4JL4A

Crystal structure of the complex between ppargamma lbd and the ligand lj570 [(2s)-3-(biphenyl-4-yl)-2-(biphenyl-4-yloxy)propanoic acid]
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
268
Chain Sequence
ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex between PPARgamma LBD and the dual agonist LJ570
rcsb
molecule keywords Peroxisome proliferator-activated receptor gamma
molecule tags Transcription/agonist
source organism Homo sapiens
total genus 93
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4jl4A00
2PNUA 4OKWA 2I0JA 2OVHA 2QA8A 3RLLA 4IQRA 1G50A 4MG8B 4XAOA 5JI0D 4S14A 4XUMA 4X1GA 2AWHA 2Q1VA 1MV9A 4G1DA 2NXXE 4MG8A 3UUDB 3ET2A 2QXSA 2PRGA 3FXVA 1XP1A 3H52A 1UPWA 3VT6A 5LWPA 3OKIA 3HLVA 5AAVB 1S9PA 3UUDA 3RUTA 2VV0A 2AB2A 1I38A 5KYAA 3HODA 5AAVA 3G8OA 4DORA 2HAMA 3CWDA 3OLSA 5B5BA 1Z5XE 3F5CB 3R5NA 4RUPA 4IVYA 4NB6A 3V9TA 5DZ0A 5AYGA 3V4AA 2ZNOA 3F5CA 3H0AD 4PLDA 1UHLB 2JF9A 5E15A 4OEDA 4NUFA 5HJPB 4MGCA 3CTBA 3ERDA 3UP0A 1NAVA 3ZQTA 1RKGA 1UHLA 3ILZA 3NSPA 4OZRU 5DWIA 5HJPA 2PIRA 3FALA 3KYTA 3U9QA 5C4OA 4G1YA 1A52A 2AO6A 3RLJA 4UDAA 3OLFA 3KMGA 4PP3A 5DWJA 5DZ3A 3W0YA 4DOSA 1ZUCA 2AA7A 1YY4A 1EXXA 2QGTA 4PRGA 2XYJA 2ZVTA 3D5FA 1X7RA 2ACLB 3GYTA 3HM1A 3D90A 3IPSA 3V3QA 4E4KA 2HWQA 2GL8A 4S0TA 4PXMA 2NXXA 4OFUA 1DB1A 5K13A 2H77A 4CI5A 4LTWA 5E0XA 5KRFA 1YP0A 4RMDA 3HC5A 1FM9D 4WLBA 3OSAA 2YJDA 3KFCA 5KCDA 5DXRA 5ETHA 3D57A 5DXQA 3SZ1A 1YOKA 1ZDTA 2J7YA 2VV1B 2ZMHA 3AZ3A 1GWRA 1E3KA 2AX6A 2Q7LA 3ADSA 4N5GA 3B0QA 5EITA 2GPOA 1XP6A 3NOAA 5KR9A 4ZOMA 5E14A 2AA6A 3W5RA 5DXGA 2ZMIA 2PIVA 4OLMA 4XTAA 5A86A 4RMEA 5DRJA 3N00A 5DVSA 3VI8A 3VTBA 4IV2A 4O8FA 3OMKA 3DZUD 1FM6A 3AN4A 4J5WA 2ZY0A 4WVDA 3V9VA 3S9SA 3W0AA 4OEZA 2OUZA 2VV3A 4UDDA 3VJIA 3KDUA 4N8RA 1FCYA 4A4VA 5I4VA 2ZK6A 4B7WA 2GPUA 2PJLA 2VSRA 5KCWA 3KMZA 4G2HA 4IA2A 3B0TA 3FEJA 1QKNA 5DKGA 1X76A 2Q61A 1T5ZA 4K7AA 1T65A 1NQ0A 4QL8A 3K6PA 3T03A 3W5PA 1Q4XA 2EWPA 2Q6JA 5KRLA 5C4UA 2P1VA 4F9MA 1S9QA 3ADTA 3NSQA 4TV1B 1FCZA 2PKLA 4OZTU 4P6XA 2HASA 1PRGA 2VSTA 2ZL9A 4NIEA 3MNOA 5SYZA 1LBDA 5KRAA 4XHDA 3ET1A 5DVCA 3L3XA 2R6WA 2PITA 1XAPA 2REWA 2NW4A 2ZFXA 2ZMJA 4G21A 1G1UA 5KCFA 4DMAA 1R5KA 2Q59B 3PCUA 1PQ9A 1QKMA 4RUJA 4XLDA 3HQ5A 1U9EA 2BJ4A 4NQAB 4M8HA 4KZJA 4DQMA 1T7MA 5DX3B 3TX7B 2HVCA 2Q59A 3IMYA 4RE8A 4UDCA 2Q7IA 3UP3A 1M2ZA 3CS8A 3P89A 4IVWA 5KCCA 1KKQA 5DX3A 3DT3A 1NUOA 4QJRA 2GP7A 2XKWA 4OJBA 4ZNHA 5KRCA 1ZEOA 2B1ZA 3KPZA 4BCRA 1GWXA 3VT8A 5HYRA 4ZNTA 4RZFA 2AX9A 3R5MA 3BC5A 4G2IA 4XT9A 5APKA 3WTQA 3AUQA 4OHAA 3B5RA 3UVVB 1YMTA 3B1MA 3TY0A 3R8DA 2QABA 2B1VA 5GIEA 3UVVA 4OGHA 4R2UA 5FQRA 5DUHA 5DV3A 2Q60A 3OMOA 5FQPA 3W5TA 2I4ZA 3GBKA 1RDTA 4R06A 3WJ5A 3B67A 1K7LA 1QKTA 4JYGA 5DUEA 4PVUA 3OMMA 4REFA 1NQ1A 4R6SA 1IE8A 4ITFA 4WHGA 3VT4A 5KRMA 4FNEA 1Y0SA 2QZOB 5AK2A 1K74A 1ILHA 4Q50A 3L0JA 3X36A 5C4TA 1T79A 3IXPA 2GTKA 3JZCA 1RKHA 1X7EA 3EYBA 3O1EA 2ZKCA 2QZOA 3OGTA 3PBAA 1T7TA 3KWYA 1TXIA 3MNEA 4ZNUA 4WPFA 4P6WA 5DYDA 5L11A 1FCXA 3ET0A 4N1YA 5DVVA 3VRVA 1XNXA 2VV4B 2YFEA 5JJMB 4X1FA 4IW6A 1PQCA 2VV2A 5KRKA 3V9YA 4OK1A 4JYIA 2VV4A 3PRGA 1XPCA 1YYEA 4J5XC 4OH5A 3OS8A 4OKBA 5KRJA 4E2JA 2ZBSA 4ZN9A 3KMRA 4ZI1A 1X78A 2ZLCA 3GWXA 4MGDB 1T7FA 1ZKYA 3L0LA 4FHIA 2J7XA 3IPQA 5L7GA 2O4RA 3AX8A 3A2HA 1S0XA 2YLOA 1T63A 2B23A 2Q1HA 3D24A 4MGDA 3F7DA 5DTVA 4G20A 4A2JA 4IUIA 4WQPA 2GWXA 3CQVA 5DKSA 1RK3A 3CS6A 4EMAA 1OSVA 5DU5A 5G45A 1YUCA 5E0WA 1SKXA 3D6DA 3WGPA 2ZLAA 1Y0XX 2G5OA 3X31A 3OLLA 1XIUA 4FGYA 2ACLA 2O9IA 3FEIA 4OZRE 4OKTA 5DWEA 3AFRA 5DZHA 3DR1A 2P4YA 2QXMA 2ZXNA 5KRHA 1I7IA 4MGAB 1PK5A 2HWRA 4IU7A 1T74A 3VT9A 5HZCA 3B0RA 3AZ2A 1MVCA 4MGAA 2O4JA 2XYWA 2Q5GA 4FN9A 5FQTA 1FM6D 3V3EA 3G0WA 3VTDA 1FD0A 2ATHA 3B65A 2VV1A 1SR7A 4E4QA 1HJ1A 1ZGYA 2ZNQA 1XQ3A 4IA1A 3W0HA 2IOKA 3W0IA 4M8EA 3HC6A 1DKFB 2ZASA 2P54A 4TUZB 4Y29A 5GT4A 1PCGA 2HFPA 1DKFA 4IS8A 5EHJA 3OZJA 4RAKA 4TUZA 3CJWA 3GD2A 3PO9A 3R29A 2NPAA 3A9EB 2OCFA 4IA3A 2POBA 2IHQA 2AMBA 2I4PA 2JFAB 2ZXMA 1S19A 2FVJA 2G0HA 2PIUA 4OEAA 4WHFA 5G5WA 2ZK3A 3DCTA 3VRWA 2QPYA 1T7RA 1U3QA 2OAXA 2JFAA 4ZO1X 5HYKA 3E94A 3K23A 4ZO1B 5FQVA 3DZYA 5DIDA 2QH6A 3OZ0A 3UUCA 1WM0X 2ZK1A 3OSIA 4S15A 3CDPA 4K4JA 5DYBA 3RVFA 1PDUA 2P7GA 4YNKA 4APUA 4J26A 3GZ9A 1SJ0A 2ZK0A 5GIDA 1XB7A 4QK4A 4TV1A 1S0ZA 1XNNA 2HC4A 3A3ZX 1KNUA 3OMPA 3P0UA 4N73A 5IAWA 3V49A 1U3SA 3FC6B 2Q6RA 5F9BA 1OVLB 5KCEA 5DWGA 2B50A 2P15A 3JZBA 3GN8A 2R6YA 2Z4JA 3FC6A 3W0JA 4PP5A 1OVLA 2XYXA 3GWSX 4OZTE 4MG9B 3B3KA 2QSEA 1XLSE 2R40A 4ZN7A 1RDTD 4MG9A 5DMFA 2Q5SA 4L96A 1K4WA 4J5WC 4QM0A 3FURA 3VHVA 5G42A 3QT0A 1UPVA 3OS9A 3W0GA 5G44A 3WFFA 4POJA 2QA6A 5DSHA 1K74D 2P7ZA 3AUNA 5L7EA 2Q8SA 4ZNVA 2IOGA 1NDEA 5DKEA 3IXPD 2YATA 5DLRA 5DK9A 5APJA 3E7CA 4G1ZA 3K8SA 2PIQA 5EI1A 3VHUA 4YPQA 4HEEX 2Q6SA 4A4WA 4OC7A 4PP6A 5AVLA 2OVMA 2HBHA 1R1KA 1ZDUA 2PINA 5DXBB 2P1UA 3ADWA 3P88A 4OARA 3CDSA 3P8XA 4J5XA 5AWJA 5DV6A 3WT5A 4YT1A 3BEJA 2QTUA 5IXKA 2F4BA 4PF3A 3B0WA 1M7WA 5DKBA 3ERTA 1L2IA 1E3GA 3G9EA 3WWRA 1G5YA 3VTCA 3VT5A 1R20A 1EREA 3OMQA 2HB7A 3OSWA 3VN2A 1LV2A 3E00A 4J24A 3W0CA 1XV9B 4RFWA 4PPPA 5DUGA 3VSOA 4RWVA 2GIUA 2ZXZA 5DV8A 1XV9A 2Q7KA 3ADXA 2OZ7A 1FBYA 4IWFA 4LNXA 3A78A 4DK8A 1BSXA 3K22A 5CJ6A 5JJMA 1G2NA 1XLSA 5DL4A 3VT7A 1ERRA 1GWQA 3R8AA 1Z5XU 3L3ZA 5APHA 1Y9RA 5AAUA 4YMQA 5AWKA 5HCVA 2PIOA 3VJTA 1XP9A 3L0EA 4POHA 4CI4A 2QW4A 3WT6A 2P7AA 2LBDA 3ADUA 5E7VA 3UU7B 1L2JA 1IE9A 4PPSA 5DY8A 4JAZA 3A2JA 5B41A 1YJEA 4REEA 4FHHA 3HZFA 4ONIA 3UU7A 4MG7B 3B68A 1YINA 3WMHA 4PWLA 1ZH7A 2HB8A 4ZJRA 4RMCA 3ZR7A 3IPUA 2P1TA 3RY9A 4L98A 1T73A 4MG7A 1MZNA 3W5QA 5E19A 1XZXX 1Z95A 2V7CA 3KDTA 1N4HA 2Z4BA 4K6IA 3VRUA 1NHZA 3FLIA 4KZIA 5KROA 2G0GA 3B66A 2G44A 1YOWA 2AM9A 3FALB 3OAPA 5E1CA 1T76A 2AA2A 3O1DA 3PEQA 5DZIA 4DM6A 4NY9A 4Q13A 5ICKA 2I4JA 5AVIA 2Q7JA 4ITEA 4JYHA 4DK7A 3ET3A 2Q3YA 3X1IA 1SQNA 4KZMA 3L1BA 1GS4A 3A2IA 4IV4A 3R2AA 3AZ1A 2YLYA 3H0AA 1PZLA 2H79A 4MGBB 3OS8C 3KBAA 5GICA 5C4SA 5L7HA 3VJSA 4MGBA 1VJBA 1XVPB 3WT7A 3UUAB 5JY3A 2AX7A 2HCDA 2POGA 4XI3A 3LMPA 2BAWA 4IA7A 3VHWA 3DZYD 2YLPA 1PQ6A 1XVPA 3UUAA 3WJ4A 4MDDA 2AYRA 1RJKA 3DCUA 5DZ1A 3VSPA 3VRTA 5DMCA 3VJHA 2AX8A 5G3JA 3BQDA 1YIMA 1ZAFA 1NRLA 3TKCA 5M96A 3ZRBA 4LBDA 3A9EA 4OKXA 3L03A 5KCUA 2I0GA 1XJ7A 1KV6A 5G43A 4IWCA 2Q70A 5ACCA 3AURA 5DRMA 1FM9A 3OOKA 1P93A 4LSJA 5DP0A 4RZGA 4OEYA 2YLQA 4Q0AC 4QE8A 4OILA 2OM9A 1A28A 2AAXA 1NAXA 1X7JA 2J14A 2R40D 1UOMA 2QR9A 5DXKA 4OH6A 1U3RA 2PIPL 2QGWA 3CLDA 5DWLA 2YHDA 1N46A 5DI7A 5DXMA 5EJVA 5KD9A 2HARA 2A3IA 2JJ3A 3LBDA 4OJ4A 3TKMA 4IW8A 5KRIA 1I37A 5DXEA 3OKHA 2FAIA 1QKUA 4QE6A 3A40X 4LNWA 2V0VA 1ILGA 3AN3A 4S0SA 5AZVA 3HO0A 4EM9A 3IA6A 3ZRAA 2PIWA 5FQSA 2QE4A 4ZNSA 1N83A 2NV7A 5KCTA 3PLZA 5H1EA 3VT3A 3G8IA 2PIXA 4OJ9A 5EGVA 4DM8A 3DZUA 5AZTA 3OOFA 1R1KD 2ZK4A 4MG5A 2ZNPA 4OIUA 2QNVA 3R8IA 3WFGA 4XUHA 5G46A 1NYXA 3X1HA 1I7GA 1XDKB 1R6GA 2J4AA 5HJSA 2GPVA 4ZNWA 5IZ0A 4RZEA 2BJ4B 3ADVA 5DXPA 1XDKA 1R20D 3FUGA 3M7RA 3SP6A 3E00D 4HLWA 3DY6A 1YA3A 3GYUA 4CSJA 1NQ7A 2AXAA 4PLEA 1H9UA 1EXAA 2QMVA 3SP9A 3Q95B 1HG4A 1TFCA 4UDBA 5EC9A 3FS1A 1NQ2A 4JGVA 4OIVA 1XOWA 1M13A 5DIEA 3Q95A 2E2RA 4RUOX 2AA5A 2XHSA 2GPPA 2W8YA 2ZK2A 5DIGA 3RUUA 4ZJWA 5KYJA 2ZK5A 5DXBA 1X7BA 1OT7A 4OFRA 4JL4A 2FSZA 2ZNNA 2Q5PA 2AMAA 4MG6A 3HVLA 5LGAA 2YJAB 1P8DA 2ABIA 2QA8B 3MNPA 3CS4A 1XQCA 1OSHA
