4RMC A;  3PEQ A;  5KCE A;  3FS1 A;  2Q3Y A;  3VRU A;  2AWH A;  5IAW A;  2PIO A;  5DIG A;  5EGV A;  5FQT A;  2PKL A;  3AZ3 A;  5E0X A;  2G5O A;  2JF9 A;  2PIQ A;  2R40 D;  4N8R A;  2OAX A;  4J5W C;  3CLD A;  3Q95 A;  4WLB A;  3FAL B;  3R5M A;  3IPQ A;  1T74 A;  5LGA A;  2ZFX A;  3V4A A;  5KR9 A;  3DCU A;  5EJV A;  2QGT A;  4RZF A;  2JFA A;  3E7C A;  2HVC A;  2PJL A;  3G0W A;  5DK9 A;  3R8A A;  2YFE A;  5L7G A;  5AWK A;  1XPC A;  5AYG A;  3W0C A;  1ERR A;  4ZO1 B;  1ERE A;  3U9Q A;  4PLE A;  3D5F A;  5DWE A;  5KRA A;  3VJH A;  2HAM A;  1EXX A;  1OT7 A;  1XVP B;  2HWR A;  2ZK3 A;  3HOD A;  4LSJ A;  2HAR A;  3WWR A;  5DXK A;  3AX8 A;  2QAB A;  1XOW A;  2QXM A;  2Q6S A;  3FC6 B;  5G45 A;  5DUE A;  1A28 A;  3K8S A;  5G42 A;  3VSP A;  4DQM A;  3OZJ A;  2YAT A;  3VHW A;  3X1I A;  4OKW A;  2ZNO A;  3VJS A;  3ZRB A;  1UOM A;  3KFC A;  2Q1V A;  3W5Q A;  2AX6 A;  5IXK A;  2VV4 B;  1U3Q A;  3IA6 A;  4PPP A;  2Q7K A;  5DIE A;  2LBD A;  1TXI A;  2AXA A;  4OFR A;  3HQ5 A;  5DWJ A;  3DZY A;  2FAI A;  1UHL A;  2NPA A;  3OS8 A;  1XVP A;  5DWI A;  2B50 A;  2HWQ A;  1T7R A;  1GWR A;  2QNV A;  3WGP A;  2QZO B;  5GT4 A;  1I7G A;  3CS4 A;  3HC6 A;  3PCU A;  4NQA B;  2YLY A;  3FC6 A;  4DMA A;  1TFC A;  4UDA A;  2R40 A;  5DYD A;  2P4Y A;  5DXB A;  3KMR A;  5C4U A;  5KCT A;  3V9T A;  1P93 A;  3D24 A;  3FUR A;  3H52 A;  3A40 X;  2EWP A;  2Q5G A;  2VV3 A;  3L1B A;  4IW6 A;  5DXQ A;  3R8I A;  3TKM A;  5JY3 A;  5DY8 A;  1FCZ A;  2QPY A;  2VV4 A;  4KZM A;  2ZK2 A;  3O1D A;  1XQ3 A;  2Q5P A;  1Z95 A;  5KYJ A;  1WM0 X;  5AVL A;  5B5B A;  2PIV A;  4OJ9 A;  5LWP A;  2ZXM A;  5ICK A;  4MG5 A;  1MZN A;  2O4R A;  4PRG A;  2J7X A;  4HEE X;  4N5G A;  3WFG A;  1SR7 A;  2NW4 A;  1N83 A;  2QZO A;  4O8F A;  2IOK A;  2ZMJ A;  4A2J A;  1RJK A;  2G44 A;  2V0V A;  2ZMH A;  4OZT E;  3ERD A;  2Q7L A;  4FHH A;  4PLD A;  5DVC A;  2VST A;  2O9I A;  3MNP A;  4MGC A;  1RKH A;  3VHV A;  5E14 A;  4OFU A;  1DB1 A;  3ADU A;  3B68 A;  4E2J A;  1UPV A;  3AUN A;  2I4J A;  3IXP D;  4EMA A;  3ADX A;  3KWY A;  1X7J A;  2VV1 B;  4ZO1 X;  1PQ6 A;  4RWV A;  5EHJ A;  2GIU A;  1M13 A;  5EC9 A;  2P54 A;  5DU5 A;  3VT3 A;  3KPZ A;  1ZEO A;  4WHF A;  1SJ0 A;  3VTC A;  1XLS A;  2AA6 A;  1ZH7 A;  3GWS X;  2B1V A;  2QXS A;  3DZU D;  3UU7 B;  2IOG A;  4G20 A;  1ZKY A;  4TV1 B;  2XYJ A;  1YIM A;  5KRL A;  3IMY A;  1U9E A;  1T7T A;  4HLW A;  4EM9 A;  4OKX A;  4LBD A;  2Q7J A;  5DZ0 A;  3MNO A;  4MG8 B;  2W8Y A;  3K22 A;  4PWL A;  5AAV B;  3V9Y A;  3GYU A;  3FLI A;  4IV4 A;  3DY6 A;  4N73 A;  1ZAF A;  4REE A;  5KRJ A;  4RE8 A;  3OAP A;  1XNX A;  3ADV A;  3CDS A;  1PK5 A;  5DRM A;  2PNU A;  2B23 A;  4JGV A;  4OED A;  4J5W A;  4JYI A;  2I4P A;  2O4J A;  3DT3 A;  4XAO A;  4MGB B;  5APH A;  