2ZKCA

Crystal structure of human estrogen-related receptor gamma ligand binding domain complex with bisphenol z
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
226
structure length
226
Chain Sequence
KPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human estrogen-related receptor gamma ligand binding domain complex with bisphenol Z
rcsb
molecule keywords Estrogen-related receptor gamma
molecule tags Transcription
source organism Homo sapiens
total genus 89
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2zkcA00
3OLFA 1XQ3A 3VT5A 4YMQA 3ADXA 5CJ6A 2PINA 3AZ1A 4ZJWA 4OZTU 1XV9B 4OZRE 2QE4A 4ZNHA 2Z4BA 2ABIA 5KCCA 2YLPA 5A86A 1KV6A 4IVWA 3NSPA 3V3EA 5H1EA 4ZOMA 2P15A 1QKTA 3RY9A 3OLLA 3W0GA 1Z5XE 4E2JA 2PIVA 3OS8C 1E3GA 1NUOA 3CS8A 3HVLA 2XKWA 5SYZA 3IPUA 1M7WA 3TX7B 1GWRA 3GBKA 3X1IA 3G0WA 2HAMA 3VT4A 3EYBA 1FCYA 5AVIA 2ZK3A 4MGDB 1XPCA 2HB7A 3K23A 4APUA 2Q61A 4IUIA 3UUAB 4E4KA 5JY3A 1FBYA 1DKFB 4PVUA 4QK4A 1A28A 2QSEA 1YINA 1PQ9A 3PEQA 2Q6JA 4OFRA 4N5GA 3VRUA 4WLBA 4ZNTA 3OMMA 2QA6A 1XDKA 2VSTA 3OKIA 3HZFA 4A4WA 2GPUA 1G5YA 4K6IA 2QW4A 3H0AA 3UUDB 1PRGA 1ZKYA 1XZXX 2REWA 3KMZA 4YT1A 2HBHA 4J5XC 3IA6A 4UDAA 1X7RA 5FQVA 1T7MA 3HODA 5E15A 4IW8A 1N4HA 3B0TA 2AXAA 3FC6B 4MG6A 4OEAA 2ZFXA 4ZN9A 5IAWA 4FHHA 4LNWA 4OLMA 5C4SA 3UUCA 3ZQTA 5DZHA 3OSIA 4J5WA 4XI3A 3W5TA 2Q7KA 4PRGA 1SKXA 2J7XA 5FQPA 1T7RA 5DWJA 4EMAA 3D57A 5DV8A 1NQ0A 2BJ4B 2P54A 3MNPA 1FCZA 3L0JA 2PIXA 1Z95A 3TKMA 4OZRU 4NUFA 4FN9A 1K74A 3OMPA 4N73A 2PITA 3HM1A 4OEZA 2EWPA 1Z5XU 3HQ5A 4MG7B 4G1DA 5APJA 3AUNA 3VHVA 1EXXA 3B65A 5L7HA 4S14A 2QA8A 1PQCA 2GPOA 3FUGA 2YLOA 2ZNNA 2I0GA 3DZUD 1Y0SA 1YP0A 3PCUA 3ADTA 2YLYA 3GYUA 5DWGA 3R2AA 2Z4JA 3OLSA 5AWJA 4LSJA 3D90A 5C4OA 5G42A 3L0LA 2PIWA 5KRHA 1Y9RA 2QGWA 3Q95A 4MG9A 4OKBA 1X7JA 1MV9A 3WT5A 1PCGA 3KFCA 2ZK6A 4HEEX 4RZGA 4Y29A 5JJMB 2XYJA 3AZ2A 4DK8A 5E0WA 2NV7A 5ICKA 3SP6A 5DXBB 4IWCA 1UPWA 2VV1A 3B67A 1XVPA 5AZTA 2ZMJA 2HASA 2ZK5A 5GIEA 1XJ7A 4RUJA 3A40X 3CQVA 1T7TA 3X36A 5AYGA 2A3IA 2P1VA 4OILA 1G2NA 2QXSA 2ZK2A 3B0WA 3ZR7A 5DIGA 2YJAB 2GTKA 3IPSA 1K4WA 1R20D 4OK1A 1OVLB 3A2JA 2HFPA 3OAPA 3P0UA 5FQRA 4OH6A 4TV1B 2P1UA 5KRLA 3DCTA 5DZIA 3UP0A 4HLWA 2AA7A 2GPPA 3ET0A 3PO9A 3X1HA 1RJKA 5IXKA 2NXXA 5EC9A 4PXMA 3AFRA 3V9TA 4RMCA 4ZNVA 5GICA 2OZ7A 1TXIA 1YMTA 2Q59B 3R8AA 1T73A 3R29A 5AAVB 1NQ2A 4FNEA 1U9EA 1ZUCA 2VV0A 3GD2A 2ZXNA 4WHGA 5E1CA 3N00A 4PLDA 4XT9A 3WT7A 4IA7A 2AAXA 3B1MA 3O1DA 2ACLB 2PRGA 4S15A 5KRJA 2I4PA 4MGBA 2JFAB 1S19A 5DK9A 1T63A 1NQ7A 5DXGA 