chains in the Genus database with same CATH superfamily
2PNUA 4OKWA 2I0JA 2OVHA 2QA8A 3RLLA 4IQRA 1G50A 4MG8B 4XAOA 5JI0D 4S14A 4XUMA 4X1GA 2AWHA 2Q1VA 1MV9A 4G1DA 2NXXE 4MG8A 3UUDB 3ET2A 2QXSA 2PRGA 3FXVA 1XP1A 3H52A 1UPWA 3VT6A 5LWPA 3OKIA 3HLVA 5AAVB 1S9PA 3UUDA 3RUTA 2VV0A 2AB2A 1I38A 5KYAA 3HODA 5AAVA 3G8OA 4DORA 2HAMA 3CWDA 3OLSA 5B5BA 1Z5XE 3F5CB 3R5NA 4RUPA 4IVYA 4NB6A 3V9TA 5DZ0A 5AYGA 3V4AA 2ZNOA 3F5CA 3H0AD 4PLDA 1UHLB 2JF9A 5E15A 4OEDA 4NUFA 5HJPB 4MGCA 3CTBA 3ERDA 3UP0A 1NAVA 3ZQTA 1RKGA 1UHLA 3ILZA 3NSPA 4OZRU 5DWIA 5HJPA 2PIRA 3FALA 3KYTA 3U9QA 5C4OA 4G1YA 1A52A 2AO6A 3RLJA 4UDAA 3OLFA 3KMGA 4PP3A 5DWJA 5DZ3A 3W0YA 4DOSA 1ZUCA 2AA7A 1YY4A 1EXXA 2QGTA 4PRGA 2XYJA 2ZVTA 3D5FA 1X7RA 2ACLB 3GYTA 3HM1A 3D90A 3IPSA 3V3QA 4E4KA 2HWQA 2GL8A 4S0TA 4PXMA 2NXXA 4OFUA 1DB1A 5K13A 2H77A 4CI5A 4LTWA 5E0XA 5KRFA 1YP0A 4RMDA 3HC5A 1FM9D 4WLBA 3OSAA 2YJDA 3KFCA 5KCDA 5DXRA 5ETHA 3D57A 5DXQA 3SZ1A 1YOKA 1ZDTA 2J7YA 2VV1B 2ZMHA 3AZ3A 1GWRA 1E3KA 2AX6A 2Q7LA 3ADSA 4N5GA 3B0QA 5EITA 2GPOA 1XP6A 3NOAA 5KR9A 4ZOMA 5E14A 2AA6A 3W5RA 5DXGA 2ZMIA 2PIVA 4OLMA 4XTAA 5A86A 4RMEA 5DRJA 3N00A 5DVSA 3VI8A 3VTBA 4IV2A 4O8FA 3OMKA 3DZUD 1FM6A 3AN4A 4J5WA 2ZY0A 4WVDA 3V9VA 3S9SA 3W0AA 4OEZA 2OUZA 2VV3A 4UDDA 3VJIA 3KDUA 4N8RA 1FCYA 4A4VA 5I4VA 2ZK6A 4B7WA 2GPUA 2PJLA 2VSRA 5KCWA 3KMZA 4G2HA 4IA2A 3B0TA 3FEJA 1QKNA 5DKGA 1X76A 2Q61A 1T5ZA 4K7AA 1T65A 1NQ0A 4QL8A 3K6PA 3T03A 3W5PA 1Q4XA 2EWPA 2Q6JA 5KRLA 5C4UA 2P1VA 4F9MA 1S9QA 3ADTA 3NSQA 4TV1B 1FCZA 2PKLA 4OZTU 4P6XA 2HASA 1PRGA 2VSTA 2ZL9A 4NIEA 3MNOA 5SYZA 1LBDA 5KRAA 4XHDA 3ET1A 5DVCA 3L3XA 2R6WA 2PITA 1XAPA 2REWA 2NW4A 2ZFXA 2ZMJA 4G21A 1G1UA 5KCFA 4DMAA 1R5KA 2Q59B 3PCUA 1PQ9A 1QKMA 4RUJA 4XLDA 3HQ5A 1U9EA 2BJ4A 4NQAB 4M8HA 4KZJA 4DQMA 1T7MA 5DX3B 3TX7B 2HVCA 2Q59A 3IMYA 4RE8A 4UDCA 2Q7IA 3UP3A 1M2ZA 3CS8A 3P89A 4IVWA 5KCCA 1KKQA 5DX3A 3DT3A 1NUOA 4QJRA 2GP7A 2XKWA 4OJBA 4ZNHA 5KRCA 1ZEOA 2B1ZA 3KPZA 4BCRA 1GWXA 3VT8A 5HYRA 4ZNTA 4RZFA 2AX9A 3R5MA 3BC5A 4G2IA 4XT9A 5APKA 3WTQA 3AUQA 4OHAA 3B5RA 3UVVB 1YMTA 3B1MA 3TY0A 3R8DA 2QABA 2B1VA 5GIEA 3UVVA 4OGHA 4R2UA 5FQRA 5DUHA 5DV3A 2Q60A 3OMOA 5FQPA 3W5TA 2I4ZA 3GBKA 1RDTA 4R06A 3WJ5A 3B67A 1K7LA 1QKTA 4JYGA 5DUEA 4PVUA 3OMMA 4REFA 1NQ1A 4R6SA 1IE8A 4ITFA 4WHGA 3VT4A 5KRMA 4FNEA 1Y0SA 2QZOB 5AK2A 1K74A 1ILHA 4Q50A 3L0JA 3X36A 5C4TA 1T79A 3IXPA 2GTKA 3JZCA 1RKHA 1X7EA 3EYBA 3O1EA 2ZKCA 2QZOA 3OGTA 3PBAA 1T7TA 3KWYA 1TXIA 3MNEA 4ZNUA 4WPFA 4P6WA 5DYDA 5L11A 1FCXA 3ET0A 4N1YA 5DVVA 3VRVA 1XNXA 2VV4B 2YFEA 5JJMB 4X1FA 4IW6A 1PQCA 2VV2A 5KRKA 3V9YA 4OK1A 4JYIA 2VV4A 3PRGA 1XPCA 1YYEA 4J5XC 4OH5A 3OS8A 4OKBA 5KRJA 4E2JA 2ZBSA 4ZN9A 3KMRA 4ZI1A 1X78A 2ZLCA 3GWXA 4MGDB 1T7FA 1ZKYA 3L0LA 4FHIA 2J7XA 3IPQA 5L7GA 2O4RA 3AX8A 3A2HA 1S0XA 2YLOA 1T63A 2B23A 2Q1HA 3D24A 4MGDA 3F7DA 5DTVA 4G20A 4A2JA 4IUIA 4WQPA 2GWXA 3CQVA 5DKSA 1RK3A 3CS6A 4EMAA 1OSVA 5DU5A 5G45A 1YUCA 5E0WA 1SKXA 3D6DA 3WGPA 2ZLAA 1Y0XX 2G5OA 3X31A 3OLLA 1XIUA 4FGYA 2ACLA 2O9IA 3FEIA 4OZRE 4OKTA 5DWEA 3AFRA 5DZHA 3DR1A 2P4YA 2QXMA 2ZXNA 5KRHA 1I7IA 4MGAB 1PK5A 2HWRA 4IU7A 1T74A 3VT9A 5HZCA 3B0RA 3AZ2A 1MVCA 4MGAA 2O4JA 2XYWA 2Q5GA 4FN9A 5FQTA 1FM6D 3V3EA 3G0WA 3VTDA 1FD0A 2ATHA 3B65A 2VV1A 1SR7A 4E4QA 1HJ1A 1ZGYA 2ZNQA 1XQ3A 4IA1A 3W0HA 2IOKA 3W0IA 4M8EA 3HC6A 1DKFB 2ZASA 2P54A 4TUZB 4Y29A 5GT4A 1PCGA 2HFPA 1DKFA 4IS8A 5EHJA 3OZJA 4RAKA 4TUZA 3CJWA 3GD2A 3PO9A 3R29A 2NPAA 3A9EB 2OCFA 4IA3A 2POBA 2IHQA 2AMBA 2I4PA 2JFAB 2ZXMA 1S19A 2FVJA 2G0HA 2PIUA 4OEAA 4WHFA 5G5WA 2ZK3A 3DCTA 3VRWA 2QPYA 1T7RA 1U3QA 2OAXA 2JFAA 4ZO1X 5HYKA 3E94A 3K23A 4ZO1B 5FQVA 3DZYA 5DIDA 2QH6A 3OZ0A 3UUCA 1WM0X 2ZK1A 3OSIA 4S15A 3CDPA 4K4JA 5DYBA 3RVFA 1PDUA 2P7GA 4YNKA 4APUA 4J26A 3GZ9A 1SJ0A 2ZK0A 5GIDA 1XB7A 4QK4A 4TV1A 1S0ZA 1XNNA 2HC4A 3A3ZX 1KNUA 3OMPA 3P0UA 4N73A 5IAWA 3V49A 1U3SA 3FC6B 2Q6RA 5F9BA 1OVLB 5KCEA 5DWGA 2B50A 2P15A 3JZBA 3GN8A 2R6YA 2Z4JA 3FC6A 3W0JA 4PP5A 1OVLA 2XYXA 3GWSX 4OZTE 4MG9B 3B3KA 2QSEA 1XLSE 2R40A 4ZN7A 1RDTD 4MG9A 5DMFA 2Q5SA 4L96A 1K4WA 4J5WC 4QM0A 3FURA 3VHVA 5G42A 3QT0A 1UPVA 3OS9A 3W0GA 5G44A 3WFFA 4POJA 2QA6A 5DSHA 1K74D 2P7ZA 3AUNA 5L7EA 2Q8SA 4ZNVA 2IOGA 1NDEA 5DKEA 3IXPD 2YATA 5DLRA 5DK9A 5APJA 3E7CA 4G1ZA 3K8SA 2PIQA 5EI1A 3VHUA 4YPQA 4HEEX 2Q6SA 4A4WA 4OC7A 4PP6A 5AVLA 2OVMA 2HBHA 1R1KA 1ZDUA 2PINA 5DXBB 2P1UA 3ADWA 3P88A 4OARA 3CDSA 3P8XA 4J5XA 5AWJA 5DV6A 3WT5A 4YT1A 3BEJA 2QTUA 5IXKA 2F4BA 4PF3A 3B0WA 1M7WA 5DKBA 3ERTA 1L2IA 1E3GA 3G9EA 3WWRA 1G5YA 3VTCA 3VT5A 1R20A 1EREA 3OMQA 2HB7A 3OSWA 3VN2A 1LV2A 3E00A 4J24A 3W0CA 1XV9B 4RFWA 4PPPA 5DUGA 3VSOA 4RWVA 2GIUA 2ZXZA 5DV8A 1XV9A 2Q7KA 3ADXA 2OZ7A 1FBYA 4IWFA 4LNXA 3A78A 4DK8A 1BSXA 3K22A 5CJ6A 5JJMA 1G2NA 1XLSA 5DL4A 3VT7A 1ERRA 1GWQA 3R8AA 1Z5XU 3L3ZA 5APHA 1Y9RA 5AAUA 4YMQA 5AWKA 5HCVA 2PIOA 3VJTA 1XP9A 3L0EA 4POHA 4CI4A 2QW4A 3WT6A 2P7AA 2LBDA 3ADUA 5E7VA 3UU7B 1L2JA 1IE9A 4PPSA 5DY8A 4JAZA 3A2JA 5B41A 1YJEA 4REEA 4FHHA 3HZFA 4ONIA 3UU7A 4MG7B 3B68A 1YINA 3WMHA 4PWLA 1ZH7A 2HB8A 4ZJRA 4RMCA 3ZR7A 3IPUA 2P1TA 3RY9A 4L98A 1T73A 4MG7A 1MZNA 3W5QA 5E19A 1XZXX 1Z95A 2V7CA 3KDTA 1N4HA 2Z4BA 4K6IA 3VRUA 1NHZA 3FLIA 4KZIA 5KROA 2G0GA 3B66A 2G44A 1YOWA 2AM9A 3FALB 3OAPA 5E1CA 1T76A 2AA2A 3O1DA 3PEQA 5DZIA 4DM6A 4NY9A 4Q13A 5ICKA 2I4JA 5AVIA 2Q7JA 4ITEA 4JYHA 4DK7A 3ET3A 2Q3YA 3X1IA 1SQNA 4KZMA 3L1BA 1GS4A 3A2IA 4IV4A 3R2AA 3AZ1A 2YLYA 3H0AA 1PZLA 2H79A 4MGBB 3OS8C 3KBAA 5GICA 5C4SA 5L7HA 3VJSA 4MGBA 1VJBA 1XVPB 3WT7A 3UUAB 5JY3A 2AX7A 2HCDA 2POGA 4XI3A 3LMPA 2BAWA 4IA7A 3VHWA 3DZYD 2YLPA 1PQ6A 1XVPA 