2B1ZA

Human estrogen receptor alpha ligand-binding domain in complex with 17methyl-17alpha-dihydroequilenin and a glucoc interacting protein 1 nr box ii peptide
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
244
structure length
232
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLEAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular characterization of a B-ring unsaturated estrogen: implications for conjugated equine estrogen components of premarin.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Hormone/growth factor receptor
source organism Homo sapiens
total genus 87
structure length 232
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2b1zA00
5DRJA 4CI4A 5EHJA 1FM9D 4Q13A 1EXAA 5EJVA 4IW6A 1NQ0A 5KCTA 4RUOX 1XP1A 2Q6SA 1S9QA 3R2AA 4RFWA 5AAUA 4EM9A 1T63A 1XZXX 1E3KA 2J4AA 3OSWA 3WWRA 4XUHA 3UP3A 2R6YA 2VSRA 2JFAA 5ACCA 4PPSA 2POGA 3IXPA 3DZUD 4JYGA 2OUZA 4QE8A 5DI7A 3HVLA 3IPUA 2GPUA 2ZL9A 5DY8A 2OZ7A 5AZVA 3B67A 2O4JA 2QSEA 3K8SA 4J5WA 3VJIA 2PIUA 4IVWA 4RZFA 2AA7A 2IOKA 1YA3A 2HBHA 1Y0XX 3B65A 3UUAB 4X1GA 4G21A 2AO6A 1Y9RA 4QL8A 1XQCA 4MGAA 4HLWA 1XLSE 4JGVA 4LNXA 1YOKA 5IZ0A 3KDUA 2JFAB 3JZBA 2QA6A 2P7GA 3L03A 3VJTA 2ZNQA 4OARA 4WLBA 3GBKA 1R6GA 1Z95A 3WGPA 2BJ4B 2I4ZA 2VV2A 4MG8A 4YNKA 3W0CA 1A52A 2H77A 2OVMA 3VRVA 5KRKA 4A4VA 3WT7A 5DXQA 5APHA 5DP0A 4CI5A 4NUFA 2I4JA 3DZYA 4A4WA 1YUCA 4G1DA 5KROA 3VT5A 2VV1B 2G0HA 1XIUA 2JF9A 3H52A 2PINA 5B5BA 4OZTU 5G42A 2Q70A 3D6DA 1XAPA 2YHDA 5AVLA 3ZRBA 3OMKA 3FURA 3HLVA 4MG8B 4R6SA 5C4TA 3HM1A 3KPZA 2Q6RA 3PLZA 2QE4A 3H0AA 3V49A 3OSIA 1NQ1A 1R5KA 1SKXA 2GTKA 4J5WC 1R1KA 5EC9A 1FCYA 4R06A 3UU7A 4IS8A 4ZNSA 1ZDTA 2HASA 3W5TA 1FM9A 4MGDA 2BAWA 2YLPA 2I4PA 4OH6A 4WHGA 1XV9B 3TY0A 4IA1A 3ZR7A 1X7EA 1UPWA 2Q60A 3GYTA 5DIEA 2YLQA 3WTQA 3OKHA 2GPOA 4FHHA 4JYHA 3UP0A 2V0VA 4ITFA 2AWHA 1S19A 5DZIA 2R6WA 2P7AA 2R40D 4CSJA 1R20D 1XJ7A 1QKNA 1UPVA 4RZEA 4JL4A 5KRCA 4WVDA 3DZUA 3UU7B 4DK7A 2Q1HA 1NAXA 4IU7A 4E4KA 4MGDB 4HEEX 1FCZA 1YMTA 4O8FA 2ZXZA 4OILA 2HB8A 5JI0D 5KRLA 5KR9A 1Z5XE 4R2UA 4RZGA 4TV1A 5KCEA 1OSVA 2AMBA 4IA7A 1ILHA 4RMCA 4FHIA 5ETHA 2NPAA 1U3RA 3AN3A 5I4VA 2V7CA 3FEJA 4FNEA 5G43A 5KCFA 4QJRA 2Q59A 2XYWA 3OS8A 5KYJA 1PQ9A 3ADVA 5GT4A 3D90A 3G0WA 1A28A 2Z4BA 3GZ9A 4JAZA 5EITA 1OT7A 3WT6A 3UUCA 3Q95A 4G20A 4Q0AC 2QXMA 1T73A 4RE8A 4TV1B 3R8DA 3R8IA 4RWVA 5DWGA 3B0RA 4YT1A 1UOMA 2AXAA 5L7GA 5KCUA 3AZ2A 3F7DA 5DXBA 3AUNA 3A2JA 1LBDA 2PIRA 4DMAA 2Q59B 2P7ZA 3MNEA 2HAMA 2ZK2A 3A2HA 4K6IA 5APJA 2ZK1A 5AAVB 1T79A 4OFUA 2XKWA 5L7HA 1QKMA 1FCXA 2HWRA 5C4OA 3X1HA 3Q95B 5DKEA 5HJPA 1P93A 1M2ZA 3CJWA 4JYIA 4OH5A 3TKCA 5LWPA 2P4YA 3AZ3A 2PNUA 3OMPA 4FN9A 4PWLA 5DXBB 3WJ4A 1X7BA 5FQRA 3FS1A 3WT5A 5IXKA 3P89A 2YATA 3L3ZA 1PQCA 5DUHA 4MG5A 5G44A 5AZTA 3UUAA 5DXKA 3UVVA 1GWXA 3A9EA 3OS8C 4N8RA 4L96A 3OSAA 2Q8SA 5DXPA 5DYBA 5HJPB 3S9SA 3W0JA 4RAKA 1ZDUA 2R40A 5DL4A 1R20A 3DR1A 4S0SA 4XLDA 5G46A 2PKLA 4J26A 2GP7A 1ZKYA 4PLEA 3KBAA 1L2JA 4RMEA 2FSZA 2PRGA 2BJ4A 4POHA 3GWSX 2NXXE 2YLYA 5L11A 3TKMA 4DM8A 1U3QA 4OIVA 4OK1A 3IPQA 2Q7LA 2FAIA 2QZOA 3A3ZX 5DUEA 5EI1A 1FBYA 3A9EB 4G2HA 2JJ3A 3UVVB 3KDTA 1M7WA 5B41A 5HYRA 4UDCA 3B0WA 4ZO1X 3HZFA 2Q6JA 3FUGA 3K6PA 1KV6A 2VV1A 2VV3A 2QMVA 5KRFA 2ZK6A 2I0JA 3CS4A 1X78A 2ZASA 2ZK3A 3L1BA 3LMPA 4MG9A 4OEZA 2J7YA 3B0QA 2F4BA 2QABA 5DUGA 2AB2A 3DT3A 3R5MA 3E00D 1G50A 2POBA 3OS9A 2QZOB 5DWIA 1GWQA 1NDEA 4IWCA 3ET2A 4M8EA 4OEYA 4OKTA 3DCUA 4XT9A 5EGVA 3W0YA 5IAWA 3ADXA 1DB1A 4YMQA 4WPFA 3P8XA 3NOAA 4L98A 1NAVA 2NW4A 3OMOA 4IV4A 3ZRAA 3OMMA 3QT0A 1XB7A 3R29A 4MG9B 5DWEA 1GS4A 1N83A 5DU5A 4M8HA 3VJHA 4ZNTA 5H1EA 4PPPA 1XV9A 4OIUA 3ERTA 1K4WA 2HB7A 5DSHA 2XYJA 4OLMA 3OKIA 5CJ6A 3VJSA 3VTCA 1S9PA 2QGWA 1PK5A 3RLLA 3W0HA 1N4HA 2E2RA 4OJ4A 3WFGA 5DKGA 4A2JA 3VTBA 1Q4XA 1Z5XU 4OZRU 5AVIA 1X7JA 3VRUA 1I38A 3DY6A 5DXRA 1ZH7A 4APUA 3OMQA 1P8DA 3RVFA 1H9UA 3ET1A 4ZNHA 5KD9A 1E3GA 5KRIA 4WHFA 3AUQA 4E4QA 1I7GA 5M96A 5G3JA 5DZ3A 3ADTA 3G9EA 2O4RA 2QNVA 1RJKA 2Q7KA 1LV2A 1T7TA 1K7LA 3W0GA 4DORA 2GIUA 3VT6A 4XUMA 5DWJA 4XAOA 1ERRA 1XDKB 5HZCA 4REFA 3UUDA 5JJMA 5E0XA 5L7EA 2FVJA 2B1ZA 3GYUA 1EXXA 1T65A 2ZMJA 3K23A 3CLDA 2AM9A 3VT4A 5KCDA 4DM6A 2OVHA 3ERDA 4NIEA 4ZN9A 4DQMA 3CS6A 1X76A 3ET0A 4OC7A 5DVVA 5DRMA 4PRGA 4RUPA 5DWLA 3CDPA 5DXEA 3L0JA 2AX6A 4OKBA 4S15A 5DV8A 3X36A 2NV7A 3ADSA 3ILZA 2ZK5A 4OJBA 5DKBA 3PEQA 2ZMIA 5DMCA 3B68A 5DZ1A 1KNUA 2YLOA 4MGCA 5KCWA 1TXIA 1ZUCA 3KFCA 3SP6A 3UUDB 2Q7JA 5AAVA 2AMAA 5JJMB 2B50A 2Q5GA 4UDBA 1RKHA 5E14A 4F9MA 3E00A 1XQ3A 4RMDA 2O9IA 3K22A 3ADWA 4LSJA 4OKWA 3VRTA 1L2IA 2PITA 2YJDA 3BQDA 3FC6A 3GWXA 5AWJA 5HCVA 2HCDA 4N1YA 3IA6A 3V9VA 4POJA 3B5RA 3E7CA 5DMFA 2EWPA 2P1VA 3RY9A 2IHQA 4QM0A 4BCRA 3W5RA 4QK4A 4N5GA 2VSTA 2HARA 4OJ9A 5HYKA 4P6WA 5FQTA 5GICA 1XVPA 2AA2A 2G0GA 3MNPA 3KMGA 2PIPL 4ZO1B 5G5WA 4B7WA 3G8IA 4UDDA 5DX3A 3OGTA 3PCUA 5KRJA 3OOKA 2Q1VA 1XLSA 2ZLCA 3BEJA 5AK2A 1YP0A 3FC6B 2QA8A 2GPVA 3L0LA 3P0UA 4RUJA 2ZK4A 4EMAA 1YIMA 3W0IA 3OLFA 1K74D 3MNOA 4G1ZA 2ATHA 2ZXMA 4FGYA 4LBDA 1ZAFA 2PIXA 3OAPA 5DKSA 4ZJRA 3ET3A 1SJ0A 4IVYA 2QTUA 3R5NA 4J5XA 1XVPB 4ZI1A 5LGAA 4P6XA 1TFCA 2XHSA 3R8AA 5DX3B 2PIVA 1RDTD 3F5CA 3RUUA 4PXMA 5DTVA 5FQPA 3GD2A 5G45A 1PDUA 2XYXA 3HC5A 2QA8B 4IW8A 3VT8A 5AWKA 3G8OA 4PP6A 3FEIA 3P88A 2AYRA 3A40X 2AX8A 4ZJWA 4S14A 3KWYA 1T74A 5AYGA 5E15A 2HFPA 3VT7A 1HJ1A 1G2NA 3L3XA 1T7FA 1OVLB 5E0WA 1DKFB 1ZEOA 2P1UA 3ADUA 3CTBA 1XPCA 2HC4A 3F5CB 2QW4A 3KMRA 3X1IA 4WQPA 1YY4A 1VJBA 2W8YA 2ZFXA 1YJEA 1NRLA 4MGBB 2P54A 4PF3A 2ZVTA 1Y0SA 1YINA 2QPYA 4S0TA 1RK3A 1XOWA 5APKA 5E1CA 1SR7A 1IE9A 2ZKCA 3B1MA 4LNWA 2AAXA 4OFRA 2OM9A 3PO9A 2GPPA 3KYTA 3EYBA 1XP6A 2B1VA 3O1DA 4UDAA 3D57A 3OZJA 4J5XC 5DIDA 4IQRA 2Z4JA 1SQNA 1HG4A 3AFRA 3A78A 4XHDA 2Q3YA 5E19A 1XNXA 3E94A 3DCTA 2J7XA 3FXVA 1XP9A 3VRWA 5DVSA 5DVCA 1IE8A 4LTWA 4IUIA 3SP9A 2A3IA 3GN8A 1XDKA 1XNNA 5GIDA 4NB6A 3V9TA 1G5YA 1OSHA 1K74A 3VI8A 3VHVA 2ZNNA 3B66A 3OLLA 2H79A 4MGAB 3AURA 4K7AA 1EREA 2OCFA 5A86A 4DOSA 5GIEA 4ZN7A 1UHLA 2G5OA 2GL8A 4MG7A 3TX7B 1U9EA 3V4AA 5DZHA 3RUTA 3IPSA 4OGHA 3NSPA 1RDTA 4G1YA 1FM6D 1PQ6A 4ZNVA 2QH6A 4NQAB 1BSXA 1M13A 4IA2A 2QR9A 3W5PA 1N46A 1GWRA 5DXMA 3VT3A 3SZ1A 2ZK0A 5DLRA 2HWQA 5DZ0A 3VT9A 3JZCA 3VHWA 4K4JA 2ACLA 3OOFA 5C4UA 1X7RA 3V9YA 1QKUA 2Q5PA 4N73A 1UHLB 1U3SA 1NYXA 2AA6A 2IOGA 2ZNPA 3A2IA 4MG7B 4OEAA 4QE6A 5F9BA 4G2IA 3WJ5A 1T76A 5KRHA 2Q7IA 4KZJA 2ZXNA 4OEDA 3WFFA 3IMYA 3L0EA 4ITEA 3PRGA 1MV9A 1MZNA 3AZ1A 5K13A 