5K13A 1NQ1A 4OARA 3A2IA 4DOSA 2Q60A 3F5CA 4JAZA 1UHLB 3ET1A 4DMAA 3AUQA 4OKWA 1ZAFA 5DUGA 3OKHA 3P88A 3UVVB 5KCTA 4JYGA 5AZVA 4OEDA 5DI7A 3W0HA 3FEJA 3JZCA 1ZDUA 1Y0XX 3ET3A 3IXPA 5HJPA 4A2JA 5L7EA 2OAXA 1TFCA 2P4YA 1R5KA 4KZIA 4OKXA 3WWRA 3VTDA 3D5FA 3DY6A 1P8DA 4OJ9A 4PLEA 3B68A 5DKBA 1L2JA 4ZI1A 4LNXA 1S0XA 2POGA 2Q3YA 4PP5A 3VSPA 3VTBA 5DRJA 5G44A 3CWDA 4OKTA 3R8IA 2AWHA 2PKLA 4R2UA 1YOKA 2OVHA 2J7YA 1LBDA 2GPVA 5DUHA 2P7ZA 3GN8A 3ADVA 4OJ4A 1XLSA 3A9EB 5DWIA 2HARA 4NIEA 5DYBA 4MGDA 4XLDA 2QZOB 3DCUA 1ZH7A 2ZNOA 3ADUA 3OOFA 4N1YA 5HCVA 3PLZA 5DZ3A 4CI4A 2QPYA 5LGAA 3AZ3A 3VT3A 2AM9A 2XYXA 4PP3A 1GS4A 3V49A 4PP6A 4RUOX 5KRIA 3VT9A 3OMKA 4MG8B 4RMEA 2G5OA 4IV4A 4XTAA 5FQSA 2V7CA 2R40D 4QL8A 2GIUA 3TKCA 3DZUA 5KCDA 1I37A 3WMHA 1DB1A 3UUDA 3FALB 5C4UA 1QKUA 3CDSA 4PWLA 3VT8A 1OT7A 1YJEA 3RUUA 4F9MA 2QR9A 2Q6SA 1LV2A 3RLLA 5E14A 1SJ0A 5F9BA 3K6PA 3R8DA 3FC6A 5HYKA 4YNKA 2AO6A 3R5MA 3W0JA 3OS8A 4PPPA 4RUPA 1X78A 2AA6A 1X7EA 4WVDA 2BJ4A 4OC7A 4PPSA 1FCXA 5DX3B 4QE8A 4XUMA 5EJVA 1VJBA 1XP1A 3OGTA 2ZY0A 5APHA 2G0HA 5DXQA 3U9QA 3BC5A 5DXKA 1QKMA 2ZK0A 4MGAB 2ZMIA 4OIUA 1SR7A 2QXMA 4MG7A 2B23A 2FSZA 2Q6RA 2YATA 5KCEA 5DLRA 1T76A 3ILZA 1R20A 2P7GA 5KCWA 2VV2A 4P6WA 3OSAA 4Q0AC 3W0AA 2R6WA 5DKGA 4REFA 3E7CA 1YYEA 3CTBA 3VJTA 3KMRA 4L98A 4RAKA 3G8IA 3B5RA 3CS4A 4NB6A 5G45A 2PNUA 3VJHA 2G0GA 3W0CA 3NSQA 2ZK4A 4ZO1X 1RDTA 3TY0A 3BEJA 3V3QA 5DSHA 1ZDTA 1N46A 4G1YA 1HG4A 1Q4XA 3F7DA 3HLVA 4J24A 2QA8B 4RZEA 4ZNUA 3AN4A 3D6DA 4ITFA 1M13A 4J26A 3FLIA 2ZNPA 2NW4A 3VT7A 1YA3A 1OSVA 2PIOA 3H0AD 5B41A 5JJMA 1YOWA 4N8RA 5DXBA 2OUZA 5B5BA 4YPQA 5DV6A 2NPAA 5KRFA 4WHFA 4JYHA 4R6SA 4ONIA 3E00A 5DKSA 1KKQA 4MG9B 4M8HA 3W5RA 1I7IA 1PQ6A 3WTQA 1XAPA 4FHIA 3GWSX 4TV1A 5DZ1A 3O1EA 2JF9A 5KYAA 2HB8A 4XAOA 1YUCA 2ZL9A 3ADSA 2NXXE 2ZVTA 3KMGA 1PK5A 5DP0A 3ET2A 2R6YA 4DORA 5I4VA 1WM0X 3DT3A 4PF3A 1EREA 5L7GA 2I0JA 2ZXMA 3DR1A 4RMDA 1FM6D 1M2ZA 2YLQA 4G20A 4Q50A 5GIDA 5DTVA 2XHSA 2Q59A 4G2IA 4REEA 3VN2A 1MVCA 2VSRA 4OJBA 3KDTA 1ZGYA 2B1VA 3NOAA 2H79A 3WJ4A 4UDBA 5AAVA 5DXPA 5KR9A 4ZN7A 3OZJA 1NYXA 5DKEA 3DZYD 3VRVA 4XUHA 5DVSA 2ZKCA 2ZNQA 5ACCA 2PIUA 2E2RA 4IA2A 3OOKA 5DUEA 5DXEA 2ACLA 4TUZB 3S9SA 2JFAA 1YY4A 3CDPA 3G8OA 5ETHA 2VV4B 4MG5A 3AURA 3D24A 3ERTA 2O4JA 1SQNA 1PZLA 1T74A 1UHLA 3KWYA 1R1KD 3L1BA 5G5WA 3UVVA 5GT4A 3HO0A 2I4ZA 1T7FA 2R40A 2AA5A 5DIEA 2B50A 2HWQA 4G2HA 5AAUA 2W8YA 1BSXA 5KYJA 4MDDA 1XV9A 1GWXA 2GL8A 3B0RA 4P6XA 4QM0A 5E7VA 5DVVA 3E94A 3UU7B 1UOMA 4RFWA 3ERDA 3B0QA 1ERRA 2OVMA 2AMBA 4QE6A 