3UUAA 3WJ4A 4MDDA 2AYRA 1RJKA 3DCUA 5DZ1A 3VSPA 3VRTA 5DMCA 3VJHA 2AX8A 5G3JA 3BQDA 1YIMA 1ZAFA 1NRLA 3TKCA 5M96A 3ZRBA 4LBDA 3A9EA 4OKXA 3L03A 5KCUA 2I0GA 1XJ7A 1KV6A 5G43A 4IWCA 2Q70A 5ACCA 3AURA 5DRMA 1FM9A 3OOKA 1P93A 4LSJA 5DP0A 4RZGA 4OEYA 2YLQA 4Q0AC 4QE8A 4OILA 2OM9A 1A28A 2AAXA 1NAXA 1X7JA 2J14A 2R40D 1UOMA 2QR9A 5DXKA 4OH6A 1U3RA 2PIPL 2QGWA 3CLDA 5DWLA 2YHDA 1N46A 5DI7A 5DXMA 5EJVA 5KD9A 2HARA 2A3IA 2JJ3A 3LBDA 4OJ4A 3TKMA 4IW8A 5KRIA 1I37A 5DXEA 3OKHA 2FAIA 1QKUA 4QE6A 3A40X 4LNWA 2V0VA 1ILGA 3AN3A 4S0SA 5AZVA 3HO0A 4EM9A 3IA6A 3ZRAA 2PIWA 5FQSA 2QE4A 4ZNSA 1N83A 2NV7A 5KCTA 3PLZA 5H1EA 3VT3A 3G8IA 2PIXA 4OJ9A 5EGVA 4DM8A 3DZUA 5AZTA 3OOFA 1R1KD 2ZK4A 4MG5A 2ZNPA 4OIUA 2QNVA 3R8IA 3WFGA 4XUHA 5G46A 1NYXA 3X1HA 1I7GA 1XDKB 1R6GA 2J4AA 5HJSA 2GPVA 4ZNWA 5IZ0A 4RZEA 2BJ4B 3ADVA 5DXPA 1XDKA 1R20D 3FUGA 3M7RA 3SP6A 3E00D 4HLWA 3DY6A 1YA3A 3GYUA 4CSJA 1NQ7A 2AXAA 4PLEA 1H9UA 1EXAA 2QMVA 3SP9A 3Q95B 1HG4A 1TFCA 4UDBA 5EC9A 3FS1A 1NQ2A 4JGVA 4OIVA 1XOWA 1M13A 5DIEA 3Q95A 2E2RA 4RUOX 2AA5A 2XHSA 2GPPA 2W8YA 2ZK2A 5DIGA 3RUUA 4ZJWA 5KYJA 2ZK5A 5DXBA 1X7BA 1OT7A 4OFRA 4JL4A 2FSZA 2ZNNA 2Q5PA 2AMAA 4MG6A 3HVLA 5LGAA 2YJAB 1P8DA 2ABIA 2QA8B 3MNPA 3CS4A 1XQCA 1OSHA
chains in the Genus database with same CATH topology
2PNUA 4OKWA 2I0JA 2OVHA 2QA8A 3RLLA 4IQRA 1G50A 4MG8B 4XAOA 5JI0D 4S14A 4XUMA 4X1GA 2AWHA 2Q1VA 1MV9A 4G1DA 2NXXE 4MG8A 3UUDB 3ET2A 2QXSA 2PRGA 3FXVA 1XP1A 3H52A 1UPWA 3VT6A 5LWPA 3OKIA 3HLVA 5AAVB 1S9PA 3UUDA 3RUTA 2VV0A 2AB2A 1I38A 5KYAA 3HODA 5AAVA 3G8OA 4DORA 2HAMA 3CWDA 3OLSA 5B5BA 1Z5XE 3F5CB 3R5NA 4RUPA 4IVYA 4NB6A 3V9TA 5DZ0A 5AYGA 3V4AA 2ZNOA 3F5CA 3H0AD 4PLDA 1UHLB 2JF9A 5E15A 4OEDA 4NUFA 5HJPB 4MGCA 3CTBA 3ERDA 3UP0A 1NAVA 3ZQTA 1RKGA 1UHLA 3ILZA 3NSPA 4OZRU 5DWIA 5HJPA 2PIRA 3FALA 3KYTA 3U9QA 5C4OA 4G1YA 1A52A 2AO6A 3RLJA 4UDAA 3OLFA 3KMGA 4PP3A 5DWJA 5DZ3A 3W0YA 4DOSA 1ZUCA 2AA7A 1YY4A 1EXXA 2QGTA 4PRGA 2XYJA 2ZVTA 3D5FA 1X7RA 2ACLB 3GYTA 3HM1A 3D90A 3IPSA 3V3QA 4E4KA 2HWQA 2GL8A 4S0TA 4PXMA 2NXXA 4OFUA 1DB1A 5K13A 2H77A 4CI5A 4LTWA 5E0XA 5KRFA 1YP0A 4RMDA 3HC5A 1FM9D 4WLBA 3OSAA 2YJDA 3KFCA 5KCDA 5DXRA 5ETHA 3D57A 5DXQA 3SZ1A 1YOKA 1ZDTA 2J7YA 2VV1B 2ZMHA 3AZ3A 1GWRA 1E3KA 2AX6A 2Q7LA 3ADSA 4N5GA 3B0QA 5EITA 2GPOA 1XP6A 3NOAA 5KR9A 4ZOMA 5E14A 2AA6A 3W5RA 5DXGA 2ZMIA 2PIVA 4OLMA 4XTAA 5A86A 4RMEA 5DRJA 3N00A 5DVSA 3VI8A 3VTBA 4IV2A 4O8FA 3OMKA 3DZUD 1FM6A 3AN4A 4J5WA 2ZY0A 4WVDA 3V9VA 3S9SA 3W0AA 4OEZA 2OUZA 2VV3A 4UDDA 3VJIA 3KDUA 4N8RA 1FCYA 4A4VA 5I4VA 2ZK6A 4B7WA 2GPUA 2PJLA 2VSRA 5KCWA 3KMZA 4G2HA 4IA2A 3B0TA 3FEJA 1QKNA 5DKGA 1X76A 2Q61A 1T5ZA 4K7AA 1T65A 1NQ0A 4QL8A 3K6PA 3T03A 3W5PA 1Q4XA 2EWPA 2Q6JA 5KRLA 5C4UA 2P1VA 4F9MA 1S9QA 3ADTA 3NSQA 4TV1B 1FCZA 2PKLA 4OZTU 4P6XA 2HASA 1PRGA 2VSTA 2ZL9A 4NIEA 3MNOA 5SYZA 1LBDA 5KRAA 4XHDA 3ET1A 5DVCA 3L3XA 2R6WA 2PITA 1XAPA 2REWA 2NW4A 2ZFXA 2ZMJA 4G21A 1G1UA 5KCFA 4DMAA 1R5KA 2Q59B 3PCUA 1PQ9A 1QKMA 4RUJA 4XLDA 3HQ5A 1U9EA 2BJ4A 4NQAB 4M8HA 4KZJA 4DQMA 1T7MA 5DX3B 3TX7B 2HVCA 2Q59A 3IMYA 4RE8A 4UDCA 2Q7IA 3UP3A 1M2ZA 3CS8A 3P89A 4IVWA 5KCCA 1KKQA 5DX3A 3DT3A 1NUOA 4QJRA 2GP7A 2XKWA 4OJBA 4ZNHA 5KRCA 1ZEOA 2B1ZA 3KPZA 4BCRA 1GWXA 3VT8A 5HYRA 4ZNTA 4RZFA 2AX9A 3R5MA 3BC5A 4G2IA 4XT9A 5APKA 3WTQA 3AUQA 4OHAA 3B5RA 3UVVB 1YMTA 3B1MA 3TY0A 3R8DA 2QABA 2B1VA 5GIEA 3UVVA 4OGHA 4R2UA 5FQRA 5DUHA 5DV3A 2Q60A 3OMOA 5FQPA 3W5TA 2I4ZA 3GBKA 1RDTA 4R06A 3WJ5A 3B67A 1K7LA 1QKTA 4JYGA 5DUEA 4PVUA 3OMMA 4REFA 1NQ1A 4R6SA 1IE8A 4ITFA 4WHGA 3VT4A 5KRMA 4FNEA 1Y0SA 2QZOB 5AK2A 1K74A 1ILHA 4Q50A 3L0JA 3X36A 5C4TA 1T79A 3IXPA 2GTKA 3JZCA 1RKHA 1X7EA 3EYBA 3O1EA 2ZKCA 2QZOA 3OGTA 3PBAA 1T7TA 3KWYA 1TXIA 3MNEA 4ZNUA 4WPFA 4P6WA 5DYDA 5L11A 1FCXA 3ET0A 4N1YA 5DVVA 3VRVA 1XNXA 2VV4B 2YFEA 5JJMB 4X1FA 4IW6A 1PQCA 2VV2A 5KRKA 3V9YA 4OK1A 4JYIA 2VV4A 3PRGA 1XPCA 1YYEA 4J5XC 4OH5A 3OS8A 4OKBA 5KRJA 4E2JA 2ZBSA 4ZN9A 3KMRA 4ZI1A 1X78A 2ZLCA 3GWXA 4MGDB 1T7FA 1ZKYA 3L0LA 4FHIA 2J7XA 3IPQA 5L7GA 2O4RA 3AX8A 3A2HA 1S0XA 2YLOA 1T63A 2B23A 2Q1HA 3D24A 4MGDA 3F7DA 5DTVA 4G20A 4A2JA 4IUIA 4WQPA 2GWXA 3CQVA 5DKSA 1RK3A 3CS6A 4EMAA 1OSVA 5DU5A 5G45A 1YUCA 5E0WA 1SKXA 3D6DA 3WGPA 2ZLAA 1Y0XX 2G5OA 3X31A 3OLLA 1XIUA 4FGYA 2ACLA 2O9IA 3FEIA 4OZRE 4OKTA 5DWEA 3AFRA 5DZHA 3DR1A 2P4YA 2QXMA 2ZXNA 5KRHA 1I7IA 4MGAB 1PK5A 2HWRA 4IU7A 1T74A 3VT9A 5HZCA 3B0RA 3AZ2A 1MVCA 4MGAA 2O4JA 2XYWA 2Q5GA 4FN9A 5FQTA 1FM6D 3V3EA 3G0WA 3VTDA 1FD0A 2ATHA 3B65A 2VV1A 1SR7A 4E4QA 1HJ1A 1ZGYA 2ZNQA 1XQ3A 4IA1A 3W0HA 2IOKA 3W0IA 4M8EA 3HC6A 1DKFB 2ZASA 2P54A 4TUZB 4Y29A 5GT4A 1PCGA 2HFPA 1DKFA 4IS8A 5EHJA 3OZJA 4RAKA 4TUZA 3CJWA 3GD2A 3PO9A 3R29A 2NPAA 3A9EB 2OCFA 4IA3A 2POBA 2IHQA 2AMBA 2I4PA 2JFAB 2ZXMA 1S19A 2FVJA 2G0HA 2PIUA 4OEAA 4WHFA 5G5WA 2ZK3A 3DCTA 3VRWA 2QPYA 1T7RA 1U3QA 2OAXA 2JFAA 4ZO1X 5HYKA 3E94A 3K23A 4ZO1B 5FQVA 3DZYA 5DIDA 2QH6A 3OZ0A 3UUCA 1WM0X 2ZK1A 3OSIA 4S15A 3CDPA 4K4JA 5DYBA 3RVFA 1PDUA 2P7GA 4YNKA 4APUA 4J26A 3GZ9A 1SJ0A 2ZK0A 5GIDA 1XB7A 4QK4A 4TV1A 1S0ZA 1XNNA 2HC4A 3A3ZX 1KNUA 3OMPA 3P0UA 4N73A 5IAWA 3V49A 1U3SA 3FC6B 2Q6RA 5F9BA 1OVLB 5KCEA 5DWGA 2B50A 2P15A 3JZBA 3GN8A 2R6YA 2Z4JA 3FC6A 3W0JA 4PP5A 1OVLA 2XYXA 3GWSX 4OZTE 4MG9B 3B3KA 2QSEA 1XLSE 2R40A 4ZN7A 1RDTD 4MG9A 5DMFA 2Q5SA 4L96A 1K4WA 4J5WC 4QM0A 3FURA 3VHVA 5G42A 3QT0A 1UPVA 3OS9A 3W0GA 5G44A 3WFFA 4POJA 2QA6A 5DSHA 1K74D 2P7ZA 3AUNA 5L7EA 2Q8SA 4ZNVA 2IOGA 1NDEA 5DKEA 3IXPD 2YATA 5DLRA 5DK9A 5APJA 3E7CA 4G1ZA 3K8SA 2PIQA 5EI1A 3VHUA 4YPQA 4HEEX 2Q6SA 4A4WA 4OC7A 4PP6A 5AVLA 2OVMA 2HBHA 1R1KA 1ZDUA 2PINA 5DXBB 2P1UA 3ADWA 3P88A 4OARA 3CDSA 3P8XA 4J5XA 5AWJA 5DV6A 3WT5A 4YT1A 3BEJA 2QTUA 5IXKA 2F4BA 4PF3A 3B0WA 1M7WA 5DKBA 3ERTA 1L2IA 1E3GA 3G9EA 3WWRA 1G5YA 3VTCA 3VT5A 1R20A 1EREA 3OMQA 2HB7A 3OSWA 3VN2A 1LV2A 3E00A 4J24A 3W0CA 1XV9B 4RFWA 4PPPA 5DUGA 3VSOA 4RWVA 2GIUA 2ZXZA 5DV8A 1XV9A 2Q7KA 3ADXA 2OZ7A 1FBYA 4IWFA 4LNXA 3A78A 4DK8A 1BSXA 3K22A 5CJ6A 5JJMA 1G2NA 1XLSA 5DL4A 3VT7A 1ERRA 1GWQA 3R8AA 1Z5XU 3L3ZA 5APHA 1Y9RA 5AAUA 4YMQA 5AWKA 5HCVA 2PIOA 3VJTA 1XP9A 3L0EA 4POHA 4CI4A 2QW4A 3WT6A 2P7AA 2LBDA 3ADUA 5E7VA 3UU7B 1L2JA 1IE9A 4PPSA 5DY8A 4JAZA 3A2JA 5B41A 1YJEA 4REEA 4FHHA 3HZFA 4ONIA 3UU7A 4MG7B 3B68A 1YINA 3WMHA 4PWLA 1ZH7A 2HB8A 4ZJRA 4RMCA 3ZR7A 3IPUA 2P1TA 3RY9A 4L98A 1T73A 4MG7A 1MZNA 3W5QA 5E19A 1XZXX 1Z95A 2V7CA 3KDTA 1N4HA 2Z4BA 4K6IA 3VRUA 1NHZA 3FLIA 4KZIA 5KROA 2G0GA 3B66A 2G44A 1YOWA 2AM9A 