2YFEA 2J14A 4KZIA 2PIOA 5KRAA 1PCGA 2VV0A 3AN4A 4OZTE 2YJAB 2ACLB 3D5FA 1WM0X 3M7RA 4IWFA 3BC5A 3IXPD 1T7MA 4MG6A 1I7IA 4OKXA 4KZMA 3HQ5A 5JY3A 2ZLAA 1T5ZA 4X1FA 5DYDA 4PP5A 5DV3A 1I37A 3U9QA 4IA3A 5E7VA 3V3QA 4J24A 2P15A 4OZRE 1PZLA 4IV2A 2AX9A 2P1TA 1S0XA 4PVUA 3B3KA 2HVCA 3PBAA 2OAXA 3CS8A 3KMZA 3VHUA 2NXXA 3FLIA 3VSPA 3AX8A 1YYEA 1ZGYA 1NQ2A 3HC6A 4DK8A 5C4SA 2LBDA 5KYAA 2AA5A 2VV4A 5FQVA 2ABIA 3RLJA 3CQVA 3VSOA 5HJSA 2PIWA 3OZ0A 4ZNUA 3VN2A 2ZNOA 3VTDA 2G44A 4NY9A 5SYZA 4ONIA 3W0AA 4OHAA 2Q5SA 3FALA 1S0ZA 3NSQA 4TUZA 1MVCA 2ZBSA 4PLDA 1PRGA 3DZYD 1KKQA 2PIQA 1NHZA 3D24A 1YOWA 1RKGA 2ZY0A 2AX7A 4REEA 4ZNWA 5DXGA 3ZQTA 4YPQA 2QGTA 1T7RA 1OVLA 5DIGA 2PJLA 1DKFA 2Q61A 3CDSA 1G1UA 4MDDA 4XTAA 1ILGA 3T03A 2VV4B 2I0GA 3HO0A 3O1EA 4PP3A 1FM6A 3V3EA 3HODA 3N00A 1NUOA 4XI3A 5DV6A 5FQSA 3W5QA 1QKTA 2GWXA 3H0AD 3LBDA 5DK9A 5KCCA 3CWDA 3B0TA 3WMHA 2REWA 2B23A 3FALB 4Q50A 4TUZB 4ZOMA 3OLSA 3X31A 4E2JA 2QXSA 4MGBA 5KRMA 2ZMHA 5ICKA 1R1KD 4Y29A 1FD0A 1NQ7A
chains in the Genus database with same CATH superfamily
5DRJA 4CI4A 5EHJA 1FM9D 4Q13A 1EXAA 5EJVA 4IW6A 1NQ0A 5KCTA 4RUOX 1XP1A 2Q6SA 1S9QA 3R2AA 4RFWA 5AAUA 4EM9A 1T63A 1XZXX 1E3KA 2J4AA 3OSWA 3WWRA 4XUHA 3UP3A 2R6YA 2VSRA 2JFAA 5ACCA 4PPSA 2POGA 3IXPA 3DZUD 4JYGA 2OUZA 4QE8A 5DI7A 3HVLA 3IPUA 2GPUA 2ZL9A 5DY8A 2OZ7A 5AZVA 3B67A 2O4JA 2QSEA 3K8SA 4J5WA 3VJIA 2PIUA 4IVWA 4RZFA 2AA7A 2IOKA 1YA3A 2HBHA 1Y0XX 3B65A 3UUAB 4X1GA 4G21A 2AO6A 1Y9RA 4QL8A 1XQCA 4MGAA 4HLWA 1XLSE 4JGVA 4LNXA 1YOKA 5IZ0A 3KDUA 2JFAB 3JZBA 2QA6A 2P7GA 3L03A 3VJTA 2ZNQA 4OARA 4WLBA 3GBKA 1R6GA 1Z95A 3WGPA 2BJ4B 2I4ZA 2VV2A 4MG8A 4YNKA 3W0CA 1A52A 2H77A 2OVMA 3VRVA 5KRKA 4A4VA 3WT7A 5DXQA 5APHA 5DP0A 4CI5A 4NUFA 2I4JA 3DZYA 4A4WA 1YUCA 4G1DA 5KROA 3VT5A 2VV1B 2G0HA 1XIUA 2JF9A 3H52A 2PINA 5B5BA 4OZTU 5G42A 2Q70A 3D6DA 1XAPA 2YHDA 5AVLA 3ZRBA 3OMKA 3FURA 3HLVA 4MG8B 4R6SA 5C4TA 3HM1A 3KPZA 2Q6RA 3PLZA 2QE4A 3H0AA 3V49A 3OSIA 1NQ1A 1R5KA 1SKXA 2GTKA 4J5WC 1R1KA 5EC9A 1FCYA 4R06A 3UU7A 4IS8A 4ZNSA 1ZDTA 2HASA 3W5TA 1FM9A 4MGDA 2BAWA 2YLPA 2I4PA 4OH6A 4WHGA 1XV9B 3TY0A 4IA1A 3ZR7A 1X7EA 1UPWA 2Q60A 3GYTA 5DIEA 2YLQA 3WTQA 3OKHA 2GPOA 4FHHA 4JYHA 3UP0A 2V0VA 4ITFA 2AWHA 1S19A 5DZIA 2R6WA 2P7AA 2R40D 4CSJA 1R20D 1XJ7A 1QKNA 1UPVA 4RZEA 4JL4A 5KRCA 4WVDA 3DZUA 3UU7B 4DK7A 2Q1HA 1NAXA 4IU7A 4E4KA 4MGDB 4HEEX 1FCZA 1YMTA 4O8FA 2ZXZA 4OILA 2HB8A 5JI0D 5KRLA 5KR9A 1Z5XE 4R2UA 4RZGA 4TV1A 5KCEA 1OSVA 2AMBA 4IA7A 1ILHA 4RMCA 4FHIA 5ETHA 2NPAA 1U3RA 3AN3A 5I4VA 2V7CA 3FEJA 4FNEA 5G43A 5KCFA 4QJRA 2Q59A 2XYWA 3OS8A 5KYJA 1PQ9A 3ADVA 5GT4A 3D90A 3G0WA 1A28A 2Z4BA 3GZ9A 4JAZA 5EITA 1OT7A 3WT6A 3UUCA 3Q95A 4G20A 4Q0AC 2QXMA 1T73A 4RE8A 4TV1B 3R8DA 3R8IA 4RWVA 5DWGA 3B0RA 4YT1A 1UOMA 2AXAA 5L7GA 5KCUA 3AZ2A 3F7DA 5DXBA 3AUNA 3A2JA 1LBDA 2PIRA 4DMAA 2Q59B 2P7ZA 3MNEA 2HAMA 2ZK2A 3A2HA 4K6IA 5APJA 2ZK1A 5AAVB 1T79A 4OFUA 2XKWA 5L7HA 1QKMA 1FCXA 2HWRA 5C4OA 3X1HA 3Q95B 5DKEA 5HJPA 1P93A 1M2ZA 3CJWA 4JYIA 4OH5A 3TKCA 5LWPA 2P4YA 3AZ3A 2PNUA 3OMPA 4FN9A 4PWLA 5DXBB 3WJ4A 1X7BA 5FQRA 3FS1A 3WT5A 5IXKA 3P89A 2YATA 3L3ZA 1PQCA 5DUHA 4MG5A 5G44A 5AZTA 3UUAA 5DXKA 3UVVA 1GWXA 3A9EA 3OS8C 4N8RA 4L96A 3OSAA 2Q8SA 5DXPA 5DYBA 5HJPB 3S9SA 3W0JA 4RAKA 1ZDUA 2R40A 5DL4A 1R20A 3DR1A 4S0SA 4XLDA 5G46A 2PKLA 4J26A 2GP7A 1ZKYA 4PLEA 3KBAA 1L2JA 4RMEA 2FSZA 2PRGA 2BJ4A 4POHA 3GWSX 2NXXE 2YLYA 5L11A 3TKMA 4DM8A 1U3QA 4OIVA 4OK1A 3IPQA 2Q7LA 2FAIA 2QZOA 3A3ZX 5DUEA 5EI1A 1FBYA 3A9EB 4G2HA 2JJ3A 3UVVB 3KDTA 1M7WA 5B41A 5HYRA 4UDCA 3B0WA 4ZO1X 3HZFA 2Q6JA 3FUGA 3K6PA 1KV6A 2VV1A 2VV3A 2QMVA 5KRFA 2ZK6A 2I0JA 3CS4A 1X78A 2ZASA 2ZK3A 3L1BA 3LMPA 4MG9A 4OEZA 2J7YA 3B0QA 2F4BA 2QABA 5DUGA 2AB2A 3DT3A 3R5MA 3E00D 1G50A 2POBA 3OS9A 2QZOB 5DWIA 1GWQA 1NDEA 4IWCA 3ET2A 4M8EA 4OEYA 4OKTA 3DCUA 4XT9A 5EGVA 3W0YA 5IAWA 3ADXA 1DB1A 4YMQA 4WPFA 3P8XA 3NOAA 4L98A 1NAVA 2NW4A 3OMOA 4IV4A 3ZRAA 3OMMA 3QT0A 1XB7A 3R29A 4MG9B 5DWEA 1GS4A 1N83A 5DU5A 4M8HA 3VJHA 4ZNTA 5H1EA 4PPPA 1XV9A 4OIUA 3ERTA 1K4WA 2HB7A 5DSHA 2XYJA 4OLMA 3OKIA 5CJ6A 3VJSA 3VTCA 1S9PA 2QGWA 1PK5A 3RLLA 3W0HA 1N4HA 2E2RA 4OJ4A 3WFGA 5DKGA 4A2JA 3VTBA 1Q4XA 1Z5XU 4OZRU 5AVIA 1X7JA 3VRUA 1I38A 3DY6A 5DXRA 1ZH7A 4APUA 3OMQA 1P8DA 3RVFA 1H9UA 3ET1A 4ZNHA 5KD9A 1E3GA 5KRIA 4WHFA 3AUQA 4E4QA 1I7GA 5M96A 5G3JA 5DZ3A 3ADTA 3G9EA 2O4RA 2QNVA 1RJKA 2Q7KA 1LV2A 1T7TA 1K7LA 3W0GA 4DORA 2GIUA 3VT6A 4XUMA 5DWJA 4XAOA 1ERRA 1XDKB 5HZCA 4REFA 3UUDA 5JJMA 5E0XA 5L7EA 2FVJA 2B1ZA 3GYUA 1EXXA 1T65A 2ZMJA 3K23A 3CLDA 2AM9A 3VT4A 5KCDA 4DM6A 2OVHA 3ERDA 4NIEA 4ZN9A 4DQMA 3CS6A 1X76A 3ET0A 4OC7A 5DVVA 5DRMA 4PRGA 4RUPA 5DWLA 3CDPA 5DXEA 3L0JA 2AX6A 4OKBA 4S15A 5DV8A 3X36A 2NV7A 3ADSA 3ILZA 2ZK5A 4OJBA 5DKBA 3PEQA 2ZMIA 5DMCA 3B68A 5DZ1A 1KNUA 2YLOA 4MGCA 5KCWA 1TXIA 1ZUCA 3KFCA 3SP6A 3UUDB 2Q7JA 5AAVA 2AMAA 5JJMB 2B50A 2Q5GA 4UDBA 1RKHA 5E14A 4F9MA 3E00A 1XQ3A 4RMDA 2O9IA 3K22A 3ADWA 4LSJA 4OKWA 3VRTA 1L2IA 2PITA 2YJDA 3BQDA 3FC6A 3GWXA 5AWJA 5HCVA 2HCDA 4N1YA 3IA6A 3V9VA 4POJA 3B5RA 3E7CA 5DMFA 2EWPA 2P1VA 3RY9A 2IHQA 4QM0A 4BCRA 3W5RA 4QK4A 4N5GA 2VSTA 2HARA 4OJ9A 5HYKA 4P6WA 5FQTA 5GICA 1XVPA 2AA2A 2G0GA 3MNPA 3KMGA 2PIPL 4ZO1B 5G5WA 4B7WA 3G8IA 4UDDA 5DX3A 3OGTA 3PCUA 5KRJA 3OOKA 2Q1VA 1XLSA 2ZLCA 3BEJA 5AK2A 1YP0A 3FC6B 2QA8A 2GPVA 3L0LA 3P0UA 4RUJA 2ZK4A 4EMAA 1YIMA 3W0IA 3OLFA 1K74D 3MNOA 4G1ZA 2ATHA 2ZXMA 4FGYA 4LBDA 1ZAFA 2PIXA 3OAPA 5DKSA 4ZJRA 3ET3A 1SJ0A 4IVYA 2QTUA 3R5NA 4J5XA 1XVPB 4ZI1A 5LGAA 4P6XA 1TFCA 2XHSA 3R8AA 5DX3B 2PIVA 1RDTD 3F5CA 3RUUA 4PXMA 5DTVA 5FQPA 3GD2A 5G45A 1PDUA 2XYXA 3HC5A 2QA8B 4IW8A 3VT8A 5AWKA 3G8OA 4PP6A 3FEIA 3P88A 2AYRA 3A40X 2AX8A 4ZJWA 4S14A 3KWYA 1T74A 5AYGA 5E15A 2HFPA 3VT7A 1HJ1A 1G2NA 3L3XA 1T7FA 1OVLB 5E0WA 1DKFB 1ZEOA 2P1UA 3ADUA 3CTBA 1XPCA 2HC4A 3F5CB 2QW4A 3KMRA 3X1IA 4WQPA 1YY4A 1VJBA 2W8YA 2ZFXA 1YJEA 1NRLA 4MGBB 2P54A 4PF3A 2ZVTA 1Y0SA 1YINA 2QPYA 4S0TA 1RK3A 1XOWA 5APKA 5E1CA 1SR7A 1IE9A 2ZKCA 3B1MA 4LNWA 2AAXA 4OFRA 2OM9A 3PO9A 2GPPA 3KYTA 3EYBA 1XP6A 2B1VA 3O1DA 4UDAA 3D57A 3OZJA 4J5XC 5DIDA 4IQRA 2Z4JA 1SQNA 1HG4A 3AFRA 3A78A 4XHDA 2Q3YA 5E19A 1XNXA 3E94A 3DCTA 2J7XA 3FXVA 1XP9A 3VRWA 5DVSA 5DVCA 1IE8A 4LTWA 4IUIA 3SP9A 2A3IA 3GN8A 1XDKA 1XNNA 5GIDA 4NB6A 3V9TA 1G5YA 1OSHA 1K74A 3VI8A 3VHVA 2ZNNA 3B66A 3OLLA 2H79A 4MGAB 3AURA 4K7AA 1EREA 2OCFA 5A86A 4DOSA 5GIEA 4ZN7A 1UHLA 2G5OA 2GL8A 4MG7A 3TX7B 1U9EA 3V4AA 5DZHA 3RUTA 3IPSA 4OGHA 3NSPA 1RDTA 4G1YA 1FM6D 1PQ6A 4ZNVA 2QH6A 