3MNOA 3F5CB 4EM9A 2HVCA 1N83A 5DRMA 3PBAA 2O9IA 2FVJA 3V9YA 5DZ0A 4LTWA 4KZJA 1PDUA 1XOWA 5DWLA 2PIQA 1MZNA 1XLSE 1KNUA 3A78A 5DU5A 1NRLA 4O8FA 1FM9D 4IVYA 1XB7A 4UDCA 3WFFA 5IZ0A 3A9EA 1ZEOA 2FAIA 3V4AA 3A2HA 3CS6A 1X76A 3UUAA 2QZOA 1DKFA 3MNEA 4WPFA 1T5ZA 3VJIA 3AX8A 4J5WC 2ZBSA 5C4TA 3VT6A 4IS8A 3IPQA 4XHDA 2Q5SA 2Q1HA 4OGHA 3FS1A 1NDEA 4S0TA 5DV3A 4MG8A 2VV3A 2Q7JA 1U3SA 2H77A 4RWVA 3X31A 5DY8A 5HJSA 3FURA 3FALA 5DYDA 2AX7A 3B3KA 1XNXA 2P7AA 3CJWA 5DVCA 3WT6A 5DXMA 2AX9A 4M8EA 1IE8A 4RZFA 5DIDA 4ZNSA 4CI5A 1A52A 2AX6A 4IWFA 3KYTA 2OM9A 1XDKB 5KCFA 4RE8A 5E0XA 5AVLA 2GP7A 5KRMA 4JYIA 4POHA 2Q70A 4OH5A 5EITA 2QTUA 3IXPD 1U3QA 4S0SA 2F4BA 3LBDA 5DX3A 4OIVA 2LBDA 2ZXZA 4K4JA 3V9VA 3A3ZX 5JI0D 5KRKA 2HC4A 3RVFA 1ILGA 2XYWA 1G1UA 1XP6A 2QNVA 3JZBA 3AN3A 2QGTA 3KPZA 4MGAA 1ILHA 5LWPA 4BCRA 4KZMA 4UDDA 5KRAA 3B66A 4K7AA 1L2IA 4CSJA 2YJDA 4POJA 4DM8A 5KROA 4J5XA 4MGCA 2IHQA 3GZ9A 3ZRAA 4IW6A 5HYRA 1HJ1A 3VHUA 2IOGA 2PJLA 2ZMHA 3P8XA 5DWEA 4FGYA 2O4RA 4DK7A 1G50A 4G21A 1FM6A 2ZASA 3ADWA 3P89A 1S0ZA 1RKHA 4X1GA 3OZ0A 1FD0A 3KDUA 1S9QA 1NHZA 3W5QA 4L96A 3VI8A 3RLJA 3SP9A 3WJ5A 3GYTA 5HZCA 3HC5A 2QH6A 4E4QA 3DZYA 1R6GA 3ZRBA 2JJ3A 4OFUA 2AB2A 3L3XA 2QMVA 3M7RA 3K22A 5G3JA 2AYRA 2AMAA 1RK3A 1UPVA 2B1ZA 2G44A 3K8SA 1T79A 2PIRA 5FQTA 3WGPA 5DL4A 5KCUA 3OMOA 2Q5PA 5E19A 1GWQA 3QT0A 2HCDA 2AA2A 4ITEA 4JL4A 4IQRA 5G43A 3Q95B 2ZK1A 4ZO1B 1R1KA 1XQCA 1OVLA 4NQAB 4X1FA 1RKGA 5DXRA 2ATHA 2J4AA 4JGVA 4IA3A 3VHWA 3R5NA 4DQMA 1E3KA 5G46A 2VV1B 3W5PA 1XVPB 1K74D 1NAVA 1NAXA 3OMQA 4OZTE 2QABA 5M96A 1U3RA 2ZLAA 2HWRA 3OS9A 1I38A 4G1ZA 3VTCA 2AX8A 1X7BA 4IA1A 3H52A 5DMCA 2OCFA 1I7GA 1XP9A 3IMYA 1P93A 4QJRA 3KBAA 5DMFA 3VRTA 2I4JA 2P1TA 1H9UA 3W0IA 3RUTA 1XIUA 3L3ZA 3L0EA 3OSWA 1FM9A 3T03A 2PIPL 2YHDA 4NY9A 3VRWA 2ZLCA 5EHJA 4TUZA 1QKNA 3SZ1A 2IOKA 2V0VA 2Q5GA 2POBA 4IV2A 1OSHA 5EGVA 2VV4A 2GWXA 4ZJRA 1RDTD 3FXVA 3WFGA 1IE9A 5KRCA 3CLDA 1EXAA 3VSOA 3FEIA 2Q1VA 4A4VA 5AWKA 3W0YA 1T65A 3L03A 4B7WA 1YIMA 4MGBB 3VJSA 5AK2A 3PRGA 2YFEA 2BAWA 3G9EA 5EI1A 4IU7A 4R06A 3UP3A 3UU7A 4LBDA 3GWXA 3HC6A 4OHAA 4DM6A 1K7LA 2J14A 3BQDA 5KD9A 4OEYA 1XNNA 2Q8SA 3LMPA 5L11A 2Q7IA 4Q13A 3E00D 1S9PA 5APKA 2Q7LA 4WQPA 5HJPB 4ZNWA
chains in the Genus database with same CATH superfamily