3FALB 3OAPA 5E1CA 1T76A 2AA2A 3O1DA 3PEQA 5DZIA 4DM6A 4NY9A 4Q13A 5ICKA 2I4JA 5AVIA 2Q7JA 4ITEA 4JYHA 4DK7A 3ET3A 2Q3YA 3X1IA 1SQNA 4KZMA 3L1BA 1GS4A 3A2IA 4IV4A 3R2AA 3AZ1A 2YLYA 3H0AA 1PZLA 2H79A 4MGBB 3OS8C 3KBAA 5GICA 5C4SA 5L7HA 3VJSA 4MGBA 1VJBA 1XVPB 3WT7A 3UUAB 5JY3A 2AX7A 2HCDA 2POGA 4XI3A 3LMPA 2BAWA 4IA7A 3VHWA 3DZYD 2YLPA 1PQ6A 1XVPA 3UUAA 3WJ4A 4MDDA 2AYRA 1RJKA 3DCUA 5DZ1A 3VSPA 3VRTA 5DMCA 3VJHA 2AX8A 5G3JA 3BQDA 1YIMA 1ZAFA 1NRLA 3TKCA 5M96A 3ZRBA 4LBDA 3A9EA 4OKXA 3L03A 5KCUA 2I0GA 1XJ7A 1KV6A 5G43A 4IWCA 2Q70A 5ACCA 3AURA 5DRMA 1FM9A 3OOKA 1P93A 4LSJA 5DP0A 4RZGA 4OEYA 2YLQA 4Q0AC 4QE8A 4OILA 2OM9A 1A28A 2AAXA 1NAXA 1X7JA 2J14A 2R40D 1UOMA 2QR9A 5DXKA 4OH6A 1U3RA 2PIPL 2QGWA 3CLDA 5DWLA 2YHDA 1N46A 5DI7A 5DXMA 5EJVA 5KD9A 2HARA 2A3IA 2JJ3A 3LBDA 4OJ4A 3TKMA 4IW8A 5KRIA 1I37A 5DXEA 3OKHA 2FAIA 1QKUA 4QE6A 3A40X 4LNWA 2V0VA 1ILGA 3AN3A 4S0SA 5AZVA 3HO0A 4EM9A 3IA6A 3ZRAA 2PIWA 5FQSA 2QE4A 4ZNSA 1N83A 2NV7A 5KCTA 3PLZA 5H1EA 3VT3A 3G8IA 2PIXA 4OJ9A 5EGVA 4DM8A 3DZUA 5AZTA 3OOFA 1R1KD 2ZK4A 4MG5A 2ZNPA 4OIUA 2QNVA 3R8IA 3WFGA 4XUHA 5G46A 1NYXA 3X1HA 1I7GA 1XDKB 1R6GA 2J4AA 5HJSA 2GPVA 4ZNWA 5IZ0A 4RZEA 2BJ4B 3ADVA 5DXPA 1XDKA 1R20D 3FUGA 3M7RA 3SP6A 3E00D 4HLWA 3DY6A 1YA3A 3GYUA 4CSJA 1NQ7A 2AXAA 4PLEA 1H9UA 1EXAA 2QMVA 3SP9A 3Q95B 1HG4A 1TFCA 4UDBA 5EC9A 3FS1A 1NQ2A 4JGVA 4OIVA 1XOWA 1M13A 5DIEA 3Q95A 2E2RA 4RUOX 2AA5A 2XHSA 2GPPA 2W8YA 2ZK2A 5DIGA 3RUUA 4ZJWA 5KYJA 2ZK5A 5DXBA 1X7BA 1OT7A 4OFRA 4JL4A 2FSZA 2ZNNA 2Q5PA 2AMAA 4MG6A 3HVLA 5LGAA 2YJAB 1P8DA 2ABIA 2QA8B 3MNPA 3CS4A 1XQCA 1OSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNU A;  4OKW A;  2I0J A;  2OVH A;  2QA8 A;  3RLL A;  4IQR A;  1G50 A;  4MG8 B;  4XAO A;  5JI0 D;  4S14 A;  4XUM A;  4X1G A;  2AWH A;  2Q1V A;  1MV9 A;  4G1D A;  2NXX E;  4MG8 A;  3UUD B;  3ET2 A;  2QXS A;  2PRG A;  3FXV A;  1XP1 A;  3H52 A;  1UPW A;  3VT6 A;  5LWP A;  3OKI A;  3HLV A;  5AAV B;  1S9P A;  3UUD A;  3RUT A;  2VV0 A;  2AB2 A;  1I38 A;  5KYA A;  3HOD A;  5AAV A;  3G8O A;  4DOR A;  2HAM A;  3CWD A;  3OLS A;  5B5B A;  1Z5X E;  3F5C B;  3R5N A;  4RUP A;  4IVY A;  4NB6 A;  3V9T A;  5DZ0 A;  5AYG A;  3V4A A;  2ZNO A;  3F5C A;  3H0A D;  4PLD A;  1UHL B;  2JF9 A;  5E15 A;  4OED A;  4NUF A;  5HJP B;  4MGC A;  3CTB A;  3ERD A;  3UP0 A;  1NAV A;  3ZQT A;  1RKG A;  1UHL A;  3ILZ A;  3NSP A;  4OZR U;  5DWI A;  5HJP A;  2PIR A;  3FAL A;  3KYT A;  3U9Q A;  5C4O A;  4G1Y A;  1A52 A;  2AO6 A;  3RLJ A;  4UDA A;  3OLF A;  3KMG A;  4PP3 A;  5DWJ A;  5DZ3 A;  3W0Y A;  4DOS A;  1ZUC A;  2AA7 A;  1YY4 A;  1EXX A;  2QGT A;  4PRG A;  2XYJ A;  2ZVT A;  3D5F A;  1X7R A;  2ACL B;  3GYT A;  3HM1 A;  3D90 A;  3IPS A;  3V3Q A;  4E4K A;  2HWQ A;  2GL8 A;  4S0T A;  4PXM A;  2NXX A;  4OFU A;  1DB1 A;  5K13 A;  2H77 A;  4CI5 A;  4LTW A;  5E0X A;  5KRF A;  1YP0 A;  4RMD A;  3HC5 A;  1FM9 D;  4WLB A;  3OSA A;  2YJD A;  3KFC A;  5KCD A;  5DXR A;  5ETH A;  3D57 A;  5DXQ A;  3SZ1 A;  1YOK A;  1ZDT A;  2J7Y A;  2VV1 B;  2ZMH A;  3AZ3 A;  1GWR A;  1E3K A;  2AX6 A;  2Q7L A;  3ADS A;  4N5G A;  3B0Q A;  5EIT A;  2GPO A;  1XP6 A;  3NOA A;  5KR9 A;  4ZOM A;  5E14 A;  2AA6 A;  3W5R A;  5DXG A;  2ZMI A;  2PIV A;  4OLM A;  4XTA A;  5A86 A;  4RME A;  5DRJ A;  3N00 A;  5DVS A;  3VI8 A;  3VTB A;  4IV2 A;  4O8F A;  3OMK A;  3DZU D;  1FM6 A;  3AN4 A;  4J5W A;  2ZY0 A;  4WVD A;  3V9V A;  3S9S A;  3W0A A;  4OEZ A;  2OUZ A;  2VV3 A;  4UDD A;  3VJI A;  3KDU A;  4N8R A;  1FCY A;  4A4V A;  5I4V A;  2ZK6 A;  4B7W A;  2GPU A;  2PJL A;  2VSR A;  5KCW A;  3KMZ A;  4G2H A;  4IA2 A;  3B0T A;  3FEJ A;  1QKN A;  5DKG A;  1X76 A;  2Q61 A;  1T5Z A;  4K7A A;  1T65 A;  1NQ0 A;  4QL8 A;  3K6P A;  3T03 A;  3W5P A;  1Q4X A;  2EWP A;  2Q6J A;  5KRL A;  5C4U A;  2P1V A;  4F9M A;  1S9Q A;  3ADT A;  3NSQ A;  4TV1 B;  1FCZ A;  2PKL A;  4OZT U;  4P6X A;  2HAS A;  1PRG A;  2VST A;  2ZL9 A;  4NIE A;  3MNO A;  5SYZ A;  1LBD A;  5KRA A;  4XHD A;  3ET1 A;  5DVC A;  3L3X A;  2R6W A;  2PIT A;  1XAP A;  2REW A;  2NW4 A;  2ZFX A;  2ZMJ A;  4G21 A;  1G1U A;  5KCF A;  4DMA A;  1R5K A;  2Q59 B;  3PCU A;  1PQ9 A;  1QKM A;  4RUJ A;  4XLD A;  3HQ5 A;  1U9E A;  2BJ4 A;  4NQA B;  4M8H A;  4KZJ A;  4DQM A;  1T7M A;  5DX3 B;  3TX7 B;  2HVC A;  2Q59 A;  3IMY A;  4RE8 A;  4UDC A;  2Q7I A;  3UP3 A;  1M2Z A;  3CS8 A;  3P89 A;  4IVW A;  5KCC A;  1KKQ A;  5DX3 A;  3DT3 A;  1NUO A;  4QJR A;  2GP7 A;  2XKW A;  4OJB A;  4ZNH A;  5KRC A;  1ZEO A;  2B1Z A;  3KPZ A;  4BCR A;  1GWX A;  3VT8 A;  5HYR A;  4ZNT A;  4RZF A;  2AX9 A;  3R5M A;  3BC5 A;  4G2I A;  4XT9 A;  5APK A;  3WTQ A;  3AUQ A;  4OHA A;  3B5R A;  3UVV B;  1YMT A;  3B1M A;  3TY0 A;  3R8D A;  2QAB A;  2B1V A;  5GIE A;  3UVV A;  4OGH A;  4R2U A;  5FQR A;  5DUH A;  5DV3 A;  2Q60 A;  3OMO A;  5FQP A;  3W5T A;  2I4Z A;  3GBK A;  1RDT A;  4R06 A;  3WJ5 A;  3B67 A;  1K7L A;  1QKT A;  4JYG A;  5DUE A;  4PVU A;  3OMM A;  4REF A;  1NQ1 A;  4R6S A;  1IE8 A;  4ITF A;  4WHG A;  3VT4 A;  5KRM A;  4FNE A;  1Y0S A;  2QZO B;  5AK2 A;  1K74 A;  1ILH A;  4Q50 A;  3L0J A;  3X36 A;  5C4T A;  1T79 A;  3IXP A;  2GTK A;  3JZC A;  1RKH A;  1X7E A;  3EYB A;  3O1E A;  2ZKC A;  2QZO A;  3OGT A;  3PBA A;  1T7T A;  3KWY A;  1TXI A;  3MNE A;  4ZNU A;  4WPF A;  4P6W A;  5DYD A;  5L11 A;  1FCX A;  3ET0 A;  4N1Y A;  5DVV A;  3VRV A;  1XNX A;  2VV4 B;  2YFE A;  5JJM B;  4X1F A;  4IW6 A;  1PQC A;  2VV2 A;  5KRK A;  3V9Y A;  4OK1 A;  4JYI A;  2VV4 A;  3PRG A;  1XPC A;  1YYE A;  4J5X C;  4OH5 A;  3OS8 A;  4OKB A;  5KRJ A;  4E2J A;  2ZBS A;  4ZN9 A;  3KMR A;  4ZI1 A;  1X78 A;  2ZLC A;  3GWX A;  4MGD B;  1T7F A;  1ZKY A;  3L0L A;  4FHI A;  2J7X A;  3IPQ A;  5L7G A;  2O4R A;  3AX8 A;  3A2H A;  1S0X A;  2YLO A;  1T63 A;  2B23 A;  2Q1H A;  3D24 A;  4MGD A;  3F7D A;  5DTV A;  4G20 A;  4A2J A;  4IUI A;  4WQP A;  2GWX A;  3CQV A;  5DKS A;  1RK3 A;  3CS6 A;  4EMA A;  1OSV A;  5DU5 A;  5G45 A;  1YUC A;  5E0W A;  1SKX A;  3D6D A;  3WGP A;  2ZLA A;  1Y0X X;  2G5O A;  3X31 A;  3OLL A;  1XIU A;  4FGY A;  2ACL A;  2O9I A;  3FEI A;  4OZR E;  4OKT A;  5DWE A;  3AFR A;  5DZH A;  3DR1 A;  2P4Y A;  2QXM A;  2ZXN A;  5KRH A;  1I7I A;  4MGA B;  1PK5 A;  2HWR A;  4IU7 A;  1T74 A;  3VT9 A;  5HZC A;  3B0R A;  3AZ2 A;  1MVC A;  4MGA A;  2O4J A;  2XYW A;  2Q5G A;  4FN9 A;  5FQT A;  1FM6 D;  3V3E A;  3G0W A;  3VTD A;  1FD0 A;  2ATH A;  3B65 A;  2VV1 A;  1SR7 A;  4E4Q