4NQAB 1BSXA 1M13A 4IA2A 2QR9A 3W5PA 1N46A 1GWRA 5DXMA 3VT3A 3SZ1A 2ZK0A 5DLRA 2HWQA 5DZ0A 3VT9A 3JZCA 3VHWA 4K4JA 2ACLA 3OOFA 5C4UA 1X7RA 3V9YA 1QKUA 2Q5PA 4N73A 1UHLB 1U3SA 1NYXA 2AA6A 2IOGA 2ZNPA 3A2IA 4MG7B 4OEAA 4QE6A 5F9BA 4G2IA 3WJ5A 1T76A 5KRHA 2Q7IA 4KZJA 2ZXNA 4OEDA 3WFFA 3IMYA 3L0EA 4ITEA 3PRGA 1MV9A 1MZNA 3AZ1A 5K13A 2YFEA 2J14A 4KZIA 2PIOA 5KRAA 1PCGA 2VV0A 3AN4A 4OZTE 2YJAB 2ACLB 3D5FA 1WM0X 3M7RA 4IWFA 3BC5A 3IXPD 1T7MA 4MG6A 1I7IA 4OKXA 4KZMA 3HQ5A 5JY3A 2ZLAA 1T5ZA 4X1FA 5DYDA 4PP5A 5DV3A 1I37A 3U9QA 4IA3A 5E7VA 3V3QA 4J24A 2P15A 4OZRE 1PZLA 4IV2A 2AX9A 2P1TA 1S0XA 4PVUA 3B3KA 2HVCA 3PBAA 2OAXA 3CS8A 3KMZA 3VHUA 2NXXA 3FLIA 3VSPA 3AX8A 1YYEA 1ZGYA 1NQ2A 3HC6A 4DK8A 5C4SA 2LBDA 5KYAA 2AA5A 2VV4A 5FQVA 2ABIA 3RLJA 3CQVA 3VSOA 5HJSA 2PIWA 3OZ0A 4ZNUA 3VN2A 2ZNOA 3VTDA 2G44A 4NY9A 5SYZA 4ONIA 3W0AA 4OHAA 2Q5SA 3FALA 1S0ZA 3NSQA 4TUZA 1MVCA 2ZBSA 4PLDA 1PRGA 3DZYD 1KKQA 2PIQA 1NHZA 3D24A 1YOWA 1RKGA 2ZY0A 2AX7A 4REEA 4ZNWA 5DXGA 3ZQTA 4YPQA 2QGTA 1T7RA 1OVLA 5DIGA 2PJLA 1DKFA 2Q61A 3CDSA 1G1UA 4MDDA 4XTAA 1ILGA 3T03A 2VV4B 2I0GA 3HO0A 3O1EA 4PP3A 1FM6A 3V3EA 3HODA 3N00A 1NUOA 4XI3A 5DV6A 5FQSA 3W5QA 1QKTA 2GWXA 3H0AD 3LBDA 5DK9A 5KCCA 3CWDA 3B0TA 3WMHA 2REWA 2B23A 3FALB 4Q50A 4TUZB 4ZOMA 3OLSA 3X31A 4E2JA 2QXSA 4MGBA 5KRMA 2ZMHA 5ICKA 1R1KD 4Y29A 1FD0A 1NQ7A
chains in the Genus database with same CATH topology
5DRJA 4CI4A 5EHJA 1FM9D 4Q13A 1EXAA 5EJVA 4IW6A 1NQ0A 5KCTA 4RUOX 1XP1A 2Q6SA 1S9QA 3R2AA 4RFWA 5AAUA 4EM9A 1T63A 1XZXX 1E3KA 2J4AA 3OSWA 3WWRA 4XUHA 3UP3A 2R6YA 2VSRA 2JFAA 5ACCA 4PPSA 2POGA 3IXPA 3DZUD 4JYGA 2OUZA 4QE8A 5DI7A 3HVLA 3IPUA 2GPUA 2ZL9A 5DY8A 2OZ7A 5AZVA 3B67A 2O4JA 2QSEA 3K8SA 4J5WA 3VJIA 2PIUA 4IVWA 4RZFA 2AA7A 2IOKA 1YA3A 2HBHA 1Y0XX 3B65A 3UUAB 4X1GA 4G21A 2AO6A 1Y9RA 4QL8A 1XQCA 4MGAA 4HLWA 1XLSE 4JGVA 4LNXA 1YOKA 5IZ0A 3KDUA 2JFAB 3JZBA 2QA6A 2P7GA 3L03A 3VJTA 2ZNQA 4OARA 4WLBA 3GBKA 1R6GA 1Z95A 3WGPA 2BJ4B 2I4ZA 2VV2A 4MG8A 4YNKA 3W0CA 1A52A 2H77A 2OVMA 3VRVA 5KRKA 4A4VA 3WT7A 5DXQA 5APHA 5DP0A 4CI5A 4NUFA 2I4JA 3DZYA 4A4WA 1YUCA 4G1DA 5KROA 3VT5A 2VV1B 2G0HA 1XIUA 2JF9A 3H52A 2PINA 5B5BA 4OZTU 5G42A 2Q70A 3D6DA 1XAPA 2YHDA 5AVLA 3ZRBA 3OMKA 3FURA 3HLVA 4MG8B 4R6SA 5C4TA 3HM1A 3KPZA 2Q6RA 3PLZA 2QE4A 3H0AA 3V49A 3OSIA 1NQ1A 1R5KA 1SKXA 2GTKA 4J5WC 1R1KA 5EC9A 1FCYA 4R06A 3UU7A 4IS8A 4ZNSA 1ZDTA 2HASA 3W5TA 1FM9A 4MGDA 2BAWA 2YLPA 2I4PA 4OH6A 4WHGA 1XV9B 3TY0A 4IA1A 3ZR7A 1X7EA 1UPWA 2Q60A 3GYTA 5DIEA 2YLQA 3WTQA 3OKHA 2GPOA 4FHHA 4JYHA 3UP0A 2V0VA 4ITFA 2AWHA 1S19A 5DZIA 2R6WA 2P7AA 2R40D 4CSJA 1R20D 1XJ7A 1QKNA 1UPVA 4RZEA 4JL4A 5KRCA 4WVDA 3DZUA 3UU7B 4DK7A 2Q1HA 1NAXA 4IU7A 4E4KA 4MGDB 4HEEX 1FCZA 1YMTA 4O8FA 2ZXZA 4OILA 2HB8A 5JI0D 5KRLA 5KR9A 1Z5XE 4R2UA 4RZGA 4TV1A 5KCEA 1OSVA 2AMBA 4IA7A 1ILHA 4RMCA 4FHIA 5ETHA 2NPAA 1U3RA 3AN3A 5I4VA 2V7CA 3FEJA 4FNEA 5G43A 5KCFA 4QJRA 2Q59A 2XYWA 3OS8A 5KYJA 1PQ9A 3ADVA 5GT4A 3D90A 3G0WA 1A28A 2Z4BA 3GZ9A 4JAZA 5EITA 1OT7A 3WT6A 3UUCA 3Q95A 4G20A 4Q0AC 2QXMA 1T73A 4RE8A 4TV1B 3R8DA 3R8IA 4RWVA 5DWGA 3B0RA 4YT1A 1UOMA 2AXAA 5L7GA 5KCUA 3AZ2A 3F7DA 5DXBA 3AUNA 3A2JA 1LBDA 2PIRA 4DMAA 2Q59B 2P7ZA 3MNEA 2HAMA 2ZK2A 3A2HA 4K6IA 5APJA 2ZK1A 5AAVB 1T79A 4OFUA 2XKWA 5L7HA 1QKMA 1FCXA 2HWRA 5C4OA 3X1HA 3Q95B 5DKEA 5HJPA 1P93A 1M2ZA 3CJWA 4JYIA 4OH5A 3TKCA 5LWPA 2P4YA 3AZ3A 2PNUA 3OMPA 4FN9A 4PWLA 5DXBB 3WJ4A 1X7BA 5FQRA 3FS1A 3WT5A 5IXKA 3P89A 2YATA 3L3ZA 1PQCA 5DUHA 4MG5A 5G44A 5AZTA 3UUAA 5DXKA 3UVVA 1GWXA 3A9EA 3OS8C 4N8RA 4L96A 3OSAA 2Q8SA 5DXPA 5DYBA 5HJPB 3S9SA 3W0JA 4RAKA 1ZDUA 2R40A 5DL4A 1R20A 3DR1A 4S0SA 4XLDA 5G46A 2PKLA 4J26A 2GP7A 1ZKYA 4PLEA 3KBAA 1L2JA 4RMEA 2FSZA 2PRGA 2BJ4A 4POHA 3GWSX 2NXXE 2YLYA 5L11A 3TKMA 4DM8A 1U3QA 4OIVA 4OK1A 3IPQA 2Q7LA 2FAIA 2QZOA 3A3ZX 5DUEA 5EI1A 1FBYA 3A9EB 4G2HA 2JJ3A 3UVVB 3KDTA 1M7WA 5B41A 5HYRA 4UDCA 3B0WA 4ZO1X 3HZFA 2Q6JA 3FUGA 3K6PA 1KV6A 2VV1A 2VV3A 2QMVA 5KRFA 2ZK6A 2I0JA 3CS4A 1X78A 2ZASA 2ZK3A 3L1BA 3LMPA 4MG9A 4OEZA 2J7YA 3B0QA 2F4BA 2QABA 5DUGA 2AB2A 3DT3A 3R5MA 3E00D 1G50A 2POBA 3OS9A 2QZOB 5DWIA 1GWQA 1NDEA 4IWCA 3ET2A 4M8EA 4OEYA 4OKTA 3DCUA 4XT9A 5EGVA 3W0YA 5IAWA 3ADXA 1DB1A 4YMQA 4WPFA 3P8XA 3NOAA 4L98A 1NAVA 2NW4A 3OMOA 4IV4A 3ZRAA 3OMMA 3QT0A 1XB7A 3R29A 4MG9B 5DWEA 1GS4A 1N83A 5DU5A 4M8HA 3VJHA 4ZNTA 5H1EA 4PPPA 1XV9A 4OIUA 3ERTA 1K4WA 2HB7A 5DSHA 2XYJA 4OLMA 3OKIA 5CJ6A 3VJSA 3VTCA 1S9PA 2QGWA 1PK5A 3RLLA 3W0HA 1N4HA 2E2RA 4OJ4A 3WFGA 5DKGA 4A2JA 3VTBA 1Q4XA 1Z5XU 4OZRU 5AVIA 1X7JA 3VRUA 1I38A 3DY6A 5DXRA 1ZH7A 4APUA 3OMQA 1P8DA 3RVFA 1H9UA 3ET1A 4ZNHA 5KD9A 1E3GA 5KRIA 4WHFA 3AUQA 4E4QA 1I7GA 5M96A 5G3JA 5DZ3A 3ADTA 3G9EA 2O4RA 2QNVA 1RJKA 2Q7KA 1LV2A 1T7TA 1K7LA 3W0GA 4DORA 2GIUA 3VT6A 4XUMA 5DWJA 4XAOA 1ERRA 1XDKB 5HZCA 4REFA 3UUDA 5JJMA 5E0XA 5L7EA 2FVJA 2B1ZA 3GYUA 1EXXA 1T65A 2ZMJA 3K23A 3CLDA 2AM9A 3VT4A 5KCDA 4DM6A 2OVHA 3ERDA 4NIEA 4ZN9A 4DQMA 3CS6A 1X76A 3ET0A 4OC7A 5DVVA 5DRMA 4PRGA 4RUPA 5DWLA 3CDPA 5DXEA 3L0JA 2AX6A 4OKBA 4S15A 5DV8A 3X36A 2NV7A 3ADSA 3ILZA 2ZK5A 4OJBA 5DKBA 3PEQA 2ZMIA 5DMCA 3B68A 5DZ1A 1KNUA 2YLOA 4MGCA 5KCWA 1TXIA 1ZUCA 3KFCA 3SP6A 3UUDB 2Q7JA 5AAVA 2AMAA 5JJMB 2B50A 2Q5GA 4UDBA 1RKHA 5E14A 4F9MA 3E00A 1XQ3A 4RMDA 2O9IA 3K22A 3ADWA 4LSJA 4OKWA 3VRTA 1L2IA 2PITA 2YJDA 3BQDA 3FC6A 3GWXA 5AWJA 5HCVA 2HCDA 4N1YA 3IA6A 3V9VA 4POJA 3B5RA 3E7CA 5DMFA 2EWPA 2P1VA 3RY9A 2IHQA 4QM0A 4BCRA 3W5RA 4QK4A 4N5GA 2VSTA 2HARA 4OJ9A 5HYKA 4P6WA 5FQTA 5GICA 1XVPA 2AA2A 2G0GA 3MNPA 3KMGA 2PIPL 4ZO1B 5G5WA 4B7WA 3G8IA 4UDDA 5DX3A 3OGTA 3PCUA 5KRJA 3OOKA 2Q1VA 1XLSA 2ZLCA 3BEJA 5AK2A 1YP0A 3FC6B 2QA8A 2GPVA 3L0LA 3P0UA 4RUJA 2ZK4A 4EMAA 1YIMA 3W0IA 3OLFA 1K74D 3MNOA 4G1ZA 2ATHA 2ZXMA 4FGYA 4LBDA 1ZAFA 2PIXA 3OAPA 5DKSA 4ZJRA 3ET3A 1SJ0A 4IVYA 2QTUA 3R5NA 4J5XA 1XVPB 4ZI1A 5LGAA 4P6XA 1TFCA 2XHSA 3R8AA 5DX3B 2PIVA 1RDTD 3F5CA 3RUUA 4PXMA 5DTVA 5FQPA 3GD2A 5G45A 1PDUA 2XYXA 3HC5A 2QA8B 4IW8A 3VT8A 5AWKA 3G8OA 4PP6A 3FEIA 3P88A 2AYRA 3A40X 2AX8A 4ZJWA 4S14A 3KWYA 1T74A 5AYGA 5E15A 2HFPA 3VT7A 1HJ1A 1G2NA 3L3XA 1T7FA 1OVLB 5E0WA 1DKFB 1ZEOA 2P1UA 3ADUA 3CTBA 1XPCA 2HC4A 3F5CB 2QW4A 3KMRA 3X1IA 4WQPA 1YY4A 1VJBA 2W8YA 2ZFXA 1YJEA 1NRLA 4MGBB 2P54A 4PF3A 2ZVTA 1Y0SA 1YINA 2QPYA 4S0TA 1RK3A 1XOWA 5APKA 5E1CA 1SR7A 1IE9A 2ZKCA 3B1MA 4LNWA 2AAXA 4OFRA 2OM9A 3PO9A 2GPPA 3KYTA 3EYBA 1XP6A 2B1VA 3O1DA 4UDAA 3D57A 3OZJA 4J5XC 5DIDA 4IQRA 2Z4JA 1SQNA 1HG4A 3AFRA 3A78A 4XHDA 2Q3YA 5E19A 1XNXA 