3OLFA 1XQ3A 3VT5A 4YMQA 3ADXA 5CJ6A 2PINA 3AZ1A 4ZJWA 4OZTU 1XV9B 4OZRE 2QE4A 4ZNHA 2Z4BA 2ABIA 5KCCA 2YLPA 5A86A 1KV6A 4IVWA 3NSPA 3V3EA 5H1EA 4ZOMA 2P15A 1QKTA 3RY9A 3OLLA 3W0GA 1Z5XE 4E2JA 2PIVA 3OS8C 1E3GA 1NUOA 3CS8A 3HVLA 2XKWA 5SYZA 3IPUA 1M7WA 3TX7B 1GWRA 3GBKA 3X1IA 3G0WA 2HAMA 3VT4A 3EYBA 1FCYA 5AVIA 2ZK3A 4MGDB 1XPCA 2HB7A 3K23A 4APUA 2Q61A 4IUIA 3UUAB 4E4KA 5JY3A 1FBYA 1DKFB 4PVUA 4QK4A 1A28A 2QSEA 1YINA 1PQ9A 3PEQA 2Q6JA 4OFRA 4N5GA 3VRUA 4WLBA 4ZNTA 3OMMA 2QA6A 1XDKA 2VSTA 3OKIA 3HZFA 4A4WA 2GPUA 1G5YA 4K6IA 2QW4A 3H0AA 3UUDB 1PRGA 1ZKYA 1XZXX 2REWA 3KMZA 4YT1A 2HBHA 4J5XC 3IA6A 4UDAA 1X7RA 5FQVA 1T7MA 3HODA 5E15A 4IW8A 1N4HA 3B0TA 2AXAA 3FC6B 4MG6A 4OEAA 2ZFXA 4ZN9A 5IAWA 4FHHA 4LNWA 4OLMA 5C4SA 3UUCA 3ZQTA 5DZHA 3OSIA 4J5WA 4XI3A 3W5TA 2Q7KA 4PRGA 1SKXA 2J7XA 5FQPA 1T7RA 5DWJA 4EMAA 3D57A 5DV8A 1NQ0A 2BJ4B 2P54A 3MNPA 1FCZA 3L0JA 2PIXA 1Z95A 3TKMA 4OZRU 4NUFA 4FN9A 1K74A 3OMPA 4N73A 2PITA 3HM1A 4OEZA 2EWPA 1Z5XU 3HQ5A 4MG7B 4G1DA 5APJA 3AUNA 3VHVA 1EXXA 3B65A 5L7HA 4S14A 2QA8A 1PQCA 2GPOA 3FUGA 2YLOA 2ZNNA 2I0GA 3DZUD 1Y0SA 1YP0A 3PCUA 3ADTA 2YLYA 3GYUA 5DWGA 3R2AA 2Z4JA 3OLSA 5AWJA 4LSJA 3D90A 5C4OA 5G42A 3L0LA 2PIWA 5KRHA 1Y9RA 2QGWA 3Q95A 4MG9A 4OKBA 1X7JA 1MV9A 3WT5A 1PCGA 3KFCA 2ZK6A 4HEEX 4RZGA 4Y29A 5JJMB 2XYJA 3AZ2A 4DK8A 5E0WA 2NV7A 5ICKA 3SP6A 5DXBB 4IWCA 1UPWA 2VV1A 3B67A 1XVPA 5AZTA 2ZMJA 2HASA 2ZK5A 5GIEA 1XJ7A 4RUJA 3A40X 3CQVA 1T7TA 3X36A 5AYGA 2A3IA 2P1VA 4OILA 1G2NA 2QXSA 2ZK2A 3B0WA 3ZR7A 5DIGA 2YJAB 2GTKA 3IPSA 1K4WA 1R20D 4OK1A 1OVLB 3A2JA 2HFPA 3OAPA 3P0UA 5FQRA 4OH6A 4TV1B 2P1UA 5KRLA 3DCTA 5DZIA 3UP0A 4HLWA 2AA7A 2GPPA 3ET0A 3PO9A 3X1HA 1RJKA 5IXKA 2NXXA 5EC9A 4PXMA 3AFRA 3V9TA 4RMCA 4ZNVA 5GICA 2OZ7A 1TXIA 1YMTA 2Q59B 3R8AA 1T73A 3R29A 5AAVB 1NQ2A 4FNEA 1U9EA 1ZUCA 2VV0A 3GD2A 2ZXNA 4WHGA 5E1CA 3N00A 4PLDA 4XT9A 3WT7A 4IA7A 2AAXA 3B1MA 3O1DA 2ACLB 2PRGA 4S15A 5KRJA 2I4PA 4MGBA 2JFAB 1S19A 5DK9A 1T63A 1NQ7A 5DXGA 5K13A 1NQ1A 4OARA 3A2IA 4DOSA 2Q60A 3F5CA 4JAZA 1UHLB 3ET1A 4DMAA 3AUQA 4OKWA 1ZAFA 5DUGA 3OKHA 3P88A 3UVVB 5KCTA 4JYGA 5AZVA 4OEDA 5DI7A 3W0HA 3FEJA 3JZCA 1ZDUA 1Y0XX 3ET3A 3IXPA 5HJPA 4A2JA 5L7EA 2OAXA 1TFCA 2P4YA 1R5KA 4KZIA 4OKXA 3WWRA 3VTDA 3D5FA 3DY6A 1P8DA 4OJ9A 4PLEA 3B68A 5DKBA 1L2JA 4ZI1A 4LNXA 1S0XA 2POGA 2Q3YA 4PP5A 3VSPA 3VTBA 5DRJA 5G44A 3CWDA 4OKTA 3R8IA 2AWHA 2PKLA 4R2UA 1YOKA 2OVHA 2J7YA 1LBDA 2GPVA 5DUHA 2P7ZA 3GN8A 3ADVA 4OJ4A 1XLSA 3A9EB 5DWIA 2HARA 4NIEA 5DYBA 4MGDA 4XLDA 2QZOB 3DCUA 1ZH7A 2ZNOA 3ADUA 3OOFA 4N1YA 5HCVA 3PLZA 5DZ3A 4CI4A 2QPYA 5LGAA 3AZ3A 3VT3A 2AM9A 2XYXA 4PP3A 1GS4A 3V49A 4PP6A 4RUOX 5KRIA 3VT9A 3OMKA 4MG8B 4RMEA 2G5OA 4IV4A 4XTAA 5FQSA 2V7CA 2R40D 4QL8A 2GIUA 3TKCA 3DZUA 5KCDA 1I37A 3WMHA 1DB1A 3UUDA 3FALB 5C4UA 1QKUA 3CDSA 4PWLA 3VT8A 