A;  1HJ1 A;  1ZGY A;  2ZNQ A;  1XQ3 A;  4IA1 A;  3W0H A;  2IOK A;  3W0I A;  4M8E A;  3HC6 A;  1DKF B;  2ZAS A;  2P54 A;  4TUZ B;  4Y29 A;  5GT4 A;  1PCG A;  2HFP A;  1DKF A;  4IS8 A;  5EHJ A;  3OZJ A;  4RAK A;  4TUZ A;  3CJW A;  3GD2 A;  3PO9 A;  3R29 A;  2NPA A;  3A9E B;  2OCF A;  4IA3 A;  2POB A;  2IHQ A;  2AMB A;  2I4P A;  2JFA B;  2ZXM A;  1S19 A;  2FVJ A;  2G0H A;  2PIU A;  4OEA A;  4WHF A;  5G5W A;  2ZK3 A;  3DCT A;  3VRW A;  2QPY A;  1T7R A;  1U3Q A;  2OAX A;  2JFA A;  4ZO1 X;  5HYK A;  3E94 A;  3K23 A;  4ZO1 B;  5FQV A;  3DZY A;  5DID A;  2QH6 A;  3OZ0 A;  3UUC A;  1WM0 X;  2ZK1 A;  3OSI A;  4S15 A;  3CDP A;  4K4J A;  5DYB A;  3RVF A;  1PDU A;  2P7G A;  4YNK A;  4APU A;  4J26 A;  3GZ9 A;  1SJ0 A;  2ZK0 A;  5GID A;  1XB7 A;  4QK4 A;  4TV1 A;  1S0Z A;  1XNN A;  2HC4 A;  3A3Z X;  1KNU A;  3OMP A;  3P0U A;  4N73 A;  5IAW A;  3V49 A;  1U3S A;  3FC6 B;  2Q6R A;  5F9B A;  1OVL B;  5KCE A;  5DWG A;  2B50 A;  2P15 A;  3JZB A;  3GN8 A;  2R6Y A;  2Z4J A;  3FC6 A;  3W0J A;  4PP5 A;  1OVL A;  2XYX A;  3GWS X;  4OZT E;  4MG9 B;  3B3K A;  2QSE A;  1XLS E;  2R40 A;  4ZN7 A;  1RDT D;  4MG9 A;  5DMF A;  2Q5S A;  4L96 A;  1K4W A;  4J5W C;  4QM0 A;  3FUR A;  3VHV A;  5G42 A;  3QT0 A;  1UPV A;  3OS9 A;  3W0G A;  5G44 A;  3WFF A;  4POJ A;  2QA6 A;  5DSH A;  1K74 D;  2P7Z A;  3AUN A;  5L7E A;  2Q8S A;  4ZNV A;  2IOG A;  1NDE A;  5DKE A;  3IXP D;  2YAT A;  5DLR A;  5DK9 A;  5APJ A;  3E7C A;  4G1Z A;  3K8S A;  2PIQ A;  5EI1 A;  3VHU A;  4YPQ A;  4HEE X;  2Q6S A;  4A4W A;  4OC7 A;  4PP6 A;  5AVL A;  2OVM A;  2HBH A;  1R1K A;  1ZDU A;  2PIN A;  5DXB B;  2P1U A;  3ADW A;  3P88 A;  4OAR A;  3CDS A;  3P8X A;  4J5X A;  5AWJ A;  5DV6 A;  3WT5 A;  4YT1 A;  3BEJ A;  2QTU A;  5IXK A;  2F4B A;  4PF3 A;  3B0W A;  1M7W A;  5DKB A;  3ERT A;  1L2I A;  1E3G A;  3G9E A;  3WWR A;  1G5Y A;  3VTC A;  3VT5 A;  1R20 A;  1ERE A;  3OMQ A;  2HB7 A;  3OSW A;  3VN2 A;  1LV2 A;  3E00 A;  4J24 A;  3W0C A;  1XV9 B;  4RFW A;  4PPP A;  5DUG A;  3VSO A;  4RWV A;  2GIU A;  2ZXZ A;  5DV8 A;  1XV9 A;  2Q7K A;  3ADX A;  2OZ7 A;  1FBY A;  4IWF A;  4LNX A;  3A78 A;  4DK8 A;  1BSX A;  3K22 A;  5CJ6 A;  5JJM A;  1G2N A;  1XLS A;  5DL4 A;  3VT7 A;  1ERR A;  1GWQ A;  3R8A A;  1Z5X U;  3L3Z A;  5APH A;  1Y9R A;  5AAU A;  4YMQ A;  5AWK A;  5HCV A;  2PIO A;  3VJT A;  1XP9 A;  3L0E A;  4POH A;  4CI4 A;  2QW4 A;  3WT6 A;  2P7A A;  2LBD A;  3ADU A;  5E7V A;  3UU7 B;  1L2J A;  1IE9 A;  4PPS A;  5DY8 A;  4JAZ A;  3A2J A;  5B41 A;  1YJE A;  4REE A;  4FHH A;  3HZF A;  4ONI A;  3UU7 A;  4MG7 B;  3B68 A;  1YIN A;  3WMH A;  4PWL A;  1ZH7 A;  2HB8 A;  4ZJR A;  4RMC A;  3ZR7 A;  3IPU A;  2P1T A;  3RY9 A;  4L98 A;  1T73 A;  4MG7 A;  1MZN A;  3W5Q A;  5E19 A;  1XZX X;  1Z95 A;  2V7C A;  3KDT A;  1N4H A;  2Z4B A;  4K6I A;  3VRU A;  1NHZ A;  3FLI A;  4KZI A;  5KRO A;  2G0G A;  3B66 A;  2G44 A;  1YOW A;  2AM9 A;  3FAL B;  3OAP A;  5E1C A;  1T76 A;  2AA2 A;  3O1D A;  3PEQ A;  5DZI A;  4DM6 A;  4NY9 A;  4Q13 A;  5ICK A;  2I4J A;  5AVI A;  2Q7J A;  4ITE A;  4JYH A;  4DK7 A;  3ET3 A;  2Q3Y A;  3X1I A;  1SQN A;  4KZM A;  3L1B A;  1GS4 A;  3A2I A;  4IV4 A;  3R2A A;  3AZ1 A;  2YLY A;  3H0A A;  1PZL A;  2H79 A;  4MGB B;  3OS8 C;  3KBA A;  5GIC A;  5C4S A;  5L7H A;  3VJS A;  4MGB A;  1VJB A;  1XVP B;  3WT7 A;  3UUA B;  5JY3 A;  2AX7 A;  2HCD A;  2POG A;  4XI3 A;  3LMP A;  2BAW A;  4IA7 A;  3VHW A;  3DZY D;  2YLP A;  1PQ6 A;  1XVP A;  3UUA A;  3WJ4 A;  4MDD A;  2AYR A;  1RJK A;  3DCU A;  5DZ1 A;  3VSP A;  3VRT A;  5DMC A;  3VJH A;  2AX8 A;  5G3J A;  3BQD A;  1YIM A;  1ZAF A;  1NRL A;  3TKC A;  5M96 A;  3ZRB A;  4LBD A;  3A9E A;  4OKX A;  3L03 A;  5KCU A;  2I0G A;  1XJ7 A;  1KV6 A;  5G43 A;  4IWC A;  2Q70 A;  5ACC A;  3AUR A;  5DRM A;  1FM9 A;  3OOK A;  1P93 A;  4LSJ A;  5DP0 A;  4RZG A;  4OEY A;  2YLQ A;  4Q0A C;  4QE8 A;  4OIL A;  2OM9 A;  1A28 A;  2AAX A;  1NAX A;  1X7J A;  2J14 A;  2R40 D;  1UOM A;  2QR9 A;  5DXK A;  4OH6 A;  1U3R A;  2PIP L;  2QGW A;  3CLD A;  5DWL A;  2YHD A;  1N46 A;  5DI7 A;  5DXM A;  5EJV A;  5KD9 A;  2HAR A;  2A3I A;  2JJ3 A;  3LBD A;  4OJ4 A;  3TKM A;  4IW8 A;  5KRI A;  1I37 A;  5DXE A;  3OKH A;  2FAI A;  1QKU A;  4QE6 A;  3A40 X;  4LNW A;  2V0V A;  1ILG A;  3AN3 A;  4S0S A;  5AZV A;  3HO0 A;  4EM9 A;  3IA6 A;  3ZRA A;  2PIW A;  5FQS A;  2QE4 A;  4ZNS A;  1N83 A;  2NV7 A;  5KCT A;  3PLZ A;  5H1E A;  3VT3 A;  3G8I A;  2PIX A;  4OJ9 A;  5EGV A;  4DM8 A;  3DZU A;  5AZT A;  3OOF A;  1R1K D;  2ZK4 A;  4MG5 A;  2ZNP A;  4OIU A;  2QNV A;  3R8I A;  3WFG A;  4XUH A;  5G46 A;  1NYX A;  3X1H A;  1I7G A;  1XDK B;  1R6G A;  2J4A A;  5HJS A;  2GPV A;  4ZNW A;  5IZ0 A;  4RZE A;  2BJ4 B;  3ADV A;  5DXP A;  1XDK A;  1R20 D;  3FUG A;  3M7R A;  3SP6 A;  3E00 D;  4HLW A;  3DY6 A;  1YA3 A;  3GYU A;  4CSJ A;  1NQ7 A;  2AXA A;  4PLE A;  1H9U A;  1EXA A;  2QMV A;  3SP9 A;  3Q95 B;  1HG4 A;  1TFC A;  4UDB A;  5EC9 A;  3FS1 A;  1NQ2 A;  4JGV A;  4OIV A;  1XOW A;  1M13 A;  5DIE A;  3Q95 A;  2E2R A;  4RUO X;  2AA5 A;  2XHS A;  2GPP A;  2W8Y A;  2ZK2 A;  5DIG A;  3RUU A;  4ZJW A;  5KYJ A;  2ZK5 A;  5DXB A;  1X7B A;  1OT7 A;  4OFR A;  4JL4 A;  2FSZ A;  2ZNN A;  2Q5P A;  2AMA A;  4MG6 A;  3HVL A;  5LGA A;  2YJA B;  1P8D A;  2ABI A;  2QA8 B;  3MNP A;  3CS4 A;  1XQC A;  1OSH A; 
#chains in the Genus database with same CATH topology
 2PNU A;  4OKW A;  2I0J A;  2OVH A;  2QA8 A;  3RLL A;  4IQR A;  1G50 A;  4MG8 B;  4XAO A;  5JI0 D;  4S14 A;  4XUM A;  4X1G A;  2AWH A;  2Q1V A;  1MV9 A;  4G1D A;  2NXX E;  4MG8 A;  3UUD B;  3ET2 A;  2QXS A;  2PRG A;  3FXV A;  1XP1 A;  3H52 A;  1UPW A;  3VT6 A;  5LWP A;  3OKI A;  3HLV A;  5AAV B;  1S9P A;  3UUD A;  3RUT A;  2VV0 A;  2AB2 A;  1I38 A;  5KYA A;  3HOD A;  5AAV A;  3G8O A;  4DOR A;  2HAM A;  3CWD A;  3OLS A;  5B5B A;  1Z5X E;  3F5C B;  3R5N A;  4RUP A;  4IVY A;  4NB6 A;  3V9T A;  5DZ0 A;  5AYG A;  3V4A A;  2ZNO A;  3F5C A;  3H0A D;  4PLD A;  1UHL B;  2JF9 A;  5E15 A;  4OED A;  4NUF A;  5HJP B;  4MGC A;  3CTB A;  3ERD A;  3UP0 A;  1NAV A;  3ZQT A;  1RKG A;  1UHL A;  3ILZ A;  3NSP A;  4OZR U;  5DWI A;  5HJP A;  2PIR A;  3FAL A;  3KYT A;  3U9Q A;  5C4O A;  4G1Y A;  1A52 A;  2AO6 A;  3RLJ A;  4UDA A;  3OLF A;  3KMG A;  4PP3 A;  5DWJ A;  5DZ3 A;  3W0Y A;  4DOS A;  1ZUC A;  2AA7 A;  1YY4 A;  1EXX A;  2QGT A;  4PRG A;  2XYJ A;  2ZVT A;  3D5F A;  1X7R A;  2ACL B;  3GYT A;  