3E94A 3DCTA 2J7XA 3FXVA 1XP9A 3VRWA 5DVSA 5DVCA 1IE8A 4LTWA 4IUIA 3SP9A 2A3IA 3GN8A 1XDKA 1XNNA 5GIDA 4NB6A 3V9TA 1G5YA 1OSHA 1K74A 3VI8A 3VHVA 2ZNNA 3B66A 3OLLA 2H79A 4MGAB 3AURA 4K7AA 1EREA 2OCFA 5A86A 4DOSA 5GIEA 4ZN7A 1UHLA 2G5OA 2GL8A 4MG7A 3TX7B 1U9EA 3V4AA 5DZHA 3RUTA 3IPSA 4OGHA 3NSPA 1RDTA 4G1YA 1FM6D 1PQ6A 4ZNVA 2QH6A 4NQAB 1BSXA 1M13A 4IA2A 2QR9A 3W5PA 1N46A 1GWRA 5DXMA 3VT3A 3SZ1A 2ZK0A 5DLRA 2HWQA 5DZ0A 3VT9A 3JZCA 3VHWA 4K4JA 2ACLA 3OOFA 5C4UA 1X7RA 3V9YA 1QKUA 2Q5PA 4N73A 1UHLB 1U3SA 1NYXA 2AA6A 2IOGA 2ZNPA 3A2IA 4MG7B 4OEAA 4QE6A 5F9BA 4G2IA 3WJ5A 1T76A 5KRHA 2Q7IA 4KZJA 2ZXNA 4OEDA 3WFFA 3IMYA 3L0EA 4ITEA 3PRGA 1MV9A 1MZNA 3AZ1A 5K13A 2YFEA 2J14A 4KZIA 2PIOA 5KRAA 1PCGA 2VV0A 3AN4A 4OZTE 2YJAB 2ACLB 3D5FA 1WM0X 3M7RA 4IWFA 3BC5A 3IXPD 1T7MA 4MG6A 1I7IA 4OKXA 4KZMA 3HQ5A 5JY3A 2ZLAA 1T5ZA 4X1FA 5DYDA 4PP5A 5DV3A 1I37A 3U9QA 4IA3A 5E7VA 3V3QA 4J24A 2P15A 4OZRE 1PZLA 4IV2A 2AX9A 2P1TA 1S0XA 4PVUA 3B3KA 2HVCA 3PBAA 2OAXA 3CS8A 3KMZA 3VHUA 2NXXA 3FLIA 3VSPA 3AX8A 1YYEA 1ZGYA 1NQ2A 3HC6A 4DK8A 5C4SA 2LBDA 5KYAA 2AA5A 2VV4A 5FQVA 2ABIA 3RLJA 3CQVA 3VSOA 5HJSA 2PIWA 3OZ0A 4ZNUA 3VN2A 2ZNOA 3VTDA 2G44A 4NY9A 5SYZA 4ONIA 3W0AA 4OHAA 2Q5SA 3FALA 1S0ZA 3NSQA 4TUZA 1MVCA 2ZBSA 4PLDA 1PRGA 3DZYD 1KKQA 2PIQA 1NHZA 3D24A 1YOWA 1RKGA 2ZY0A 2AX7A 4REEA 4ZNWA 5DXGA 3ZQTA 4YPQA 2QGTA 1T7RA 1OVLA 5DIGA 2PJLA 1DKFA 2Q61A 3CDSA 1G1UA 4MDDA 4XTAA 1ILGA 3T03A 2VV4B 2I0GA 3HO0A 3O1EA 4PP3A 1FM6A 3V3EA 3HODA 3N00A 1NUOA 4XI3A 5DV6A 5FQSA 3W5QA 1QKTA 2GWXA 3H0AD 3LBDA 5DK9A 5KCCA 3CWDA 3B0TA 3WMHA 2REWA 2B23A 3FALB 4Q50A 4TUZB 4ZOMA 3OLSA 3X31A 4E2JA 2QXSA 4MGBA 5KRMA 2ZMHA 5ICKA 1R1KD 4Y29A 1FD0A 1NQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DRJ A;  4CI4 A;  5EHJ A;  1FM9 D;  4Q13 A;  1EXA A;  5EJV A;  4IW6 A;  1NQ0 A;  5KCT A;  4RUO X;  1XP1 A;  2Q6S A;  1S9Q A;  3R2A A;  4RFW A;  5AAU A;  4EM9 A;  1T63 A;  1XZX X;  1E3K A;  2J4A A;  3OSW A;  3WWR A;  4XUH A;  3UP3 A;  2R6Y A;  2VSR A;  2JFA A;  5ACC A;  4PPS A;  2POG A;  3IXP A;  3DZU D;  4JYG A;  2OUZ A;  4QE8 A;  5DI7 A;  3HVL A;  3IPU A;  2GPU A;  2ZL9 A;  5DY8 A;  2OZ7 A;  5AZV A;  3B67 A;  2O4J A;  2QSE A;  3K8S A;  4J5W A;  3VJI A;  2PIU A;  4IVW A;  4RZF A;  2AA7 A;  2IOK A;  1YA3 A;  2HBH A;  1Y0X X;  3B65 A;  3UUA B;  4X1G A;  4G21 A;  2AO6 A;  1Y9R A;  4QL8 A;  1XQC A;  4MGA A;  4HLW A;  1XLS E;  4JGV A;  4LNX A;  1YOK A;  5IZ0 A;  3KDU A;  2JFA B;  3JZB A;  2QA6 A;  2P7G A;  3L03 A;  3VJT A;  2ZNQ A;  4OAR A;  4WLB A;  3GBK A;  1R6G A;  1Z95 A;  3WGP A;  2BJ4 B;  2I4Z A;  2VV2 A;  4MG8 A;  4YNK A;  3W0C A;  1A52 A;  2H77 A;  2OVM A;  3VRV A;  5KRK A;  4A4V A;  3WT7 A;  5DXQ A;  5APH A;  5DP0 A;  4CI5 A;  4NUF A;  2I4J A;  3DZY A;  4A4W A;  1YUC A;  4G1D A;  5KRO A;  3VT5 A;  2VV1 B;  2G0H A;  1XIU A;  2JF9 A;  3H52 A;  2PIN A;  5B5B A;  4OZT U;  5G42 A;  2Q70 A;  3D6D A;  1XAP A;  2YHD A;  5AVL A;  3ZRB A;  3OMK A;  3FUR A;  3HLV A;  4MG8 B;  4R6S A;  5C4T A;  3HM1 A;  3KPZ A;  2Q6R A;  3PLZ A;  2QE4 A;  3H0A A;  3V49 A;  3OSI A;  1NQ1 A;  1R5K A;  1SKX A;  2GTK A;  4J5W C;  1R1K A;  5EC9 A;  1FCY A;  4R06 A;  3UU7 A;  4IS8 A;  4ZNS A;  1ZDT A;  2HAS A;  3W5T A;  1FM9 A;  4MGD A;  2BAW A;  2YLP A;  2I4P A;  4OH6 A;  4WHG A;  1XV9 B;  3TY0 A;  4IA1 A;  3ZR7 A;  1X7E A;  1UPW A;  2Q60 A;  3GYT A;  5DIE A;  2YLQ A;  3WTQ A;  3OKH A;  2GPO A;  4FHH A;  4JYH A;  3UP0 A;  2V0V A;  4ITF A;  2AWH A;  1S19 A;  5DZI A;  2R6W A;  2P7A A;  2R40 D;  4CSJ A;  1R20 D;  1XJ7 A;  1QKN A;  1UPV A;  4RZE A;  4JL4 A;  5KRC A;  4WVD A;  3DZU A;  3UU7 B;  4DK7 A;  2Q1H A;  1NAX A;  4IU7 A;  4E4K A;  4MGD B;  4HEE X;  1FCZ A;  1YMT A;  4O8F A;  2ZXZ A;  4OIL A;  2HB8 A;  5JI0 D;  5KRL A;  5KR9 A;  1Z5X E;  4R2U A;  4RZG A;  4TV1 A;  5KCE A;  1OSV A;  2AMB A;  4IA7 A;  1ILH A;  4RMC A;  4FHI A;  5ETH A;  2NPA A;  1U3R A;  3AN3 A;  5I4V A;  2V7C A;  3FEJ A;  4FNE A;  5G43 A;  5KCF A;  4QJR A;  2Q59 A;  2XYW A;  3OS8 A;  5KYJ A;  1PQ9 A;  3ADV A;  5GT4 A;  3D90 A;  3G0W A;  1A28 A;  2Z4B A;  3GZ9 A;  4JAZ A;  5EIT A;  1OT7 A;  3WT6 A;  3UUC A;  3Q95 A;  4G20 A;  4Q0A C;  2QXM A;  1T73 A;  4RE8 A;  4TV1 B;  3R8D A;  3R8I A;  4RWV A;  5DWG A;  3B0R A;  4YT1 A;  1UOM A;  2AXA A;  5L7G A;  5KCU A;  3AZ2 A;  3F7D A;  5DXB A;  3AUN A;  3A2J A;  1LBD A;  2PIR A;  4DMA A;  2Q59 B;  2P7Z A;  3MNE A;  2HAM A;  2ZK2 A;  3A2H A;  4K6I A;  5APJ A;  2ZK1 A;  5AAV B;  1T79 A;  4OFU A;  2XKW A;  5L7H A;  1QKM A;  1FCX A;  2HWR A;  5C4O A;  3X1H A;  3Q95 B;  5DKE A;  5HJP A;  1P93 A;  1M2Z A;  3CJW A;  4JYI A;  4OH5 A;  3TKC A;  5LWP A;  2P4Y A;  3AZ3 A;  2PNU A;  3OMP A;  4FN9 A;  4PWL A;  5DXB B;  3WJ4 A;  1X7B A;  5FQR A;  3FS1 A;  3WT5 A;  5IXK A;  3P89 A;  2YAT A;  3L3Z A;  1PQC A;  5DUH A;  4MG5 A;  5G44 A;  5AZT A;  3UUA A;  5DXK A;  3UVV A;  1GWX A;  3A9E A;  3OS8 C;  4N8R A;  4L96 A;  3OSA A;  2Q8S A;  5DXP A;  5DYB A;  5HJP B;  3S9S A;  3W0J A;  4RAK A;  1ZDU A;  2R40 A;  5DL4 A;  1R20 A;  3DR1 A;  4S0S A;  4XLD A;  5G46 A;  2PKL A;  4J26 A;  2GP7 A;  1ZKY A;  4PLE A;  3KBA A;  1L2J A;  4RME A;  2FSZ A;  2PRG A;  2BJ4 A;  4POH A;  3GWS X;  2NXX E;  2YLY A;  5L11 A;  3TKM A;  4DM8 A;  1U3Q A;  4OIV A;  4OK1 A;  3IPQ A;  2Q7L A;  2FAI A;  2QZO A;  3A3Z X;  5DUE A;  5EI1 A;  1FBY A;  3A9E B;  4G2H A;  2JJ3 A;  3UVV B;  3KDT A;  1M7W A;  5B41 A;  5HYR A;  4UDC A;  3B0W A;  4ZO1 X;  3HZF A;  2Q6J A;  3FUG A;  3K6P A;  1KV6 A;  2VV1 A;  2VV3 A;  2QMV A;  5KRF A;  2ZK6 A;  2I0J A;  3CS4 A;  1X78 A;  2ZAS A;  2ZK3 A;  3L1B A;  3LMP A;  4MG9 A;  4OEZ A;  2J7Y A;  3B0Q A;  2F4B A;  2QAB A;  5DUG A;  2AB2 A;  3DT3 A;  3R5M A;  3E00 D;  1G50 A;  2POB A;  3OS9 A;  2QZO B;  5DWI A;  1GWQ A;  1NDE A;  4IWC A;  3ET2 A;  4M8E A;  4OEY A;  4OKT A;  3DCU A;  4XT9 A;  5EGV A;  3W0Y A;  5IAW A;  3ADX A;  1DB1 A;  4YMQ A;  4WPF A;  3P8X A;  3NOA A;  4L98 A;  1NAV A;  2NW4 A;  3OMO A;  4IV4 A;  3ZRA A;  3OMM A;  3QT0 A;  1XB7 A;  3R29 A;  4MG9 B;  5DWE A;  1GS4 A;  1N83 A;  5DU5 A;  4M8H A;  3VJH A;  4ZNT A;  5H1E A;  4PPP A;  1XV9 A;  4OIU A;  3ERT A;  1K4W A;  2HB7 A;  5DSH A;  2XYJ A;  4OLM A;  3OKI A;  5CJ6 A;  3VJS A;  3VTC A;  1S9P A;  2QGW A;  1PK5 A;  3RLL A;  3W0H A;  1N4H A;  2E2R A;  4OJ4 A;  3WFG A;  5DKG A;  4A2J A;  3VTB A;  1Q4X A;  1Z5X U;  4OZR U;  5AVI A;  1X7J A;  3VRU A;  1I38 A;  3DY6 A;  5DXR A;  