1OT7A 1YJEA 3RUUA 4F9MA 2QR9A 2Q6SA 1LV2A 3RLLA 5E14A 1SJ0A 5F9BA 3K6PA 3R8DA 3FC6A 5HYKA 4YNKA 2AO6A 3R5MA 3W0JA 3OS8A 4PPPA 4RUPA 1X78A 2AA6A 1X7EA 4WVDA 2BJ4A 4OC7A 4PPSA 1FCXA 5DX3B 4QE8A 4XUMA 5EJVA 1VJBA 1XP1A 3OGTA 2ZY0A 5APHA 2G0HA 5DXQA 3U9QA 3BC5A 5DXKA 1QKMA 2ZK0A 4MGAB 2ZMIA 4OIUA 1SR7A 2QXMA 4MG7A 2B23A 2FSZA 2Q6RA 2YATA 5KCEA 5DLRA 1T76A 3ILZA 1R20A 2P7GA 5KCWA 2VV2A 4P6WA 3OSAA 4Q0AC 3W0AA 2R6WA 5DKGA 4REFA 3E7CA 1YYEA 3CTBA 3VJTA 3KMRA 4L98A 4RAKA 3G8IA 3B5RA 3CS4A 4NB6A 5G45A 2PNUA 3VJHA 2G0GA 3W0CA 3NSQA 2ZK4A 4ZO1X 1RDTA 3TY0A 3BEJA 3V3QA 5DSHA 1ZDTA 1N46A 4G1YA 1HG4A 1Q4XA 3F7DA 3HLVA 4J24A 2QA8B 4RZEA 4ZNUA 3AN4A 3D6DA 4ITFA 1M13A 4J26A 3FLIA 2ZNPA 2NW4A 3VT7A 1YA3A 1OSVA 2PIOA 3H0AD 5B41A 5JJMA 1YOWA 4N8RA 5DXBA 2OUZA 5B5BA 4YPQA 5DV6A 2NPAA 5KRFA 4WHFA 4JYHA 4R6SA 4ONIA 3E00A 5DKSA 1KKQA 4MG9B 4M8HA 3W5RA 1I7IA 1PQ6A 3WTQA 1XAPA 4FHIA 3GWSX 4TV1A 5DZ1A 3O1EA 2JF9A 5KYAA 2HB8A 4XAOA 1YUCA 2ZL9A 3ADSA 2NXXE 2ZVTA 3KMGA 1PK5A 5DP0A 3ET2A 2R6YA 4DORA 5I4VA 1WM0X 3DT3A 4PF3A 1EREA 5L7GA 2I0JA 2ZXMA 3DR1A 4RMDA 1FM6D 1M2ZA 2YLQA 4G20A 4Q50A 5GIDA 5DTVA 2XHSA 2Q59A 4G2IA 4REEA 3VN2A 1MVCA 2VSRA 4OJBA 3KDTA 1ZGYA 2B1VA 3NOAA 2H79A 3WJ4A 4UDBA 5AAVA 5DXPA 5KR9A 4ZN7A 3OZJA 1NYXA 5DKEA 3DZYD 3VRVA 4XUHA 5DVSA 2ZKCA 2ZNQA 5ACCA 2PIUA 2E2RA 4IA2A 3OOKA 5DUEA 5DXEA 2ACLA 4TUZB 3S9SA 2JFAA 1YY4A 3CDPA 3G8OA 5ETHA 2VV4B 4MG5A 3AURA 3D24A 3ERTA 2O4JA 1SQNA 1PZLA 1T74A 1UHLA 3KWYA 1R1KD 3L1BA 5G5WA 3UVVA 5GT4A 3HO0A 2I4ZA 1T7FA 2R40A 2AA5A 5DIEA 2B50A 2HWQA 4G2HA 5AAUA 2W8YA 1BSXA 5KYJA 4MDDA 1XV9A 1GWXA 2GL8A 3B0RA 4P6XA 4QM0A 5E7VA 5DVVA 3E94A 3UU7B 1UOMA 4RFWA 3ERDA 3B0QA 1ERRA 2OVMA 2AMBA 4QE6A 3MNOA 3F5CB 4EM9A 2HVCA 1N83A 5DRMA 3PBAA 2O9IA 2FVJA 3V9YA 5DZ0A 4LTWA 4KZJA 1PDUA 1XOWA 5DWLA 2PIQA 1MZNA 1XLSE 1KNUA 3A78A 5DU5A 1NRLA 4O8FA 1FM9D 4IVYA 1XB7A 4UDCA 3WFFA 5IZ0A 3A9EA 1ZEOA 2FAIA 3V4AA 3A2HA 3CS6A 1X76A 3UUAA 2QZOA 1DKFA 3MNEA 4WPFA 1T5ZA 3VJIA 3AX8A 4J5WC 2ZBSA 5C4TA 3VT6A 4IS8A 3IPQA 4XHDA 2Q5SA 2Q1HA 4OGHA 3FS1A 1NDEA 4S0TA 5DV3A 4MG8A 2VV3A 2Q7JA 1U3SA 2H77A 4RWVA 3X31A 5DY8A 5HJSA 3FURA 3FALA 5DYDA 2AX7A 3B3KA 1XNXA 2P7AA 3CJWA 5DVCA 3WT6A 5DXMA 2AX9A 4M8EA 1IE8A 4RZFA 5DIDA 4ZNSA 4CI5A 1A52A 2AX6A 4IWFA 3KYTA 2OM9A 1XDKB 5KCFA 4RE8A 5E0XA 5AVLA 2GP7A 5KRMA 4JYIA 4POHA 2Q70A 4OH5A 5EITA 2QTUA 3IXPD 1U3QA 4S0SA 2F4BA 3LBDA 5DX3A 4OIVA 2LBDA 2ZXZA 4K4JA 3V9VA 3A3ZX 5JI0D 5KRKA 2HC4A 3RVFA 1ILGA 2XYWA 1G1UA 1XP6A 2QNVA 3JZBA 3AN3A 2QGTA 3KPZA 4MGAA 1ILHA 