3HM1 A;  3D90 A;  3IPS A;  3V3Q A;  4E4K A;  2HWQ A;  2GL8 A;  4S0T A;  4PXM A;  2NXX A;  4OFU A;  1DB1 A;  5K13 A;  2H77 A;  4CI5 A;  4LTW A;  5E0X A;  5KRF A;  1YP0 A;  4RMD A;  3HC5 A;  1FM9 D;  4WLB A;  3OSA A;  2YJD A;  3KFC A;  5KCD A;  5DXR A;  5ETH A;  3D57 A;  5DXQ A;  3SZ1 A;  1YOK A;  1ZDT A;  2J7Y A;  2VV1 B;  2ZMH A;  3AZ3 A;  1GWR A;  1E3K A;  2AX6 A;  2Q7L A;  3ADS A;  4N5G A;  3B0Q A;  5EIT A;  2GPO A;  1XP6 A;  3NOA A;  5KR9 A;  4ZOM A;  5E14 A;  2AA6 A;  3W5R A;  5DXG A;  2ZMI A;  2PIV A;  4OLM A;  4XTA A;  5A86 A;  4RME A;  5DRJ A;  3N00 A;  5DVS A;  3VI8 A;  3VTB A;  4IV2 A;  4O8F A;  3OMK A;  3DZU D;  1FM6 A;  3AN4 A;  4J5W A;  2ZY0 A;  4WVD A;  3V9V A;  3S9S A;  3W0A A;  4OEZ A;  2OUZ A;  2VV3 A;  4UDD A;  3VJI A;  3KDU A;  4N8R A;  1FCY A;  4A4V A;  5I4V A;  2ZK6 A;  4B7W A;  2GPU A;  2PJL A;  2VSR A;  5KCW A;  3KMZ A;  4G2H A;  4IA2 A;  3B0T A;  3FEJ A;  1QKN A;  5DKG A;  1X76 A;  2Q61 A;  1T5Z A;  4K7A A;  1T65 A;  1NQ0 A;  4QL8 A;  3K6P A;  3T03 A;  3W5P A;  1Q4X A;  2EWP A;  2Q6J A;  5KRL A;  5C4U A;  2P1V A;  4F9M A;  1S9Q A;  3ADT A;  3NSQ A;  4TV1 B;  1FCZ A;  2PKL A;  4OZT U;  4P6X A;  2HAS A;  1PRG A;  2VST A;  2ZL9 A;  4NIE A;  3MNO A;  5SYZ A;  1LBD A;  5KRA A;  4XHD A;  3ET1 A;  5DVC A;  3L3X A;  2R6W A;  2PIT A;  1XAP A;  2REW A;  2NW4 A;  2ZFX A;  2ZMJ A;  4G21 A;  1G1U A;  5KCF A;  4DMA A;  1R5K A;  2Q59 B;  3PCU A;  1PQ9 A;  1QKM A;  4RUJ A;  4XLD A;  3HQ5 A;  1U9E A;  2BJ4 A;  4NQA B;  4M8H A;  4KZJ A;  4DQM A;  1T7M A;  5DX3 B;  3TX7 B;  2HVC A;  2Q59 A;  3IMY A;  4RE8 A;  4UDC A;  2Q7I A;  3UP3 A;  1M2Z A;  3CS8 A;  3P89 A;  4IVW A;  5KCC A;  1KKQ A;  5DX3 A;  3DT3 A;  1NUO A;  4QJR A;  2GP7 A;  2XKW A;  4OJB A;  4ZNH A;  5KRC A;  1ZEO A;  2B1Z A;  3KPZ A;  4BCR A;  1GWX A;  3VT8 A;  5HYR A;  4ZNT A;  4RZF A;  2AX9 A;  3R5M A;  3BC5 A;  4G2I A;  4XT9 A;  5APK A;  3WTQ A;  3AUQ A;  4OHA A;  3B5R A;  3UVV B;  1YMT A;  3B1M A;  3TY0 A;  3R8D A;  2QAB A;  2B1V A;  5GIE A;  3UVV A;  4OGH A;  4R2U A;  5FQR A;  5DUH A;  5DV3 A;  2Q60 A;  3OMO A;  5FQP A;  3W5T A;  2I4Z A;  3GBK A;  1RDT A;  4R06 A;  3WJ5 A;  3B67 A;  1K7L A;  1QKT A;  4JYG A;  5DUE A;  4PVU A;  3OMM A;  4REF A;  1NQ1 A;  4R6S A;  1IE8 A;  4ITF A;  4WHG A;  3VT4 A;  5KRM A;  4FNE A;  1Y0S A;  2QZO B;  5AK2 A;  1K74 A;  1ILH A;  4Q50 A;  3L0J A;  3X36 A;  5C4T A;  1T79 A;  3IXP A;  2GTK A;  3JZC A;  1RKH A;  1X7E A;  3EYB A;  3O1E A;  2ZKC A;  2QZO A;  3OGT A;  3PBA A;  1T7T A;  3KWY A;  1TXI A;  3MNE A;  4ZNU A;  4WPF A;  4P6W A;  5DYD A;  5L11 A;  1FCX A;  3ET0 A;  4N1Y A;  5DVV A;  3VRV A;  1XNX A;  2VV4 B;  2YFE A;  5JJM B;  4X1F A;  4IW6 A;  1PQC A;  2VV2 A;  5KRK A;  3V9Y A;  4OK1 A;  4JYI A;  2VV4 A;  3PRG A;  1XPC A;  1YYE A;  4J5X C;  4OH5 A;  3OS8 A;  4OKB A;  5KRJ A;  4E2J A;  2ZBS A;  4ZN9 A;  3KMR A;  4ZI1 A;  1X78 A;  2ZLC A;  3GWX A;  4MGD B;  1T7F A;  1ZKY A;  3L0L A;  4FHI A;  2J7X A;  3IPQ A;  5L7G A;  2O4R A;  3AX8 A;  3A2H A;  1S0X A;  2YLO A;  1T63 A;  2B23 A;  2Q1H A;  3D24 A;  4MGD A;  3F7D A;  5DTV A;  4G20 A;  4A2J A;  4IUI A;  4WQP A;  2GWX A;  3CQV A;  5DKS A;  1RK3 A;  3CS6 A;  4EMA A;  1OSV A;  5DU5 A;  5G45 A;  1YUC A;  5E0W A;  1SKX A;  3D6D A;  3WGP A;  2ZLA A;  1Y0X X;  2G5O A;  3X31 A;  3OLL A;  1XIU A;  4FGY A;  2ACL A;  2O9I A;  3FEI A;  4OZR E;  4OKT A;  5DWE A;  3AFR A;  5DZH A;  3DR1 A;  2P4Y A;  2QXM A;  2ZXN A;  5KRH A;  1I7I A;  4MGA B;  1PK5 A;  2HWR A;  4IU7 A;  1T74 A;  3VT9 A;  5HZC A;  3B0R A;  3AZ2 A;  1MVC A;  4MGA A;  2O4J A;  2XYW A;  2Q5G A;  4FN9 A;  5FQT A;  1FM6 D;  3V3E A;  3G0W A;  3VTD A;  1FD0 A;  2ATH A;  3B65 A;  2VV1 A;  1SR7 A;  4E4Q A;  1HJ1 A;  1ZGY A;  2ZNQ A;  1XQ3 A;  4IA1 A;  3W0H A;  2IOK A;  3W0I A;  4M8E A;  3HC6 A;  1DKF B;  2ZAS A;  2P54 A;  4TUZ B;  4Y29 A;  5GT4 A;  1PCG A;  2HFP A;  1DKF A;  4IS8 A;  5EHJ A;  3OZJ A;  4RAK A;  4TUZ A;  3CJW A;  3GD2 A;  3PO9 A;  3R29 A;  2NPA A;  3A9E B;  2OCF A;  4IA3 A;  2POB A;  2IHQ A;  2AMB A;  2I4P A;  2JFA B;  2ZXM A;  1S19 A;  2FVJ A;  2G0H A;  2PIU A;  4OEA A;  4WHF A;  5G5W A;  2ZK3 A;  3DCT A;  3VRW A;  2QPY A;  1T7R A;  1U3Q A;  2OAX A;  2JFA A;  4ZO1 X;  5HYK A;  3E94 A;  3K23 A;  4ZO1 B;  5FQV A;  3DZY A;  5DID A;  2QH6 A;  3OZ0 A;  3UUC A;  1WM0 X;  2ZK1 A;  3OSI A;  4S15 A;  3CDP A;  4K4J A;  5DYB A;  3RVF A;  1PDU A;  2P7G A;  4YNK A;  4APU A;  4J26 A;  3GZ9 A;  1SJ0 A;  2ZK0 A;  5GID A;  1XB7 A;  4QK4 A;  4TV1 A;  1S0Z A;  1XNN A;  2HC4 A;  3A3Z X;  1KNU A;  3OMP A;  3P0U A;  4N73 A;  5IAW A;  3V49 A;  1U3S A;  3FC6 B;  2Q6R A;  5F9B A;  1OVL B;  5KCE A;  5DWG A;  2B50 A;  2P15 A;  3JZB A;  3GN8 A;  2R6Y A;  2Z4J A;  3FC6 A;  3W0J A;  4PP5 A;  1OVL A;  2XYX A;  3GWS X;  4OZT E;  4MG9 B;  3B3K A;  2QSE A;  1XLS E;  2R40 A;  4ZN7 A;  1RDT D;  4MG9 A;  5DMF A;  2Q5S A;  4L96 A;  1K4W A;  4J5W C;  4QM0 A;  3FUR A;  3VHV A;  5G42 A;  3QT0 A;  1UPV A;  3OS9 A;  3W0G A;  5G44 A;  3WFF A;  4POJ A;  2QA6 A;  5DSH A;  1K74 D;  2P7Z A;  3AUN A;  5L7E A;  2Q8S A;  4ZNV A;  2IOG A;  1NDE A;  5DKE A;  3IXP D;  2YAT A;  5DLR A;  5DK9 A;  5APJ A;  3E7C A;  4G1Z A;  3K8S A;  2PIQ A;  5EI1 A;  3VHU A;  4YPQ A;  4HEE X;  2Q6S A;  4A4W A;  4OC7 A;  4PP6 A;  5AVL A;  2OVM A;  2HBH A;  1R1K A;  1ZDU A;  2PIN A;  5DXB B;  2P1U A;  3ADW A;  3P88 A;  4OAR A;  3CDS A;  3P8X A;  4J5X A;  5AWJ A;  5DV6 A;  3WT5 A;  4YT1 A;  3BEJ A;  2QTU A;  5IXK A;  2F4B A;  4PF3 A;  3B0W A;  1M7W A;  5DKB A;  3ERT A;  1L2I A;  1E3G A;  3G9E A;  3WWR A;  1G5Y A;  3VTC A;  3VT5 A;  1R20 A;  1ERE A;  3OMQ A;  2HB7 A;  3OSW A;  3VN2 A;  1LV2 A;  3E00 A;  4J24 A;  3W0C A;  1XV9 B;  4RFW A;  4PPP A;  5DUG A;  3VSO A;  4RWV A;  2GIU A;  2ZXZ A;  5DV8 A;  1XV9 A;  2Q7K A;  3ADX A;  2OZ7 A;  1FBY A;  4IWF A;  4LNX A;  3A78 A;  4DK8 A;  1BSX A;  3K22 A;  5CJ6 A;  5JJM A;  1G2N A;  1XLS A;  5DL4 A;  3VT7 A;  1ERR A;  1GWQ A;  3R8A A;  1Z5X U;  3L3Z A;  5APH A;  1Y9R A;  5AAU A;  4YMQ A;  5AWK A;  5HCV A;  2PIO A;  3VJT A;  1XP9 A;  3L0E A;  4POH A;  4CI4 A;  2QW4 A;  3WT6 A;  2P7A A;  2LBD A;  3ADU A;  5E7V A;  3UU7 B;  1L2J A;  1IE9 A;  4PPS A;  5DY8 A;  4JAZ A;  3A2J A;  5B41 A;  1YJE A;  4REE A;  4FHH A;  3HZF A;  4ONI A;  3UU7 A;  4MG7 B;  3B68 A;  1YIN A;  3WMH A;  4PWL A;  1ZH7 A;  2HB8 A;  4ZJR A;  4RMC A;  3ZR7 A;  3IPU A;  2P1T