3SP9 A;  3NSP A;  1T63 A;  4WVD A;  1X7E A;  3UU7 A;  3SZ1 A;  4ZNS A;  1XP9 A;  3NOA A;  3HZF A;  1Z5X U;  4PP6 A;  4LTW A;  1PQ9 A;  3ADT A;  4TV1 A;  4DOS A;  1G5Y A;  2Z4B A;  2ZAS A;  1T5Z A;  4S15 A;  4PP3 A;  4MG8 A;  3JZB A;  4POH A;  2AX9 A;  5CJ6 A;  4IA7 A;  3OLS A;  4XT9 A;  5ACC A;  3A3Z X;  3H0A D;  2P7G A;  3VT9 A;  1T65 A;  2QR9 A;  2REW A;  4OK1 A;  2BAW A;  2ZK4 A;  1G50 A;  5AZV A;  1I7I A;  2ZNN A;  4WQP A;  3CS6 A;  2JFA B;  1XDK B;  4FNE A;  4XHD A;  3VI8 A;  3UUA B;  3VRW A;  4ZN9 A;  4MGB A;  5DXR A;  3BQD A;  5DKB A;  4MG7 B;  1QKT A;  3TX7 B;  3UP0 A;  3DZY D;  1EXA A;  2Z4J A;  4OLM A;  2GPP A;  3RUT A;  2YJA B;  3F5C B;  2Q5S A;  2AO6 A;  2PIW A;  1NDE A;  4QL8 A;  1Z5X E;  3ZR7 A;  1E3G A;  2IHQ A;  4Q0A C;  3K23 A;  4FGY A;  4NIE A;  3B67 A;  3V3E A;  2Q61 A;  4ZNV A;  4P6X A;  3A2H A;  4RMD A;  2AA2 A;  1OVL A;  3CQV A;  3KBA A;  4NB6 A;  4OIV A;  5E19 A;  1E3K A;  4S0S A;  4QK4 A;  3E94 A;  1PQC A;  4PF3 A;  2I4Z A;  3WTQ A;  5HYK A;  2AX7 A;  1NRL A;  3ERT A;  1XDK A;  4ZNT A;  5HJS A;  4L96 A;  3UUA A;  4MGA B;  5DZH A;  1FBY A;  3L03 A;  4MG7 A;  2ZXN A;  3GZ9 A;  3OSW A;  1S19 A;  1UHL B;  2PIP L;  3BEJ A;  3ET3 A;  2QSE A;  3F5C A;  3OKH A;  1XLS E;  3P88 A;  2ZK1 A;  4CSJ A;  3ADW A;  3PLZ A;  1XZX X;  1R1K D;  2Q8S A;  3D90 A;  1NAX A;  5A86 A;  3TY0 A;  4RZE A;  2Q60 A;  3VT7 A;  3EYB A;  3GN8 A;  4Q50 A;  5DVS A;  1Y0X X;  5SYZ A;  4YMQ A;  4IUI A;  3B5R A;  3PRG A;  3OSA A;  2HBH A;  3ILZ A;  5DXB B;  3VN2 A;  4M8E A;  5AAU A;  3H0A A;  2Q6J A;  4OKB A;  5DYB A;  4WHG A;  1X76 A;  2PIR A;  2ZK6 A;  3L3Z A;  4IVY A;  4OJB A;  4OH6 A;  3V9V A;  2QE4 A;  4QM0 A;  3WT5 A;  4MGA A;  3D6D A;  2AM9 A;  4DM6 A;  4A4V A;  5B41 A;  2GPU A;  4K7A A;  4RUO X;  2HCD A;  3L0E A;  2BJ4 A;  1NQ1 A;  3TKC A;  4LNX A;  3DCT A;  2H79 A;  4P6W A;  5DV6 A;  5G5W A;  1ZUC A;  4JYH A;  1KNU A;  4OKT A;  3HO0 A;  2OCF A;  4S14 A;  1IE8 A;  1Y9R A;  5EIT A;  3VRT A;  3W5R A;  3G9E A;  4J5X C;  5F9B A;  2FSZ A;  5HZC A;  1OSH A;  1YMT A;  1YP0 A;  2G0G A;  3P8X A;  5DWG A;  5AWJ A;  4G2H A;  3VHU A;  1I37 A;  4X1G A;  1PDU A;  5E7V A;  2OM9 A;  2XYW A;  2GL8 A;  1YA3 A;  2PRG A;  4OGH A;  3RUU A;  5E1C A;  2OVH A;  1R1K A;  2ZLC A;  3IPS A;  1G1U A;  3VJT A;  3AN4 A;  3HM1 A;  2ATH A;  4OH5 A;  4R2U A;  1XQC A;  3K6P A;  4RUP A;  5DID A;  5H1E A;  3GD2 A;  1T76 A;  3KDU A;  2F4B A;  3OKI A;  3A2I A;  4M8H A;  5DXG A;  4PPS A;  1N4H A;  5EI1 A;  4IW8 A;  5DXP A;  2A3I A;  1GWX A;  1IE9 A;  3W0Y A;  4XUM A;  2YJD A;  5KCW A;  4PXM A;  1P8D A;  5DV3 A;  4XI3 A;  3SP6 A;  4OZR U;  4RAK A;  2ZNQ A;  3OZ0 A;  1XAP A;  3AFR A;  5ETH A;  3CS8 A;  1NUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...