5LWPA 4BCRA 4KZMA 4UDDA 5KRAA 3B66A 4K7AA 1L2IA 4CSJA 2YJDA 4POJA 4DM8A 5KROA 4J5XA 4MGCA 2IHQA 3GZ9A 3ZRAA 4IW6A 5HYRA 1HJ1A 3VHUA 2IOGA 2PJLA 2ZMHA 3P8XA 5DWEA 4FGYA 2O4RA 4DK7A 1G50A 4G21A 1FM6A 2ZASA 3ADWA 3P89A 1S0ZA 1RKHA 4X1GA 3OZ0A 1FD0A 3KDUA 1S9QA 1NHZA 3W5QA 4L96A 3VI8A 3RLJA 3SP9A 3WJ5A 3GYTA 5HZCA 3HC5A 2QH6A 4E4QA 3DZYA 1R6GA 3ZRBA 2JJ3A 4OFUA 2AB2A 3L3XA 2QMVA 3M7RA 3K22A 5G3JA 2AYRA 2AMAA 1RK3A 1UPVA 2B1ZA 2G44A 3K8SA 1T79A 2PIRA 5FQTA 3WGPA 5DL4A 5KCUA 3OMOA 2Q5PA 5E19A 1GWQA 3QT0A 2HCDA 2AA2A 4ITEA 4JL4A 4IQRA 5G43A 3Q95B 2ZK1A 4ZO1B 1R1KA 1XQCA 1OVLA 4NQAB 4X1FA 1RKGA 5DXRA 2ATHA 2J4AA 4JGVA 4IA3A 3VHWA 3R5NA 4DQMA 1E3KA 5G46A 2VV1B 3W5PA 1XVPB 1K74D 1NAVA 1NAXA 3OMQA 4OZTE 2QABA 5M96A 1U3RA 2ZLAA 2HWRA 3OS9A 1I38A 4G1ZA 3VTCA 2AX8A 1X7BA 4IA1A 3H52A 5DMCA 2OCFA 1I7GA 1XP9A 3IMYA 1P93A 4QJRA 3KBAA 5DMFA 3VRTA 2I4JA 2P1TA 1H9UA 3W0IA 3RUTA 1XIUA 3L3ZA 3L0EA 3OSWA 1FM9A 3T03A 2PIPL 2YHDA 4NY9A 3VRWA 2ZLCA 5EHJA 4TUZA 1QKNA 3SZ1A 2IOKA 2V0VA 2Q5GA 2POBA 4IV2A 1OSHA 5EGVA 2VV4A 2GWXA 4ZJRA 1RDTD 3FXVA 3WFGA 1IE9A 5KRCA 3CLDA 1EXAA 3VSOA 3FEIA 2Q1VA 4A4VA 5AWKA 3W0YA 1T65A 3L03A 4B7WA 1YIMA 4MGBB 3VJSA 5AK2A 3PRGA 2YFEA 2BAWA 3G9EA 5EI1A 4IU7A 4R06A 3UP3A 3UU7A 4LBDA 3GWXA 3HC6A 4OHAA 4DM6A 1K7LA 2J14A 3BQDA 5KD9A 4OEYA 1XNNA 2Q8SA 3LMPA 5L11A 2Q7IA 4Q13A 3E00D 1S9PA 5APKA 2Q7LA 4WQPA 5HJPB 4ZNWA
chains in the Genus database with same CATH topology
3OLFA 1XQ3A 3VT5A 4YMQA 3ADXA 5CJ6A 2PINA 3AZ1A 4ZJWA 4OZTU 1XV9B 4OZRE 2QE4A 4ZNHA 2Z4BA 2ABIA 5KCCA 2YLPA 5A86A 1KV6A 4IVWA 3NSPA 3V3EA 5H1EA 4ZOMA 2P15A 1QKTA 3RY9A 3OLLA 3W0GA 1Z5XE 4E2JA 2PIVA 3OS8C 1E3GA 1NUOA 3CS8A 3HVLA 2XKWA 5SYZA 3IPUA 1M7WA 3TX7B 1GWRA 3GBKA 3X1IA 3G0WA 2HAMA 3VT4A 3EYBA 1FCYA 5AVIA 2ZK3A 4MGDB 1XPCA 2HB7A 3K23A 4APUA 2Q61A 4IUIA 3UUAB 4E4KA 5JY3A 1FBYA 1DKFB 4PVUA 4QK4A 1A28A 2QSEA 1YINA 1PQ9A 3PEQA 2Q6JA 4OFRA 4N5GA 3VRUA 4WLBA 4ZNTA 3OMMA 2QA6A 1XDKA 2VSTA 3OKIA 3HZFA 4A4WA 2GPUA 1G5YA 4K6IA 2QW4A 3H0AA 3UUDB 1PRGA 1ZKYA 1XZXX 2REWA 3KMZA 4YT1A 2HBHA 4J5XC 3IA6A 4UDAA 1X7RA 5FQVA 1T7MA 3HODA 5E15A 4IW8A 1N4HA 3B0TA 2AXAA 3FC6B 4MG6A 4OEAA 2ZFXA 4ZN9A 5IAWA 4FHHA 4LNWA 4OLMA 5C4SA 3UUCA 3ZQTA 5DZHA 3OSIA 4J5WA 4XI3A 3W5TA 2Q7KA 4PRGA 1SKXA 2J7XA 5FQPA 1T7RA 5DWJA 4EMAA 3D57A 5DV8A 1NQ0A 2BJ4B 2P54A 3MNPA 1FCZA 3L0JA 2PIXA 1Z95A 3TKMA 4OZRU 4NUFA 4FN9A 1K74A 3OMPA 4N73A 2PITA 3HM1A 4OEZA 2EWPA 1Z5XU 3HQ5A 4MG7B 4G1DA 5APJA 3AUNA 3VHVA 1EXXA 3B65A 5L7HA 4S14A 2QA8A 1PQCA 2GPOA 3FUGA 2YLOA 2ZNNA 