A;  3RY9 A;  4L98 A;  1T73 A;  4MG7 A;  1MZN A;  3W5Q A;  5E19 A;  1XZX X;  1Z95 A;  2V7C A;  3KDT A;  1N4H A;  2Z4B A;  4K6I A;  3VRU A;  1NHZ A;  3FLI A;  4KZI A;  5KRO A;  2G0G A;  3B66 A;  2G44 A;  1YOW A;  2AM9 A;  3FAL B;  3OAP A;  5E1C A;  1T76 A;  2AA2 A;  3O1D A;  3PEQ A;  5DZI A;  4DM6 A;  4NY9 A;  4Q13 A;  5ICK A;  2I4J A;  5AVI A;  2Q7J A;  4ITE A;  4JYH A;  4DK7 A;  3ET3 A;  2Q3Y A;  3X1I A;  1SQN A;  4KZM A;  3L1B A;  1GS4 A;  3A2I A;  4IV4 A;  3R2A A;  3AZ1 A;  2YLY A;  3H0A A;  1PZL A;  2H79 A;  4MGB B;  3OS8 C;  3KBA A;  5GIC A;  5C4S A;  5L7H A;  3VJS A;  4MGB A;  1VJB A;  1XVP B;  3WT7 A;  3UUA B;  5JY3 A;  2AX7 A;  2HCD A;  2POG A;  4XI3 A;  3LMP A;  2BAW A;  4IA7 A;  3VHW A;  3DZY D;  2YLP A;  1PQ6 A;  1XVP A;  3UUA A;  3WJ4 A;  4MDD A;  2AYR A;  1RJK A;  3DCU A;  5DZ1 A;  3VSP A;  3VRT A;  5DMC A;  3VJH A;  2AX8 A;  5G3J A;  3BQD A;  1YIM A;  1ZAF A;  1NRL A;  3TKC A;  5M96 A;  3ZRB A;  4LBD A;  3A9E A;  4OKX A;  3L03 A;  5KCU A;  2I0G A;  1XJ7 A;  1KV6 A;  5G43 A;  4IWC A;  2Q70 A;  5ACC A;  3AUR A;  5DRM A;  1FM9 A;  3OOK A;  1P93 A;  4LSJ A;  5DP0 A;  4RZG A;  4OEY A;  2YLQ A;  4Q0A C;  4QE8 A;  4OIL A;  2OM9 A;  1A28 A;  2AAX A;  1NAX A;  1X7J A;  2J14 A;  2R40 D;  1UOM A;  2QR9 A;  5DXK A;  4OH6 A;  1U3R A;  2PIP L;  2QGW A;  3CLD A;  5DWL A;  2YHD A;  1N46 A;  5DI7 A;  5DXM A;  5EJV A;  5KD9 A;  2HAR A;  2A3I A;  2JJ3 A;  3LBD A;  4OJ4 A;  3TKM A;  4IW8 A;  5KRI A;  1I37 A;  5DXE A;  3OKH A;  2FAI A;  1QKU A;  4QE6 A;  3A40 X;  4LNW A;  2V0V A;  1ILG A;  3AN3 A;  4S0S A;  5AZV A;  3HO0 A;  4EM9 A;  3IA6 A;  3ZRA A;  2PIW A;  5FQS A;  2QE4 A;  4ZNS A;  1N83 A;  2NV7 A;  5KCT A;  3PLZ A;  5H1E A;  3VT3 A;  3G8I A;  2PIX A;  4OJ9 A;  5EGV A;  4DM8 A;  3DZU A;  5AZT A;  3OOF A;  1R1K D;  2ZK4 A;  4MG5 A;  2ZNP A;  4OIU A;  2QNV A;  3R8I A;  3WFG A;  4XUH A;  5G46 A;  1NYX A;  3X1H A;  1I7G A;  1XDK B;  1R6G A;  2J4A A;  5HJS A;  2GPV A;  4ZNW A;  5IZ0 A;  4RZE A;  2BJ4 B;  3ADV A;  5DXP A;  1XDK A;  1R20 D;  3FUG A;  3M7R A;  3SP6 A;  3E00 D;  4HLW A;  3DY6 A;  1YA3 A;  3GYU A;  4CSJ A;  1NQ7 A;  2AXA A;  4PLE A;  1H9U A;  1EXA A;  2QMV A;  3SP9 A;  3Q95 B;  1HG4 A;  1TFC A;  4UDB A;  5EC9 A;  3FS1 A;  1NQ2 A;  4JGV A;  4OIV A;  1XOW A;  1M13 A;  5DIE A;  3Q95 A;  2E2R A;  4RUO X;  2AA5 A;  2XHS A;  2GPP A;  2W8Y A;  2ZK2 A;  5DIG A;  3RUU A;  4ZJW A;  5KYJ A;  2ZK5 A;  5DXB A;  1X7B A;  1OT7 A;  4OFR A;  4JL4 A;  2FSZ A;  2ZNN A;  2Q5P A;  2AMA A;  4MG6 A;  3HVL A;  5LGA A;  2YJA B;  1P8D A;  2ABI A;  2QA8 B;  3MNP A;  3CS4 A;  1XQC A;  1OSH A; 
#chains in the Genus database with same CATH homology
 2PNU A;  4OKW A;  2I0J A;  2OVH A;  2QA8 A;  3RLL A;  4IQR A;  1G50 A;  4MG8 B;  4XAO A;  5JI0 D;  4S14 A;  4XUM A;  4X1G A;  2AWH A;  2Q1V A;  1MV9 A;  4G1D A;  2NXX E;  4MG8 A;  3UUD B;  3ET2 A;  2QXS A;  2PRG A;  3FXV A;  1XP1 A;  3H52 A;  1UPW A;  3VT6 A;  5LWP A;  3OKI A;  3HLV A;  5AAV B;  1S9P A;  3UUD A;  3RUT A;  2VV0 A;  2AB2 A;  1I38 A;  5KYA A;  3HOD A;  5AAV A;  3G8O A;  4DOR A;  2HAM A;  3CWD A;  3OLS A;  5B5B A;  1Z5X E;  3F5C B;  3R5N A;  4RUP A;  4IVY A;  4NB6 A;  3V9T A;  5DZ0 A;  5AYG A;  3V4A A;  2ZNO A;  3F5C A;  3H0A D;  4PLD A;  1UHL B;  2JF9 A;  5E15 A;  4OED A;  4NUF A;  5HJP B;  4MGC A;  3CTB A;  3ERD A;  3UP0 A;  1NAV A;  3ZQT A;  1RKG A;  1UHL A;  3ILZ A;  3NSP A;  4OZR U;  5DWI A;  5HJP A;  2PIR A;  3FAL A;  3KYT A;  3U9Q A;  5C4O A;  4G1Y A;  1A52 A;  2AO6 A;  3RLJ A;  4UDA A;  3OLF A;  3KMG A;  4PP3 A;  5DWJ A;  5DZ3 A;  3W0Y A;  4DOS A;  1ZUC A;  2AA7 A;  1YY4 A;  1EXX A;  2QGT A;  4PRG A;  2XYJ A;  2ZVT A;  3D5F A;  1X7R A;  2ACL B;  3GYT A;  3HM1 A;  3D90 A;  3IPS A;  3V3Q A;  4E4K A;  2HWQ A;  2GL8 A;  4S0T A;  4PXM A;  2NXX A;  4OFU A;  1DB1 A;  5K13 A;  2H77 A;  4CI5 A;  4LTW A;  5E0X A;  5KRF A;  1YP0 A;  4RMD A;  3HC5 A;  1FM9 D;  4WLB A;  3OSA A;  2YJD A;  3KFC A;  5KCD A;  5DXR A;  5ETH A;  3D57 A;  5DXQ A;  3SZ1 A;  1YOK A;  1ZDT A;  2J7Y A;  2VV1 B;  2ZMH A;  3AZ3 A;  1GWR A;  1E3K A;  2AX6 A;  2Q7L A;  3ADS A;  4N5G A;  3B0Q A;  5EIT A;  2GPO A;  1XP6 A;  3NOA A;  5KR9 A;  4ZOM A;  5E14 A;  2AA6 A;  3W5R A;  5DXG A;  2ZMI A;  2PIV A;  4OLM A;  4XTA A;  5A86 A;  4RME A;  5DRJ A;  3N00 A;  5DVS A;  3VI8 A;  3VTB A;  4IV2 A;  4O8F A;  3OMK A;  3DZU D;  1FM6 A;  3AN4 A;  4J5W A;  2ZY0 A;  4WVD A;  3V9V A;  3S9S A;  3W0A A;  4OEZ A;  2OUZ A;  2VV3 A;  4UDD A;  3VJI A;  3KDU A;  4N8R A;  1FCY A;  4A4V A;  5I4V A;  2ZK6 A;  4B7W A;  2GPU A;  2PJL A;  2VSR A;  5KCW A;  3KMZ A;  4G2H A;  4IA2 A;  3B0T A;  3FEJ A;  1QKN A;  5DKG A;  1X76 A;  2Q61 A;  1T5Z A;  4K7A A;  1T65 A;  1NQ0 A;  4QL8 A;  3K6P A;  3T03 A;  3W5P A;  1Q4X A;  2EWP A;  2Q6J A;  5KRL A;  5C4U A;  2P1V A;  4F9M A;  1S9Q A;  3ADT A;  3NSQ A;  4TV1 B;  1FCZ A;  2PKL A;  4OZT U;  4P6X A;  2HAS A;  1PRG A;  2VST A;  2ZL9 A;  4NIE A;  3MNO A;  5SYZ A;  1LBD A;  5KRA A;  4XHD A;  3ET1 A;  5DVC A;  3L3X A;  2R6W A;  2PIT A;  1XAP A;  2REW A;  2NW4 A;  2ZFX A;  2ZMJ A;  4G21 A;  1G1U A;  5KCF A;  4DMA A;  1R5K A;  2Q59 B;  3PCU A;  1PQ9 A;  1QKM A;  4RUJ A;  4XLD A;  3HQ5 A;  1U9E A;  2BJ4 A;  4NQA B;  4M8H A;  4KZJ A;  4DQM A;  1T7M A;  5DX3 B;  3TX7 B;  2HVC A;  2Q59 A;  3IMY A;  4RE8 A;  4UDC A;  2Q7I A;  3UP3 A;  1M2Z A;  3CS8 A;  3P89 A;  4IVW A;  5KCC A;  1KKQ A;  5DX3 A;  3DT3 A;  1NUO A;  4QJR A;  2GP7 A;  2XKW A;  4OJB A;  4ZNH A;  5KRC A;  1ZEO A;  2B1Z A;  3KPZ A;  4BCR A;  1GWX A;  3VT8 A;  5HYR A;  4ZNT A;  4RZF A;  2AX9 A;  3R5M A;  3BC5 A;  4G2I A;  4XT9 A;  5APK A;  3WTQ A;  3AUQ A;  4OHA A;  3B5R A;  3UVV B;  1YMT A;  3B1M A;  3TY0 A;  3R8D A;  2QAB A;  2B1V A;  5GIE A;  3UVV A;  4OGH A;  4R2U A;  5FQR A;  5DUH A;  5DV3 A;  2Q60 A;  3OMO A;  5FQP A;  3W5T A;  2I4Z A;  3GBK A;  1RDT A;  4R06 A;  3WJ5 A;  3B67 A;  1K7L A;  1QKT A;  4JYG A;  5DUE A;  4PVU A;  3OMM A;  4REF A;  1NQ1 A;  4R6S A;  1IE8 A;  4ITF A;  4WHG A;  3VT4 A;  5KRM A;  4FNE A;  1Y0S A;  2QZO B;  5AK2 A;  1K74 A;  1ILH A;  4Q50 A;  3L0J A;  3X36 A;  5C4T A;  1T79 A;  3IXP A;  2GTK A;  3JZC A;  1RKH A;  1X7E A;  3EYB A;  3O1E A;  2ZKC A;  2QZO A;  3OGT A;  3PBA A;  1T7T A;  3KWY A;  1TXI A;  3MNE A;  4ZNU A;  4WPF A;  4P6W A;  5DYD A;  5L11 A;  1FCX A;  3ET0 A;  4N1Y A;  5DVV A;  3VRV A;  1XNX A;  2VV4 B;  2YFE A;  