1ZH7 A;  4APU A;  3OMQ A;  1P8D A;  3RVF A;  1H9U A;  3ET1 A;  4ZNH A;  5KD9 A;  1E3G A;  5KRI A;  4WHF A;  3AUQ A;  4E4Q A;  1I7G A;  5M96 A;  5G3J A;  5DZ3 A;  3ADT A;  3G9E A;  2O4R A;  2QNV A;  1RJK A;  2Q7K A;  1LV2 A;  1T7T A;  1K7L A;  3W0G A;  4DOR A;  2GIU A;  3VT6 A;  4XUM A;  5DWJ A;  4XAO A;  1ERR A;  1XDK B;  5HZC A;  4REF A;  3UUD A;  5JJM A;  5E0X A;  5L7E A;  2FVJ A;  2B1Z A;  3GYU A;  1EXX A;  1T65 A;  2ZMJ A;  3K23 A;  3CLD A;  2AM9 A;  3VT4 A;  5KCD A;  4DM6 A;  2OVH A;  3ERD A;  4NIE A;  4ZN9 A;  4DQM A;  3CS6 A;  1X76 A;  3ET0 A;  4OC7 A;  5DVV A;  5DRM A;  4PRG A;  4RUP A;  5DWL A;  3CDP A;  5DXE A;  3L0J A;  2AX6 A;  4OKB A;  4S15 A;  5DV8 A;  3X36 A;  2NV7 A;  3ADS A;  3ILZ A;  2ZK5 A;  4OJB A;  5DKB A;  3PEQ A;  2ZMI A;  5DMC A;  3B68 A;  5DZ1 A;  1KNU A;  2YLO A;  4MGC A;  5KCW A;  1TXI A;  1ZUC A;  3KFC A;  3SP6 A;  3UUD B;  2Q7J A;  5AAV A;  2AMA A;  5JJM B;  2B50 A;  2Q5G A;  4UDB A;  1RKH A;  5E14 A;  4F9M A;  3E00 A;  1XQ3 A;  4RMD A;  2O9I A;  3K22 A;  3ADW A;  4LSJ A;  4OKW A;  3VRT A;  1L2I A;  2PIT A;  2YJD A;  3BQD A;  3FC6 A;  3GWX A;  5AWJ A;  5HCV A;  2HCD A;  4N1Y A;  3IA6 A;  3V9V A;  4POJ A;  3B5R A;  3E7C A;  5DMF A;  2EWP A;  2P1V A;  3RY9 A;  2IHQ A;  4QM0 A;  4BCR A;  3W5R A;  4QK4 A;  4N5G A;  2VST A;  2HAR A;  4OJ9 A;  5HYK A;  4P6W A;  5FQT A;  5GIC A;  1XVP A;  2AA2 A;  2G0G A;  3MNP A;  3KMG A;  2PIP L;  4ZO1 B;  5G5W A;  4B7W A;  3G8I A;  4UDD A;  5DX3 A;  3OGT A;  3PCU A;  5KRJ A;  3OOK A;  2Q1V A;  1XLS A;  2ZLC A;  3BEJ A;  5AK2 A;  1YP0 A;  3FC6 B;  2QA8 A;  2GPV A;  3L0L A;  3P0U A;  4RUJ A;  2ZK4 A;  4EMA A;  1YIM A;  3W0I A;  3OLF A;  1K74 D;  3MNO A;  4G1Z A;  2ATH A;  2ZXM A;  4FGY A;  4LBD A;  1ZAF A;  2PIX A;  3OAP A;  5DKS A;  4ZJR A;  3ET3 A;  1SJ0 A;  4IVY A;  2QTU A;  3R5N A;  4J5X A;  1XVP B;  4ZI1 A;  5LGA A;  4P6X A;  1TFC A;  2XHS A;  3R8A A;  5DX3 B;  2PIV A;  1RDT D;  3F5C A;  3RUU A;  4PXM A;  5DTV A;  5FQP A;  3GD2 A;  5G45 A;  1PDU A;  2XYX A;  3HC5 A;  2QA8 B;  4IW8 A;  3VT8 A;  5AWK A;  3G8O A;  4PP6 A;  3FEI A;  3P88 A;  2AYR A;  3A40 X;  2AX8 A;  4ZJW A;  4S14 A;  3KWY A;  1T74 A;  5AYG A;  5E15 A;  2HFP A;  3VT7 A;  1HJ1 A;  1G2N A;  3L3X A;  1T7F A;  1OVL B;  5E0W A;  1DKF B;  1ZEO A;  2P1U A;  3ADU A;  3CTB A;  1XPC A;  2HC4 A;  3F5C B;  2QW4 A;  3KMR A;  3X1I A;  4WQP A;  1YY4 A;  1VJB A;  2W8Y A;  2ZFX A;  1YJE A;  1NRL A;  4MGB B;  2P54 A;  4PF3 A;  2ZVT A;  1Y0S A;  1YIN A;  2QPY A;  4S0T A;  1RK3 A;  1XOW A;  5APK A;  5E1C A;  1SR7 A;  1IE9 A;  2ZKC A;  3B1M A;  4LNW A;  2AAX A;  4OFR A;  2OM9 A;  3PO9 A;  2GPP A;  3KYT A;  3EYB A;  1XP6 A;  2B1V A;  3O1D A;  4UDA A;  3D57 A;  3OZJ A;  4J5X C;  5DID A;  4IQR A;  2Z4J A;  1SQN A;  1HG4 A;  3AFR A;  3A78 A;  4XHD A;  2Q3Y A;  5E19 A;  1XNX A;  3E94 A;  3DCT A;  2J7X A;  3FXV A;  1XP9 A;  3VRW A;  5DVS A;  5DVC A;  1IE8 A;  4LTW A;  4IUI A;  3SP9 A;  2A3I A;  3GN8 A;  1XDK A;  1XNN A;  5GID A;  4NB6 A;  3V9T A;  1G5Y A;  1OSH A;  1K74 A;  3VI8 A;  3VHV A;  2ZNN A;  3B66 A;  3OLL A;  2H79 A;  4MGA B;  3AUR A;  4K7A A;  1ERE A;  2OCF A;  5A86 A;  4DOS A;  5GIE A;  4ZN7 A;  1UHL A;  2G5O A;  2GL8 A;  4MG7 A;  3TX7 B;  1U9E A;  3V4A A;  5DZH A;  3RUT A;  3IPS A;  4OGH A;  3NSP A;  1RDT A;  4G1Y A;  1FM6 D;  1PQ6 A;  4ZNV A;  2QH6 A;  4NQA B;  1BSX A;  1M13 A;  4IA2 A;  2QR9 A;  3W5P A;  1N46 A;  1GWR A;  5DXM A;  3VT3 A;  3SZ1 A;  2ZK0 A;  5DLR A;  2HWQ A;  5DZ0 A;  3VT9 A;  3JZC A;  3VHW A;  4K4J A;  2ACL A;  3OOF A;  5C4U A;  1X7R A;  3V9Y A;  1QKU A;  2Q5P A;  4N73 A;  1UHL B;  1U3S A;  1NYX A;  2AA6 A;  2IOG A;  2ZNP A;  3A2I A;  4MG7 B;  4OEA A;  4QE6 A;  5F9B A;  4G2I A;  3WJ5 A;  1T76 A;  5KRH A;  2Q7I A;  4KZJ A;  2ZXN A;  4OED A;  3WFF A;  3IMY A;  3L0E A;  4ITE A;  3PRG A;  1MV9 A;  1MZN A;  3AZ1 A;  5K13 A;  2YFE A;  2J14 A;  4KZI A;  2PIO A;  5KRA A;  1PCG A;  2VV0 A;  3AN4 A;  4OZT E;  2YJA B;  2ACL B;  3D5F A;  1WM0 X;  3M7R A;  4IWF A;  3BC5 A;  3IXP D;  1T7M A;  4MG6 A;  1I7I A;  4OKX A;  4KZM A;  3HQ5 A;  5JY3 A;  2ZLA A;  1T5Z A;  4X1F A;  5DYD A;  4PP5 A;  5DV3 A;  1I37 A;  3U9Q A;  4IA3 A;  5E7V A;  3V3Q A;  4J24 A;  2P15 A;  4OZR E;  1PZL A;  4IV2 A;  2AX9 A;  2P1T A;  1S0X A;  4PVU A;  3B3K A;  2HVC A;  3PBA A;  2OAX A;  3CS8 A;  3KMZ A;  3VHU A;  2NXX A;  3FLI A;  3VSP A;  3AX8 A;  1YYE A;  1ZGY A;  1NQ2 A;  3HC6 A;  4DK8 A;  5C4S A;  2LBD A;  5KYA A;  2AA5 A;  2VV4 A;  5FQV A;  2ABI A;  3RLJ A;  3CQV A;  3VSO A;  5HJS A;  2PIW A;  3OZ0 A;  4ZNU A;  3VN2 A;  2ZNO A;  3VTD A;  2G44 A;  4NY9 A;  5SYZ A;  4ONI A;  3W0A A;  4OHA A;  2Q5S A;  3FAL A;  1S0Z A;  3NSQ A;  4TUZ A;  1MVC A;  2ZBS A;  4PLD A;  1PRG A;  3DZY D;  1KKQ A;  2PIQ A;  1NHZ A;  3D24 A;  1YOW A;  1RKG A;  2ZY0 A;  2AX7 A;  4REE A;  4ZNW A;  5DXG A;  3ZQT A;  4YPQ A;  2QGT A;  1T7R A;  1OVL A;  5DIG A;  2PJL A;  1DKF A;  2Q61 A;  3CDS A;  1G1U A;  4MDD A;  4XTA A;  1ILG A;  3T03 A;  2VV4 B;  2I0G A;  3HO0 A;  3O1E A;  4PP3 A;  1FM6 A;  3V3E A;  3HOD A;  3N00 A;  1NUO A;  4XI3 A;  5DV6 A;  5FQS A;  3W5Q A;  1QKT A;  2GWX A;  3H0A D;  3LBD A;  5DK9 A;  5KCC A;  3CWD A;  3B0T A;  3WMH A;  2REW A;  2B23 A;  3FAL B;  4Q50 A;  4TUZ B;  4ZOM A;  3OLS A;  3X31 A;  4E2J A;  2QXS A;  4MGB A;  5KRM A;  2ZMH A;  5ICK A;  1R1K D;  4Y29 A;  1FD0 A;  1NQ7 A; 
#chains in the Genus database with same CATH topology
 5DRJ A;  4CI4 A;  5EHJ A;  1FM9 D;  4Q13 A;  1EXA A;  5EJV A;  4IW6 A;  1NQ0 A;  5KCT A;  4RUO X;  1XP1 A;  2Q6S A;  1S9Q A;  3R2A A;  4RFW A;  5AAU A;  4EM9 A;  1T63 A;  1XZX X;  1E3K A;  2J4A A;  3OSW A;  3WWR A;  4XUH A;  3UP3 A;  2R6Y A;  2VSR A;  2JFA A;  5ACC A;  4PPS A;  2POG A;  3IXP A;  3DZU D;  4JYG A;  2OUZ A;  4QE8 A;  5DI7 A;  3HVL A;  3IPU A;  2GPU A;  2ZL9 A;  5DY8 A;  2OZ7 A;  5AZV A;  3B67 A;  2O4J A;  2QSE A;  3K8S A;  4J5W A;  3VJI A;  2PIU A;  4IVW A;  4RZF A;  2AA7 A;  2IOK A;  1YA3 A;  2HBH A;  1Y0X X;  3B65 A;  3UUA B;  4X1G A;  4G21 A;  2AO6 A;  1Y9R A;  4QL8 A;  1XQC A;  4MGA A;  4HLW A;  1XLS E;  4JGV A;  4LNX A;  1YOK A;  5IZ0 A;  3KDU A;  2JFA B;  3JZB A;  2QA6 A;  2P7G A;  3L03 A;  3VJT A;  2ZNQ A;  4OAR A;  4WLB A;  3GBK A;  1R6G A;  1Z95 A;  3WGP A;  2BJ4 B;  2I4Z A;  2VV2 A;  4MG8 A;  4YNK A;  3W0C A;  1A52 A;  2H77 A;  2OVM A;  3VRV A;  5KRK A;  4A4V A;  3WT7 A;  5DXQ A;  5APH A;  5DP0 