2I0GA 3DZUD 1Y0SA 1YP0A 3PCUA 3ADTA 2YLYA 3GYUA 5DWGA 3R2AA 2Z4JA 3OLSA 5AWJA 4LSJA 3D90A 5C4OA 5G42A 3L0LA 2PIWA 5KRHA 1Y9RA 2QGWA 3Q95A 4MG9A 4OKBA 1X7JA 1MV9A 3WT5A 1PCGA 3KFCA 2ZK6A 4HEEX 4RZGA 4Y29A 5JJMB 2XYJA 3AZ2A 4DK8A 5E0WA 2NV7A 5ICKA 3SP6A 5DXBB 4IWCA 1UPWA 2VV1A 3B67A 1XVPA 5AZTA 2ZMJA 2HASA 2ZK5A 5GIEA 1XJ7A 4RUJA 3A40X 3CQVA 1T7TA 3X36A 5AYGA 2A3IA 2P1VA 4OILA 1G2NA 2QXSA 2ZK2A 3B0WA 3ZR7A 5DIGA 2YJAB 2GTKA 3IPSA 1K4WA 1R20D 4OK1A 1OVLB 3A2JA 2HFPA 3OAPA 3P0UA 5FQRA 4OH6A 4TV1B 2P1UA 5KRLA 3DCTA 5DZIA 3UP0A 4HLWA 2AA7A 2GPPA 3ET0A 3PO9A 3X1HA 1RJKA 5IXKA 2NXXA 5EC9A 4PXMA 3AFRA 3V9TA 4RMCA 4ZNVA 5GICA 2OZ7A 1TXIA 1YMTA 2Q59B 3R8AA 1T73A 3R29A 5AAVB 1NQ2A 4FNEA 1U9EA 1ZUCA 2VV0A 3GD2A 2ZXNA 4WHGA 5E1CA 3N00A 4PLDA 4XT9A 3WT7A 4IA7A 2AAXA 3B1MA 3O1DA 2ACLB 2PRGA 4S15A 5KRJA 2I4PA 4MGBA 2JFAB 1S19A 5DK9A 1T63A 1NQ7A 5DXGA 5K13A 1NQ1A 4OARA 3A2IA 4DOSA 2Q60A 3F5CA 4JAZA 1UHLB 3ET1A 4DMAA 3AUQA 4OKWA 1ZAFA 5DUGA 3OKHA 3P88A 3UVVB 5KCTA 4JYGA 5AZVA 4OEDA 5DI7A 3W0HA 3FEJA 3JZCA 1ZDUA 1Y0XX 3ET3A 3IXPA 5HJPA 4A2JA 5L7EA 2OAXA 1TFCA 2P4YA 1R5KA 4KZIA 4OKXA 3WWRA 3VTDA 3D5FA 3DY6A 1P8DA 4OJ9A 4PLEA 3B68A 5DKBA 1L2JA 4ZI1A 4LNXA 1S0XA 2POGA 2Q3YA 4PP5A 3VSPA 3VTBA 5DRJA 5G44A 3CWDA 4OKTA 3R8IA 2AWHA 2PKLA 4R2UA 1YOKA 2OVHA 2J7YA 1LBDA 2GPVA 5DUHA 2P7ZA 3GN8A 3ADVA 4OJ4A 1XLSA 3A9EB 5DWIA 2HARA 4NIEA 5DYBA 4MGDA 4XLDA 2QZOB 3DCUA 1ZH7A 2ZNOA 3ADUA 3OOFA 4N1YA 5HCVA 3PLZA 5DZ3A 4CI4A 2QPYA 5LGAA 3AZ3A 3VT3A 2AM9A 2XYXA 4PP3A 1GS4A 3V49A 4PP6A 4RUOX 5KRIA 3VT9A 3OMKA 4MG8B 4RMEA 2G5OA 4IV4A 4XTAA 5FQSA 2V7CA 2R40D 4QL8A 2GIUA 3TKCA 3DZUA 5KCDA 1I37A 3WMHA 1DB1A 3UUDA 3FALB 5C4UA 1QKUA 3CDSA 4PWLA 3VT8A 1OT7A 1YJEA 3RUUA 4F9MA 2QR9A 2Q6SA 1LV2A 3RLLA 5E14A 1SJ0A 5F9BA 3K6PA 3R8DA 3FC6A 5HYKA 4YNKA 2AO6A 3R5MA 3W0JA 3OS8A 4PPPA 4RUPA 1X78A 2AA6A 1X7EA 4WVDA 2BJ4A 4OC7A 4PPSA 1FCXA 5DX3B 4QE8A 4XUMA 5EJVA 1VJBA 1XP1A 3OGTA 2ZY0A 5APHA 2G0HA 5DXQA 3U9QA 3BC5A 5DXKA 1QKMA 2ZK0A 4MGAB 2ZMIA 4OIUA 1SR7A 2QXMA 4MG7A 2B23A 2FSZA 2Q6RA 2YATA 5KCEA 5DLRA 1T76A 3ILZA 1R20A 2P7GA 5KCWA 2VV2A 4P6WA 3OSAA 4Q0AC 3W0AA 2R6WA 5DKGA 4REFA 3E7CA 1YYEA 3CTBA 3VJTA 3KMRA 4L98A 4RAKA 3G8IA 3B5RA 3CS4A 4NB6A 5G45A 2PNUA 3VJHA 2G0GA 3W0CA 3NSQA 2ZK4A 4ZO1X 1RDTA 3TY0A 3BEJA 3V3QA 5DSHA 1ZDTA 1N46A 4G1YA 1HG4A 1Q4XA 3F7DA 3HLVA 4J24A 2QA8B 4RZEA 4ZNUA 3AN4A 3D6DA 4ITFA 1M13A 4J26A 3FLIA 2ZNPA 2NW4A 3VT7A 1YA3A 1OSVA 2PIOA 3H0AD 5B41A 5JJMA 1YOWA 4N8RA 5DXBA 2OUZA 5B5BA 4YPQA 5DV6A 2NPAA 5KRFA 4WHFA 