5JJM B;  4X1F A;  4IW6 A;  1PQC A;  2VV2 A;  5KRK A;  3V9Y A;  4OK1 A;  4JYI A;  2VV4 A;  3PRG A;  1XPC A;  1YYE A;  4J5X C;  4OH5 A;  3OS8 A;  4OKB A;  5KRJ A;  4E2J A;  2ZBS A;  4ZN9 A;  3KMR A;  4ZI1 A;  1X78 A;  2ZLC A;  3GWX A;  4MGD B;  1T7F A;  1ZKY A;  3L0L A;  4FHI A;  2J7X A;  3IPQ A;  5L7G A;  2O4R A;  3AX8 A;  3A2H A;  1S0X A;  2YLO A;  1T63 A;  2B23 A;  2Q1H A;  3D24 A;  4MGD A;  3F7D A;  5DTV A;  4G20 A;  4A2J A;  4IUI A;  4WQP A;  2GWX A;  3CQV A;  5DKS A;  1RK3 A;  3CS6 A;  4EMA A;  1OSV A;  5DU5 A;  5G45 A;  1YUC A;  5E0W A;  1SKX A;  3D6D A;  3WGP A;  2ZLA A;  1Y0X X;  2G5O A;  3X31 A;  3OLL A;  1XIU A;  4FGY A;  2ACL A;  2O9I A;  3FEI A;  4OZR E;  4OKT A;  5DWE A;  3AFR A;  5DZH A;  3DR1 A;  2P4Y A;  2QXM A;  2ZXN A;  5KRH A;  1I7I A;  4MGA B;  1PK5 A;  2HWR A;  4IU7 A;  1T74 A;  3VT9 A;  5HZC A;  3B0R A;  3AZ2 A;  1MVC A;  4MGA A;  2O4J A;  2XYW A;  2Q5G A;  4FN9 A;  5FQT A;  1FM6 D;  3V3E A;  3G0W A;  3VTD A;  1FD0 A;  2ATH A;  3B65 A;  2VV1 A;  1SR7 A;  4E4Q A;  1HJ1 A;  1ZGY A;  2ZNQ A;  1XQ3 A;  4IA1 A;  3W0H A;  2IOK A;  3W0I A;  4M8E A;  3HC6 A;  1DKF B;  2ZAS A;  2P54 A;  4TUZ B;  4Y29 A;  5GT4 A;  1PCG A;  2HFP A;  1DKF A;  4IS8 A;  5EHJ A;  3OZJ A;  4RAK A;  4TUZ A;  3CJW A;  3GD2 A;  3PO9 A;  3R29 A;  2NPA A;  3A9E B;  2OCF A;  4IA3 A;  2POB A;  2IHQ A;  2AMB A;  2I4P A;  2JFA B;  2ZXM A;  1S19 A;  2FVJ A;  2G0H A;  2PIU A;  4OEA A;  4WHF A;  5G5W A;  2ZK3 A;  3DCT A;  3VRW A;  2QPY A;  1T7R A;  1U3Q A;  2OAX A;  2JFA A;  4ZO1 X;  5HYK A;  3E94 A;  3K23 A;  4ZO1 B;  5FQV A;  3DZY A;  5DID A;  2QH6 A;  3OZ0 A;  3UUC A;  1WM0 X;  2ZK1 A;  3OSI A;  4S15 A;  3CDP A;  4K4J A;  5DYB A;  3RVF A;  1PDU A;  2P7G A;  4YNK A;  4APU A;  4J26 A;  3GZ9 A;  1SJ0 A;  2ZK0 A;  5GID A;  1XB7 A;  4QK4 A;  4TV1 A;  1S0Z A;  1XNN A;  2HC4 A;  3A3Z X;  1KNU A;  3OMP A;  3P0U A;  4N73 A;  5IAW A;  3V49 A;  1U3S A;  3FC6 B;  2Q6R A;  5F9B A;  1OVL B;  5KCE A;  5DWG A;  2B50 A;  2P15 A;  3JZB A;  3GN8 A;  2R6Y A;  2Z4J A;  3FC6 A;  3W0J A;  4PP5 A;  1OVL A;  2XYX A;  3GWS X;  4OZT E;  4MG9 B;  3B3K A;  2QSE A;  1XLS E;  2R40 A;  4ZN7 A;  1RDT D;  4MG9 A;  5DMF A;  2Q5S A;  4L96 A;  1K4W A;  4J5W C;  4QM0 A;  3FUR A;  3VHV A;  5G42 A;  3QT0 A;  1UPV A;  3OS9 A;  3W0G A;  5G44 A;  3WFF A;  4POJ A;  2QA6 A;  5DSH A;  1K74 D;  2P7Z A;  3AUN A;  5L7E A;  2Q8S A;  4ZNV A;  2IOG A;  1NDE A;  5DKE A;  3IXP D;  2YAT A;  5DLR A;  5DK9 A;  5APJ A;  3E7C A;  4G1Z A;  3K8S A;  2PIQ A;  5EI1 A;  3VHU A;  4YPQ A;  4HEE X;  2Q6S A;  4A4W A;  4OC7 A;  4PP6 A;  5AVL A;  2OVM A;  2HBH A;  1R1K A;  1ZDU A;  2PIN A;  5DXB B;  2P1U A;  3ADW A;  3P88 A;  4OAR A;  3CDS A;  3P8X A;  4J5X A;  5AWJ A;  5DV6 A;  3WT5 A;  4YT1 A;  3BEJ A;  2QTU A;  5IXK A;  2F4B A;  4PF3 A;  3B0W A;  1M7W A;  5DKB A;  3ERT A;  1L2I A;  1E3G A;  3G9E A;  3WWR A;  1G5Y A;  3VTC A;  3VT5 A;  1R20 A;  1ERE A;  3OMQ A;  2HB7 A;  3OSW A;  3VN2 A;  1LV2 A;  3E00 A;  4J24 A;  3W0C A;  1XV9 B;  4RFW A;  4PPP A;  5DUG A;  3VSO A;  4RWV A;  2GIU A;  2ZXZ A;  5DV8 A;  1XV9 A;  2Q7K A;  3ADX A;  2OZ7 A;  1FBY A;  4IWF A;  4LNX A;  3A78 A;  4DK8 A;  1BSX A;  3K22 A;  5CJ6 A;  5JJM A;  1G2N A;  1XLS A;  5DL4 A;  3VT7 A;  1ERR A;  1GWQ A;  3R8A A;  1Z5X U;  3L3Z A;  5APH A;  1Y9R A;  5AAU A;  4YMQ A;  5AWK A;  5HCV A;  2PIO A;  3VJT A;  1XP9 A;  3L0E A;  4POH A;  4CI4 A;  2QW4 A;  3WT6 A;  2P7A A;  2LBD A;  3ADU A;  5E7V A;  3UU7 B;  1L2J A;  1IE9 A;  4PPS A;  5DY8 A;  4JAZ A;  3A2J A;  5B41 A;  1YJE A;  4REE A;  4FHH A;  3HZF A;  4ONI A;  3UU7 A;  4MG7 B;  3B68 A;  1YIN A;  3WMH A;  4PWL A;  1ZH7 A;  2HB8 A;  4ZJR A;  4RMC A;  3ZR7 A;  3IPU A;  2P1T A;  3RY9 A;  4L98 A;  1T73 A;  4MG7 A;  1MZN A;  3W5Q A;  5E19 A;  1XZX X;  1Z95 A;  2V7C A;  3KDT A;  1N4H A;  2Z4B A;  4K6I A;  3VRU A;  1NHZ A;  3FLI A;  4KZI A;  5KRO A;  2G0G A;  3B66 A;  2G44 A;  1YOW A;  2AM9 A;  3FAL B;  3OAP A;  5E1C A;  1T76 A;  2AA2 A;  3O1D A;  3PEQ A;  5DZI A;  4DM6 A;  4NY9 A;  4Q13 A;  5ICK A;  2I4J A;  5AVI A;  2Q7J A;  4ITE A;  4JYH A;  4DK7 A;  3ET3 A;  2Q3Y A;  3X1I A;  1SQN A;  4KZM A;  3L1B A;  1GS4 A;  3A2I A;  4IV4 A;  3R2A A;  3AZ1 A;  2YLY A;  3H0A A;  1PZL A;  2H79 A;  4MGB B;  3OS8 C;  3KBA A;  5GIC A;  5C4S A;  5L7H A;  3VJS A;  4MGB A;  1VJB A;  1XVP B;  3WT7 A;  3UUA B;  5JY3 A;  2AX7 A;  2HCD A;  2POG A;  4XI3 A;  3LMP A;  2BAW A;  4IA7 A;  3VHW A;  3DZY D;  2YLP A;  1PQ6 A;  1XVP A;  3UUA A;  3WJ4 A;  4MDD A;  2AYR A;  1RJK A;  3DCU A;  5DZ1 A;  3VSP A;  3VRT A;  5DMC A;  3VJH A;  2AX8 A;  5G3J A;  3BQD A;  1YIM A;  1ZAF A;  1NRL A;  3TKC A;  5M96 A;  3ZRB A;  4LBD A;  3A9E A;  4OKX A;  3L03 A;  5KCU A;  2I0G A;  1XJ7 A;  1KV6 A;  5G43 A;  4IWC A;  2Q70 A;  5ACC A;  3AUR A;  5DRM A;  1FM9 A;  3OOK A;  1P93 A;  4LSJ A;  5DP0 A;  4RZG A;  4OEY A;  2YLQ A;  4Q0A C;  4QE8 A;  4OIL A;  2OM9 A;  1A28 A;  2AAX A;  1NAX A;  1X7J A;  2J14 A;  2R40 D;  1UOM A;  2QR9 A;  5DXK A;  4OH6 A;  1U3R A;  2PIP L;  2QGW A;  3CLD A;  5DWL A;  2YHD A;  1N46 A;  5DI7 A;  5DXM A;  5EJV A;  5KD9 A;  2HAR A;  2A3I A;  2JJ3 A;  3LBD A;  4OJ4 A;  3TKM A;  4IW8 A;  5KRI A;  1I37 A;  5DXE A;  3OKH A;  2FAI A;  1QKU A;  4QE6 A;  3A40 X;  4LNW A;  2V0V A;  1ILG A;  3AN3 A;  4S0S A;  5AZV A;  3HO0 A;  4EM9 A;  3IA6 A;  3ZRA A;  2PIW A;  5FQS A;  2QE4 A;  4ZNS A;  1N83 A;  2NV7 A;  5KCT A;  3PLZ A;  5H1E A;  3VT3 A;  3G8I A;  2PIX A;  4OJ9 A;  5EGV A;  4DM8 A;  3DZU A;  5AZT A;  3OOF A;  1R1K D;  2ZK4 A;  4MG5 A;  2ZNP A;  4OIU A;  2QNV A;  3R8I A;  3WFG A;  4XUH A;  5G46 A;  1NYX A;  3X1H A;  1I7G A;  1XDK B;  1R6G A;  2J4A A;  5HJS A;  2GPV A;  4ZNW A;  5IZ0 A;  4RZE A;  2BJ4 B;  3ADV A;  5DXP A;  1XDK A;  1R20 D;  3FUG A;  3M7R A;  3SP6 A;  3E00 D;  4HLW A;  3DY6 A;  1YA3 A;  3GYU A;  4CSJ A;  1NQ7 A;  2AXA A;  4PLE A;  1H9U A;  1EXA A;  2QMV A;  3SP9 A;  3Q95 B;  1HG4 A;  1TFC A;  4UDB A;  5EC9 A;  3FS1 A;  1NQ2 A;  4JGV A;  4OIV A;  1XOW A;  1M13 A;  5DIE A;  3Q95 A;  2E2R A;  4RUO X;  2AA5 A;  2XHS A;  2GPP A;  2W8Y A;  2ZK2 A;  5DIG A;  3RUU A;  4ZJW A;  5KYJ A;  2ZK5 A;  5DXB A;  1X7B A;  1OT7 A;  4OFR A;  4JL4 A;  2FSZ A;  2ZNN A;  2Q5P A;  2AMA A;  4MG6 A;  3HVL A;  5LGA A;  2YJA B;  1P8D A;  2ABI A;  2QA8 B;  3MNP A;  3CS4 A;  1XQC A;  1OSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...