A;  4CI5 A;  4NUF A;  2I4J A;  3DZY A;  4A4W A;  1YUC A;  4G1D A;  5KRO A;  3VT5 A;  2VV1 B;  2G0H A;  1XIU A;  2JF9 A;  3H52 A;  2PIN A;  5B5B A;  4OZT U;  5G42 A;  2Q70 A;  3D6D A;  1XAP A;  2YHD A;  5AVL A;  3ZRB A;  3OMK A;  3FUR A;  3HLV A;  4MG8 B;  4R6S A;  5C4T A;  3HM1 A;  3KPZ A;  2Q6R A;  3PLZ A;  2QE4 A;  3H0A A;  3V49 A;  3OSI A;  1NQ1 A;  1R5K A;  1SKX A;  2GTK A;  4J5W C;  1R1K A;  5EC9 A;  1FCY A;  4R06 A;  3UU7 A;  4IS8 A;  4ZNS A;  1ZDT A;  2HAS A;  3W5T A;  1FM9 A;  4MGD A;  2BAW A;  2YLP A;  2I4P A;  4OH6 A;  4WHG A;  1XV9 B;  3TY0 A;  4IA1 A;  3ZR7 A;  1X7E A;  1UPW A;  2Q60 A;  3GYT A;  5DIE A;  2YLQ A;  3WTQ A;  3OKH A;  2GPO A;  4FHH A;  4JYH A;  3UP0 A;  2V0V A;  4ITF A;  2AWH A;  1S19 A;  5DZI A;  2R6W A;  2P7A A;  2R40 D;  4CSJ A;  1R20 D;  1XJ7 A;  1QKN A;  1UPV A;  4RZE A;  4JL4 A;  5KRC A;  4WVD A;  3DZU A;  3UU7 B;  4DK7 A;  2Q1H A;  1NAX A;  4IU7 A;  4E4K A;  4MGD B;  4HEE X;  1FCZ A;  1YMT A;  4O8F A;  2ZXZ A;  4OIL A;  2HB8 A;  5JI0 D;  5KRL A;  5KR9 A;  1Z5X E;  4R2U A;  4RZG A;  4TV1 A;  5KCE A;  1OSV A;  2AMB A;  4IA7 A;  1ILH A;  4RMC A;  4FHI A;  5ETH A;  2NPA A;  1U3R A;  3AN3 A;  5I4V A;  2V7C A;  3FEJ A;  4FNE A;  5G43 A;  5KCF A;  4QJR A;  2Q59 A;  2XYW A;  3OS8 A;  5KYJ A;  1PQ9 A;  3ADV A;  5GT4 A;  3D90 A;  3G0W A;  1A28 A;  2Z4B A;  3GZ9 A;  4JAZ A;  5EIT A;  1OT7 A;  3WT6 A;  3UUC A;  3Q95 A;  4G20 A;  4Q0A C;  2QXM A;  1T73 A;  4RE8 A;  4TV1 B;  3R8D A;  3R8I A;  4RWV A;  5DWG A;  3B0R A;  4YT1 A;  1UOM A;  2AXA A;  5L7G A;  5KCU A;  3AZ2 A;  3F7D A;  5DXB A;  3AUN A;  3A2J A;  1LBD A;  2PIR A;  4DMA A;  2Q59 B;  2P7Z A;  3MNE A;  2HAM A;  2ZK2 A;  3A2H A;  4K6I A;  5APJ A;  2ZK1 A;  5AAV B;  1T79 A;  4OFU A;  2XKW A;  5L7H A;  1QKM A;  1FCX A;  2HWR A;  5C4O A;  3X1H A;  3Q95 B;  5DKE A;  5HJP A;  1P93 A;  1M2Z A;  3CJW A;  4JYI A;  4OH5 A;  3TKC A;  5LWP A;  2P4Y A;  3AZ3 A;  2PNU A;  3OMP A;  4FN9 A;  4PWL A;  5DXB B;  3WJ4 A;  1X7B A;  5FQR A;  3FS1 A;  3WT5 A;  5IXK A;  3P89 A;  2YAT A;  3L3Z A;  1PQC A;  5DUH A;  4MG5 A;  5G44 A;  5AZT A;  3UUA A;  5DXK A;  3UVV A;  1GWX A;  3A9E A;  3OS8 C;  4N8R A;  4L96 A;  3OSA A;  2Q8S A;  5DXP A;  5DYB A;  5HJP B;  3S9S A;  3W0J A;  4RAK A;  1ZDU A;  2R40 A;  5DL4 A;  1R20 A;  3DR1 A;  4S0S A;  4XLD A;  5G46 A;  2PKL A;  4J26 A;  2GP7 A;  1ZKY A;  4PLE A;  3KBA A;  1L2J A;  4RME A;  2FSZ A;  2PRG A;  2BJ4 A;  4POH A;  3GWS X;  2NXX E;  2YLY A;  5L11 A;  3TKM A;  4DM8 A;  1U3Q A;  4OIV A;  4OK1 A;  3IPQ A;  2Q7L A;  2FAI A;  2QZO A;  3A3Z X;  5DUE A;  5EI1 A;  1FBY A;  3A9E B;  4G2H A;  2JJ3 A;  3UVV B;  3KDT A;  1M7W A;  5B41 A;  5HYR A;  4UDC A;  3B0W A;  4ZO1 X;  3HZF A;  2Q6J A;  3FUG A;  3K6P A;  1KV6 A;  2VV1 A;  2VV3 A;  2QMV A;  5KRF A;  2ZK6 A;  2I0J A;  3CS4 A;  1X78 A;  2ZAS A;  2ZK3 A;  3L1B A;  3LMP A;  4MG9 A;  4OEZ A;  2J7Y A;  3B0Q A;  2F4B A;  2QAB A;  5DUG A;  2AB2 A;  3DT3 A;  3R5M A;  3E00 D;  1G50 A;  2POB A;  3OS9 A;  2QZO B;  5DWI A;  1GWQ A;  1NDE A;  4IWC A;  3ET2 A;  4M8E A;  4OEY A;  4OKT A;  3DCU A;  4XT9 A;  5EGV A;  3W0Y A;  5IAW A;  3ADX A;  1DB1 A;  4YMQ A;  4WPF A;  3P8X A;  3NOA A;  4L98 A;  1NAV A;  2NW4 A;  3OMO A;  4IV4 A;  3ZRA A;  3OMM A;  3QT0 A;  1XB7 A;  3R29 A;  4MG9 B;  5DWE A;  1GS4 A;  1N83 A;  5DU5 A;  4M8H A;  3VJH A;  4ZNT A;  5H1E A;  4PPP A;  1XV9 A;  4OIU A;  3ERT A;  1K4W A;  2HB7 A;  5DSH A;  2XYJ A;  4OLM A;  3OKI A;  5CJ6 A;  3VJS A;  3VTC A;  1S9P A;  2QGW A;  1PK5 A;  3RLL A;  3W0H A;  1N4H A;  2E2R A;  4OJ4 A;  3WFG A;  5DKG A;  4A2J A;  3VTB A;  1Q4X A;  1Z5X U;  4OZR U;  5AVI A;  1X7J A;  3VRU A;  1I38 A;  3DY6 A;  5DXR A;  1ZH7 A;  4APU A;  3OMQ A;  1P8D A;  3RVF A;  1H9U A;  3ET1 A;  4ZNH A;  5KD9 A;  1E3G A;  5KRI A;  4WHF A;  3AUQ A;  4E4Q A;  1I7G A;  5M96 A;  5G3J A;  5DZ3 A;  3ADT A;  3G9E A;  2O4R A;  2QNV A;  1RJK A;  2Q7K A;  1LV2 A;  1T7T A;  1K7L A;  3W0G A;  4DOR A;  2GIU A;  3VT6 A;  4XUM A;  5DWJ A;  4XAO A;  1ERR A;  1XDK B;  5HZC A;  4REF A;  3UUD A;  5JJM A;  5E0X A;  5L7E A;  2FVJ A;  2B1Z A;  3GYU A;  1EXX A;  1T65 A;  2ZMJ A;  3K23 A;  3CLD A;  2AM9 A;  3VT4 A;  5KCD A;  4DM6 A;  2OVH A;  3ERD A;  4NIE A;  4ZN9 A;  4DQM A;  3CS6 A;  1X76 A;  3ET0 A;  4OC7 A;  5DVV A;  5DRM A;  4PRG A;  4RUP A;  5DWL A;  3CDP A;  5DXE A;  3L0J A;  2AX6 A;  4OKB A;  4S15 A;  5DV8 A;  3X36 A;  2NV7 A;  3ADS A;  3ILZ A;  2ZK5 A;  4OJB A;  5DKB A;  3PEQ A;  2ZMI A;  5DMC A;  3B68 A;  5DZ1 A;  1KNU A;  2YLO A;  4MGC A;  5KCW A;  1TXI A;  1ZUC A;  3KFC A;  3SP6 A;  3UUD B;  2Q7J A;  5AAV A;  2AMA A;  5JJM B;  2B50 A;  2Q5G A;  4UDB A;  1RKH A;  5E14 A;  4F9M A;  3E00 A;  1XQ3 A;  4RMD A;  2O9I A;  3K22 A;  3ADW A;  4LSJ A;  4OKW A;  3VRT A;  1L2I A;  2PIT A;  2YJD A;  3BQD A;  3FC6 A;  3GWX A;  5AWJ A;  5HCV A;  2HCD A;  4N1Y A;  3IA6 A;  3V9V A;  4POJ A;  3B5R A;  3E7C A;  5DMF A;  2EWP A;  2P1V A;  3RY9 A;  2IHQ A;  4QM0 A;  4BCR A;  3W5R A;  4QK4 A;  4N5G A;  2VST A;  2HAR A;  4OJ9 A;  5HYK A;  4P6W A;  5FQT A;  5GIC A;  1XVP A;  2AA2 A;  2G0G A;  3MNP A;  3KMG A;  2PIP L;  4ZO1 B;  5G5W A;  4B7W A;  3G8I A;  4UDD A;  5DX3 A;  3OGT A;  3PCU A;  5KRJ A;  3OOK A;  2Q1V A;  1XLS A;  2ZLC A;  3BEJ A;  5AK2 A;  1YP0 A;  3FC6 B;  2QA8 A;  2GPV A;  3L0L A;  3P0U A;  4RUJ A;  2ZK4 A;  4EMA A;  1YIM A;  3W0I A;  3OLF A;  1K74 D;  3MNO A;  4G1Z A;  2ATH A;  2ZXM A;  4FGY A;  4LBD A;  1ZAF A;  2PIX A;  3OAP A;  5DKS A;  4ZJR A;  3ET3 A;  1SJ0 A;  4IVY A;  2QTU A;  3R5N A;  4J5X A;  1XVP B;  4ZI1 A;  5LGA A;  4P6X A;  1TFC A;  2XHS A;  3R8A A;  5DX3 B;  2PIV A;  1RDT D;  3F5C A;  3RUU A;  4PXM A;  5DTV A;  5FQP A;  3GD2 A;  5G45 A;  1PDU A;  2XYX A;  3HC5 A;  2QA8 B;  4IW8 A;  3VT8 A;  5AWK A;  3G8O A;  4PP6 A;  3FEI A;  3P88 A;  2AYR A;  3A40 X;  2AX8 A;  4ZJW A;  4S14 A;  3KWY A;  1T74 A;  5AYG A;  5E15 A;  2HFP A;  3VT7 A;  1HJ1 A;  1G2N A;  3L3X A;  1T7F A;  1OVL B;  5E0W A;  1DKF B;  1ZEO A;  2P1U A;  3ADU A;  3CTB A;  1XPC A;  2HC4 A;  3F5C B;  2QW4 A;  3KMR A;  3X1I A;  4WQP A;  1YY4 A;  1VJB A;  2W8Y A;  2ZFX A;  1YJE A;  1NRL A;  4MGB B;  2P54 A;  4PF3 A;  2ZVT A;  1Y0S A;  1YIN A;  2QPY A;  4S0T A;  1RK3 A;  1XOW A;  5APK A;  5E1C A;  1SR7 A;  1IE9 A;  2ZKC A;  3B1M A;  4LNW A;  2AAX A;  4OFR A;  2OM9 A;  3PO9 A;  2GPP A;  3KYT A;  3EYB A;  1XP6 A;  2B1V A;  3O1D A;  4UDA A;  3D57 A;  3OZJ A;  4J5X C;  5DID A;  4IQR A;  2Z4J A;  1SQN A;  1HG4 A;  3AFR A;  3A78 A;  4XHD A;  2Q3Y A;  5E19 A;  1XNX A;  3E94 A;  3DCT A;  2J7X A;  3FXV A;  1XP9 A;  3VRW A;  5DVS A;  5DVC A;  1IE8 A;  4LTW A;  4IUI A;  3SP9 A;  2A3I A;  3GN8 A;  1XDK A;  1XNN A;  5GID A;  4NB6 A;  3V9T A;  1G5Y A;  1OSH A;  1K74 A;  3VI8 A;  3VHV A;  2ZNN A;  3B66 A;  3OLL A;  2H79 A;  4MGA B;  3AUR A;  4K7A A;  1ERE A;  2OCF A;  5A86 A;  4DOS A;  5GIE A;  4ZN7 A;  1UHL A;  2G5O A;  2GL8 A;  4MG7 A;  3TX7 B;  1U9E A;  3V4A A;  5DZH A;  3RUT A;  3IPS A;  4OGH A;  3NSP A;  1RDT A;  4G1Y A;  1FM6 D;  1PQ6 A;  4ZNV A;  2QH6 A;  4NQA B;  1BSX A;  1M13 A;  4IA2 A;  2QR9 A;  3W5P A;  1N46 A;  1GWR A;  5DXM A;  3VT3 A;  3SZ1 A;  2ZK0 A;  5DLR A;  2HWQ A;  5DZ0 A;  3VT9 A;  3JZC A;  3VHW A;  4K4J A;  2ACL A;  3OOF A;  5C4U A;  1X7R A;  3V9Y A;  1QKU A;  2Q5P A;  4N73 A;  1UHL B;  1U3S A;  1NYX A;  2AA6 A;  2IOG A;  2ZNP A;  3A2I A;  4MG7 B;  4OEA A;  4QE6 A;  5F9B A;  4G2I A;  3WJ5 A;  1T76 A;  5KRH A;  2Q7I A;  4KZJ A;  2ZXN A;  4OED A;  3WFF A;  3IMY A;  3L0E A;  4ITE A;  3PRG A;  1MV9 A;  1MZN A;  3AZ1 A;  5K13 A;  2YFE A;  2J14 A;  4KZI A;  2PIO A;  5KRA A;  1PCG A;  2VV0 A;  3AN4 A;  4OZT E;  2YJA B;  2ACL B;  3D5F A;  1WM0 X;  3M7R A;  4IWF A;  3BC5 A;  3IXP D;  1T7M A;  4MG6 A;  1I7I A;  4OKX A;  4KZM A;  3HQ5 A;  5JY3 A;  2ZLA A;  1T5Z A;  4X1F A;  5DYD A;  4PP5 A;  5DV3 A;  1I37 A;  3U9Q A;  4IA3 A;  5E7V A;  3V3Q A;  4J24 A;  2P15 A;  4OZR E;  1PZL A;  4IV2 A;  2AX9 A;  2P1T A;  1S0X A;  4PVU A;  3B3K A;  2HVC A;  3PBA A;  2OAX A;  3CS8 A;  3KMZ A;  3VHU A;  2NXX A;  3FLI A;  3VSP A;  3AX8 A;  1YYE A;  1ZGY A;  1NQ2 A;  3HC6 A;  4DK8 A;  5C4S A;  2LBD A;  5KYA A;  2AA5 A;  2VV4 A;  5FQV A;  2ABI A;  3RLJ A;  3CQV A;  3VSO A;  5HJS A;  2PIW A;  3OZ0 A;  4ZNU A;  3VN2 A;  2ZNO A;  3VTD A;  2G44 A;  4NY9 A;  5SYZ A;  4ONI A;  3W0A A;  4OHA A;  2Q5S A;  3FAL A;  1S0Z A;  3NSQ A;  4TUZ A;  1MVC A;  2ZBS A;  4PLD A;  1PRG A;  3DZY D;  1KKQ A;  2PIQ A;  1NHZ A;  3D24 A;  1YOW A;  1RKG A;  2ZY0 A;  2AX7 A;  4REE A;  4ZNW A;  5DXG A;  3ZQT A;  4YPQ A;  2QGT A;  1T7R A;  1OVL A;  5DIG A;  2PJL A;  1DKF A;  2Q61 A;  3CDS A;  1G1U A;  4MDD A;  4XTA A;  1ILG A;  3T03 A;  2VV4 B;  2I0G A;  3HO0 A;  3O1E A;  4PP3 A;  1FM6 A;  3V3E A;  3HOD A;  3N00 A;  1NUO A;  4XI3 A;  5DV6 A;  5FQS A;  3W5Q A;  1QKT A;  2GWX A;  3H0A D;  3LBD A;  5DK9 A;  5KCC A;  3CWD A;  3B0T A;  3WMH A;  2REW A;  2B23 A;  3FAL B;  4Q50 A;  4TUZ B;  4ZOM A;  3OLS A;  3X31 A;  4E2J A;  2QXS A;  4MGB A;  5KRM A;  2ZMH A;  5ICK A;  1R1K D;  4Y29 A;  1FD0 A;  1NQ7 A; 
#chains in the Genus database with same CATH homology
 5DRJ A;  4CI4 A;  5EHJ A;  1FM9 D;  4Q13 A;  1EXA A;  5EJV A;  4IW6 A;  1NQ0 A;  5KCT A;  4RUO X;  1XP1 A;  2Q6S A;  1S9Q A;  3R2A A;  4RFW A;  5AAU A;  4EM9 A;  1T63 A;  1XZX X;  1E3K A;  2J4A A;  3OSW A;  3WWR A;  4XUH A;  3UP3 A;  2R6Y A;  2VSR A;  2JFA A;  5ACC A;  4PPS A;  2POG A;  3IXP A;  3DZU D;  4JYG A;  2OUZ A;  4QE8 A;  5DI7 A;  3HVL A;  3IPU A;  2GPU A;  2ZL9 A;  5DY8 A;  2OZ7 A;  5AZV A;  3B67 A;  2O4J A;  2QSE A;  3K8S A;  4J5W A;  3VJI A;  2PIU A;  4IVW A;  4RZF A;  2AA7 A;  2IOK A;  1YA3 A;  2HBH A;  1Y0X X;  3B65 A;  3UUA B;  4X1G A;  4G21 A;  2AO6 A;  1Y9R A;  4QL8 A;  1XQC A;  4MGA A;  4HLW A;  1XLS E;  4JGV A;  4LNX A;  1YOK A;  5IZ0 A;  3KDU A;  2JFA B;  3JZB A;  2QA6 A;  2P7G A;  3L03 A;  3VJT A;  2ZNQ A;  4OAR A;  4WLB A;  3GBK A;  1R6G A;  1Z95 A;  3WGP A;  2BJ4 B;  2I4Z A;  2VV2 A;  4MG8 A;  4YNK A;  3W0C A;  1A52 A;  2H77 A;  2OVM A;  3VRV A;  5KRK A;  4A4V A;  3WT7 A;  5DXQ A;  5APH A;  5DP0 A;  4CI5 A;  4NUF A;  2I4J A;  3DZY A;  4A4W A;  1YUC A;  4G1D A;  5KRO A;  3VT5 A;  2VV1 B;  2G0H A;  1XIU A;  2JF9 A;  3H52 A;  2PIN A;  5B5B A;  4OZT U;  5G42 A;  2Q70 A;  3D6D A;  1XAP A;  2YHD A;  5AVL A;  3ZRB A;  3OMK A;  3FUR A;  3HLV A;  4MG8 B;  4R6S A;  5C4T A;  3HM1 A;  3KPZ A;  2Q6R A;  3PLZ A;  2QE4 A;  3H0A A;  3V49 A;  3OSI A;  1NQ1 A;  1R5K A;  1SKX A;  2GTK A;  4J5W C;  1R1K A;  5EC9 A;  1FCY A;  4R06 A;  3UU7 A;  4IS8 A;  4ZNS A;  1ZDT A;  2HAS A;  3W5T A;  1FM9 A;  4MGD A;  2BAW A;  2YLP A;  2I4P A;  4OH6 A;  4WHG A;  1XV9 B;  3TY0 A;  4IA1 A;  3ZR7 A;  1X7E A;  1UPW A;  2Q60 A;  3GYT A;  5DIE A;  2YLQ A;  3WTQ A;  3OKH A;  2GPO A;  4FHH A;  4JYH A;  3UP0 A;  2V0V A;  4ITF A;  2AWH A;  1S19 A;  5DZI A;  2R6W A;  2P7A A;  2R40 D;  4CSJ A;  1R20 D;  1XJ7 A;  1QKN A;  1UPV A;  4RZE A;  4JL4 A;  5KRC A;  4WVD A;  3DZU A;  3UU7 B;  4DK7 A;  2Q1H A;  1NAX A;  4IU7 A;  4E4K A;  4MGD B;  4HEE X;  1FCZ A;  1YMT A;  4O8F A;  2ZXZ A;  4OIL A;  2HB8 A;  5JI0 D;  5KRL A;  5KR9 A;  1Z5X E;  4R2U A;  4RZG A;  4TV1 A;  5KCE A;  1OSV A;  2AMB A;  4IA7 A;  1ILH A;  4RMC A;  4FHI A;  5ETH A;  2NPA A;  1U3R A;  3AN3 A;  5I4V A;  2V7C A;  3FEJ A;  4FNE A;  5G43 A;  5KCF A;  4QJR A;  2Q59 A;  2XYW A;  3OS8 A;  5KYJ A;  1PQ9 A;  3ADV A;  5GT4 A;  3D90 A;  3G0W A;  1A28 A;  2Z4B A;  3GZ9 A;  4JAZ A;  5EIT A;  1OT7 A;  3WT6 A;  3UUC A;  3Q95 A;  4G20 A;  4Q0A C;  2QXM A;  1T73 A;  4RE8 A;  4TV1 B;  3R8D A;  3R8I A;  4RWV A;  5DWG A;  3B0R A;  4YT1 A;  1UOM A;  2AXA A;  5L7G A;  5KCU A;  3AZ2 A;  3F7D A;  5DXB A;  3AUN A;  3A2J A;  1LBD A;  2PIR A;  4DMA A;  2Q59 B;  2P7Z A;  3MNE A;  2HAM A;  2ZK2 A;  3A2H A;  4K6I A;  5APJ A;  2ZK1 A;  5AAV B;  1T79 A;  4OFU A;  2XKW A;  5L7H A;  1QKM A;  1FCX A;  2HWR A;  5C4O A;  3X1H A;  3Q95 B;  5DKE A;  5HJP A;  1P93 A;  1M2Z A;  3CJW A;  4JYI A;  4OH5 A;  3TKC A;  5LWP A;  2P4Y A;  3AZ3 A;  2PNU A;  3OMP A;  4FN9 A;  4PWL A;  5DXB B;  3WJ4 A;  1X7B A;  5FQR A;  3FS1 A;  3WT5 A;  5IXK A;  3P89 A;  2YAT A;  3L3Z A;  1PQC A;  5DUH A;  4MG5 A;  5G44 A;  5AZT A;  3UUA A;  5DXK A;  3UVV A;  1GWX A;  3A9E A;  3OS8 C;  4N8R A;  4L96 A;  3OSA A;  2Q8S A;  5DXP A;  5DYB A;  5HJP B;  3S9S A;  3W0J A;  4RAK A;  1ZDU A;  2R40 A;  5DL4 A;  1R20 A;  3DR1 A;  4S0S A;  4XLD A;  5G46 A;  2PKL A;  4J26 A;  2GP7 A;  1ZKY A;  4PLE A;  3KBA A;  1L2J A;  4RME A;  2FSZ A;  2PRG A;  2BJ4 A;  4POH A;  3GWS X;  2NXX E;  2YLY A;  5L11 A;  3TKM A;  4DM8 A;  1U3Q A;  4OIV A;  4OK1 A;  3IPQ A;  2Q7L A;  2FAI A;  2QZO A;  3A3Z X;  5DUE A;  5EI1 A;  1FBY A;  3A9E B;  4G2H A;  2JJ3 A;  3UVV B;  3KDT A;  1M7W A;  5B41 A;  5HYR A;  4UDC A;  3B0W A;  4ZO1 X;  3HZF A;  2Q6J A;  3FUG A;  3K6P A;  1KV6 A;  2VV1 A;  2VV3 A;  2QMV A;  5KRF A;  2ZK6 A;  2I0J A;  3CS4 A;  1X78 A;  2ZAS A;  2ZK3 A;  3L1B A;  3LMP A;  4MG9 A;  4OEZ A;  2J7Y A;  3B0Q A;  2F4B A;  2QAB A;  5DUG A;  2AB2 A;  3DT3 A;  3R5M A;  3E00 D;  1G50 A;  2POB A;  3OS9 A;  2QZO B;  5DWI A;  1GWQ A;  1NDE A;  4IWC A;  3ET2 A;  4M8E A;  4OEY A;  4OKT A;  3DCU A;  4XT9 A;  5EGV A;  3W0Y A;  5IAW A;  3ADX A;  1DB1 A;  4YMQ A;  4WPF A;  3P8X A;  3NOA A;  4L98 A;  1NAV A;  2NW4 A;  3OMO A;  4IV4 A;  3ZRA A;  3OMM A;  3QT0 A;  1XB7 A;  3R29 A;  4MG9 B;  5DWE A;  1GS4 A;  1N83 A;  5DU5 A;  4M8H A;  3VJH A;  4ZNT A;  5H1E A;  4PPP A;  1XV9 A;  4OIU A;  3ERT A;  1K4W A;  2HB7 A;  5DSH A;  2XYJ A;  4OLM A;  3OKI A;  5CJ6 A;  3VJS A;  3VTC A;  1S9P A;  2QGW A;  1PK5 A;  3RLL A;  3W0H A;  1N4H A;  2E2R A;  4OJ4 A;  3WFG A;  5DKG A;  4A2J A;  3VTB A;  1Q4X A;  1Z5X U;  4OZR U;  5AVI A;  1X7J A;  3VRU A;  1I38 A;  3DY6 A;  5DXR A;  1ZH7 A;  4APU A;  3OMQ A;  1P8D A;  3RVF A;  1H9U A;  3ET1 A;  4ZNH A;  5KD9 A;  1E3G A;  5KRI A;  4WHF A;  3AUQ A;  4E4Q A;  1I7G A;  5M96 A;  5G3J A;  5DZ3 A;  3ADT A;  3G9E A;  2O4R A;  2QNV A;  1RJK A;  2Q7K A;  1LV2 A;  1T7T A;  1K7L A;  3W0G A;  4DOR A;  2GIU A;  3VT6 A;  4XUM A;  5DWJ A;  4XAO A;  1ERR A;  1XDK B;  5HZC A;  4REF A;  3UUD A;  5JJM A;  5E0X A;  5L7E A;  2FVJ A;  2B1Z A;  3GYU A;  1EXX A;  1T65 A;  2ZMJ A;  3K23 A;  3CLD A;  2AM9 A;  3VT4 A;  5KCD A;  4DM6 A;  2OVH A;  3ERD A;  4NIE A;  4ZN9 A;  4DQM A;  3CS6 A;  1X76 A;  3ET0 A;  4OC7 A;  5DVV A;  5DRM A;  4PRG A;  4RUP A;  5DWL A;  3CDP A;  5DXE A;  3L0J A;  2AX6 A;  4OKB A;  4S15 A;  5DV8 A;  3X36 A;  2NV7 A;  3ADS A;  3ILZ A;  2ZK5 A;  4OJB A;  5DKB A;  3PEQ A;  2ZMI A;  5DMC A;  3B68 A;  5DZ1 A;  1KNU A;  2YLO A;  4MGC A;  5KCW A;  1TXI A;  1ZUC A;  3KFC A;  3SP6 A;  3UUD B;  2Q7J A;  5AAV A;  2AMA A;  5JJM B;  2B50 A;  2Q5G A;  4UDB A;  1RKH A;  5E14 A;  4F9M A;  3E00 A;  1XQ3 A;  4RMD A;  2O9I A;  3K22 A;  3ADW A;  4LSJ A;  4OKW A;  3VRT A;  1L2I A;  2PIT A;  2YJD A;  3BQD A;  3FC6 A;  3GWX A;  5AWJ A;  5HCV A;  2HCD A;  4N1Y A;  3IA6 A;  3V9V A;  4POJ A;  3B5R A;  3E7C A;  5DMF A;  2EWP A;  2P1V A;  3RY9 A;  2IHQ A;  4QM0 A;  4BCR A;  3W5R A;  4QK4 A;  4N5G A;  2VST A;  2HAR A;  4OJ9 A;  5HYK A;  4P6W A;  5FQT A;  5GIC A;  1XVP A;  2AA2 A;  2G0G A;  3MNP A;  3KMG A;  2PIP L;  4ZO1 B;  5G5W A;  4B7W A;  3G8I A;  4UDD A;  5DX3 A;  3OGT A;  3PCU A;  5KRJ A;  3OOK A;  2Q1V A;  1XLS A;  2ZLC A;  3BEJ A;  5AK2 A;  1YP0 A;  3FC6 B;  2QA8 A;  2GPV A;  3L0L A;  3P0U A;  4RUJ A;  2ZK4 A;  4EMA A;  1YIM A;  3W0I A;  3OLF A;  1K74 D;  3MNO A;  4G1Z A;  2ATH A;  2ZXM A;  4FGY A;  4LBD A;  1ZAF A;  2PIX A;  3OAP A;  5DKS A;  4ZJR A;  3ET3 A;  1SJ0 A;  4IVY A;  2QTU A;  3R5N A;  4J5X A;  1XVP B;  4ZI1 A;  5LGA A;  4P6X A;  1TFC A;  2XHS A;  3R8A A;  5DX3 B;  2PIV A;  1RDT D;  3F5C A;  3RUU A;  4PXM A;  5DTV A;  5FQP A;  3GD2 A;  5G45 A;  1PDU A;  2XYX A;  3HC5 A;  2QA8 B;  4IW8 A;  3VT8 A;  5AWK A;  3G8O A;  4PP6 A;  3FEI A;  3P88 A;  2AYR A;  3A40 X;  2AX8 A;  4ZJW A;  4S14 A;  3KWY A;  1T74 A;  5AYG A;  5E15 A;  2HFP A;  3VT7 A;  1HJ1 A;  1G2N A;  3L3X A;  1T7F A;  1OVL B;  5E0W A;  1DKF B;  1ZEO A;  2P1U A;  3ADU A;  3CTB A;  1XPC A;  2HC4 A;  3F5C B;  2QW4 A;  3KMR A;  3X1I A;  4WQP A;  1YY4 A;  1VJB A;  2W8Y A;  2ZFX A;  1YJE A;  1NRL A;  4MGB B;  2P54 A;  4PF3 A;  2ZVT A;  1Y0S A;  1YIN A;  2QPY A;  4S0T A;  1RK3 A;  1XOW A;  5APK A;  5E1C A;  1SR7 A;  1IE9 A;  2ZKC A;  3B1M A;  4LNW A;  2AAX A;  4OFR A;  2OM9 A;  3PO9 A;  2GPP A;  3KYT A;  3EYB A;  1XP6 A;  2B1V A;  3O1D A;  4UDA A;  3D57 A;  3OZJ A;  4J5X C;  5DID A;  4IQR A;  2Z4J A;  1SQN A;  1HG4 A;  3AFR A;  3A78 A;  4XHD A;  2Q3Y A;  5E19 A;  1XNX A;  3E94 A;  3DCT A;  2J7X A;  3FXV A;  1XP9 A;  3VRW A;  5DVS A;  5DVC A;  1IE8 A;  4LTW A;  4IUI A;  3SP9 A;  2A3I A;  3GN8 A;  1XDK A;  1XNN A;  5GID A;  4NB6 A;  3V9T A;  1G5Y A;  1OSH A;  1K74 A;  3VI8 A;  3VHV A;  2ZNN A;  3B66 A;  3OLL A;  2H79 A;  4MGA B;  3AUR A;  4K7A A;  1ERE A;  2OCF A;  5A86 A;  4DOS A;  5GIE A;  4ZN7 A;  1UHL A;  2G5O A;  2GL8 A;  4MG7 A;  3TX7 B;  1U9E A;  3V4A A;  5DZH A;  3RUT A;  3IPS A;  4OGH A;  3NSP A;  1RDT A;  4G1Y A;  1FM6 D;  1PQ6 A;  4ZNV A;  2QH6 A;  4NQA B;  1BSX A;  1M13 A;  4IA2 A;  2QR9 A;  3W5P A;  1N46 A;  1GWR A;  5DXM A;  3VT3 A;  3SZ1 A;  2ZK0 A;  5DLR A;  2HWQ A;  5DZ0 A;  3VT9 A;  3JZC A;  3VHW A;  4K4J A;  2ACL A;  3OOF A;  5C4U A;  1X7R A;  3V9Y A;  1QKU A;  2Q5P A;  4N73 A;  1UHL B;  1U3S A;  1NYX A;  2AA6 A;  2IOG A;  2ZNP A;  3A2I A;  4MG7 B;  4OEA A;  4QE6 A;  5F9B A;  4G2I A;  3WJ5 A;  1T76 A;  5KRH A;  2Q7I A;  4KZJ A;  2ZXN A;  4OED A;  3WFF A;  3IMY A;  3L0E A;  4ITE A;  3PRG A;  1MV9 A;  1MZN A;  3AZ1 A;  5K13 A;  2YFE A;  2J14 A;  4KZI A;  2PIO A;  5KRA A;  1PCG A;  2VV0 A;  3AN4 A;  4OZT E;  2YJA B;  2ACL B;  3D5F A;  1WM0 X;  3M7R A;  4IWF A;  3BC5 A;  3IXP D;  1T7M A;  4MG6 A;  1I7I A;  4OKX A;  4KZM A;  3HQ5 A;  5JY3 A;  2ZLA A;  1T5Z A;  4X1F A;  5DYD A;  4PP5 A;  5DV3 A;  1I37 A;  3U9Q A;  4IA3 A;  5E7V A;  3V3Q A;  4J24 A;  2P15 A;  4OZR E;  1PZL A;  4IV2 A;  2AX9 A;  2P1T A;  1S0X A;  4PVU A;  3B3K A;  2HVC A;  3PBA A;  2OAX A;  3CS8 A;  3KMZ A;  3VHU A;  2NXX A;  3FLI A;  3VSP A;  3AX8 A;  1YYE A;  1ZGY A;  1NQ2 A;  3HC6 A;  4DK8 A;  5C4S A;  2LBD A;  5KYA A;  2AA5 A;  2VV4 A;  5FQV A;  2ABI A;  3RLJ A;  3CQV A;  3VSO A;  5HJS A;  2PIW A;  3OZ0 A;  4ZNU A;  3VN2 A;  2ZNO A;  3VTD A;  2G44 A;  4NY9 A;  5SYZ A;  4ONI A;  3W0A A;  4OHA A;  2Q5S A;  3FAL A;  1S0Z A;  3NSQ A;  4TUZ A;  1MVC A;  2ZBS A;  4PLD A;  1PRG A;  3DZY D;  1KKQ A;  2PIQ A;  1NHZ A;  3D24 A;  1YOW A;  1RKG A;  2ZY0 A;  2AX7 A;  4REE A;  4ZNW A;  5DXG A;  3ZQT A;  4YPQ A;  2QGT A;  1T7R A;  1OVL A;  5DIG A;  2PJL A;  1DKF A;  2Q61 A;  3CDS A;  1G1U A;  4MDD A;  4XTA A;  1ILG A;  3T03 A;  2VV4 B;  2I0G A;  3HO0 A;  3O1E A;  4PP3 A;  1FM6 A;  3V3E A;  3HOD A;  3N00 A;  1NUO A;  4XI3 A;  5DV6 A;  5FQS A;  3W5Q A;  1QKT A;  2GWX A;  3H0A D;  3LBD A;  5DK9 A;  5KCC A;  3CWD A;  3B0T A;  3WMH A;  2REW A;  2B23 A;  3FAL B;  4Q50 A;  4TUZ B;  4ZOM A;  3OLS A;  3X31 A;  4E2J A;  2QXS A;  4MGB A;  5KRM A;  2ZMH A;  5ICK A;  1R1K D;  4Y29 A;  1FD0 A;  1NQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...