4JYHA 4R6SA 4ONIA 3E00A 5DKSA 1KKQA 4MG9B 4M8HA 3W5RA 1I7IA 1PQ6A 3WTQA 1XAPA 4FHIA 3GWSX 4TV1A 5DZ1A 3O1EA 2JF9A 5KYAA 2HB8A 4XAOA 1YUCA 2ZL9A 3ADSA 2NXXE 2ZVTA 3KMGA 1PK5A 5DP0A 3ET2A 2R6YA 4DORA 5I4VA 1WM0X 3DT3A 4PF3A 1EREA 5L7GA 2I0JA 2ZXMA 3DR1A 4RMDA 1FM6D 1M2ZA 2YLQA 4G20A 4Q50A 5GIDA 5DTVA 2XHSA 2Q59A 4G2IA 4REEA 3VN2A 1MVCA 2VSRA 4OJBA 3KDTA 1ZGYA 2B1VA 3NOAA 2H79A 3WJ4A 4UDBA 5AAVA 5DXPA 5KR9A 4ZN7A 3OZJA 1NYXA 5DKEA 3DZYD 3VRVA 4XUHA 5DVSA 2ZKCA 2ZNQA 5ACCA 2PIUA 2E2RA 4IA2A 3OOKA 5DUEA 5DXEA 2ACLA 4TUZB 3S9SA 2JFAA 1YY4A 3CDPA 3G8OA 5ETHA 2VV4B 4MG5A 3AURA 3D24A 3ERTA 2O4JA 1SQNA 1PZLA 1T74A 1UHLA 3KWYA 1R1KD 3L1BA 5G5WA 3UVVA 5GT4A 3HO0A 2I4ZA 1T7FA 2R40A 2AA5A 5DIEA 2B50A 2HWQA 4G2HA 5AAUA 2W8YA 1BSXA 5KYJA 4MDDA 1XV9A 1GWXA 2GL8A 3B0RA 4P6XA 4QM0A 5E7VA 5DVVA 3E94A 3UU7B 1UOMA 4RFWA 3ERDA 3B0QA 1ERRA 2OVMA 2AMBA 4QE6A 3MNOA 3F5CB 4EM9A 2HVCA 1N83A 5DRMA 3PBAA 2O9IA 2FVJA 3V9YA 5DZ0A 4LTWA 4KZJA 1PDUA 1XOWA 5DWLA 2PIQA 1MZNA 1XLSE 1KNUA 3A78A 5DU5A 1NRLA 4O8FA 1FM9D 4IVYA 1XB7A 4UDCA 3WFFA 5IZ0A 3A9EA 1ZEOA 2FAIA 3V4AA 3A2HA 3CS6A 1X76A 3UUAA 2QZOA 1DKFA 3MNEA 4WPFA 1T5ZA 3VJIA 3AX8A 4J5WC 2ZBSA 5C4TA 3VT6A 4IS8A 3IPQA 4XHDA 2Q5SA 2Q1HA 4OGHA 3FS1A 1NDEA 4S0TA 5DV3A 4MG8A 2VV3A 2Q7JA 1U3SA 2H77A 4RWVA 3X31A 5DY8A 5HJSA 3FURA 3FALA 5DYDA 2AX7A 3B3KA 1XNXA 2P7AA 3CJWA 5DVCA 3WT6A 5DXMA 2AX9A 4M8EA 1IE8A 4RZFA 5DIDA 4ZNSA 4CI5A 1A52A 2AX6A 4IWFA 3KYTA 2OM9A 1XDKB 5KCFA 4RE8A 5E0XA 5AVLA 2GP7A 5KRMA 4JYIA 4POHA 2Q70A 4OH5A 5EITA 2QTUA 3IXPD 1U3QA 4S0SA 2F4BA 3LBDA 5DX3A 4OIVA 2LBDA 2ZXZA 4K4JA 3V9VA 3A3ZX 5JI0D 5KRKA 2HC4A 3RVFA 1ILGA 2XYWA 1G1UA 1XP6A 2QNVA 3JZBA 3AN3A 2QGTA 3KPZA 4MGAA 1ILHA 5LWPA 4BCRA 4KZMA 4UDDA 5KRAA 3B66A 4K7AA 1L2IA 4CSJA 2YJDA 4POJA 4DM8A 5KROA 4J5XA 4MGCA 2IHQA 3GZ9A 3ZRAA 4IW6A 5HYRA 1HJ1A 3VHUA 2IOGA 2PJLA 2ZMHA 3P8XA 5DWEA 4FGYA 2O4RA 4DK7A 1G50A 4G21A 1FM6A 2ZASA 3ADWA 3P89A 1S0ZA 1RKHA 4X1GA 3OZ0A 1FD0A 3KDUA 1S9QA 1NHZA 3W5QA 4L96A 3VI8A 3RLJA 3SP9A 3WJ5A 3GYTA 5HZCA 3HC5A 2QH6A 4E4QA 3DZYA 1R6GA 3ZRBA 2JJ3A 4OFUA 2AB2A 3L3XA 2QMVA 3M7RA 3K22A 5G3JA 2AYRA 2AMAA 1RK3A 1UPVA 2B1ZA 2G44A 3K8SA 1T79A 2PIRA 5FQTA 3WGPA 5DL4A 5KCUA 3OMOA 2Q5PA 5E19A 1GWQA 3QT0A 2HCDA 2AA2A 4ITEA 4JL4A 4IQRA 5G43A 3Q95B 2ZK1A 4ZO1B 1R1KA 1XQCA 1OVLA 4NQAB 4X1FA 1RKGA 5DXRA 2ATHA 2J4AA 4JGVA 4IA3A 3VHWA 3R5NA 4DQMA 1E3KA 5G46A 2VV1B 3W5PA 1XVPB 1K74D 1NAVA 1NAXA 3OMQA 4OZTE 2QABA 5M96A 1U3RA 2ZLAA 2HWRA 3OS9A 1I38A 4G1ZA 3VTCA 2AX8A 1X7BA 4IA1A 3H52A 5DMCA 2OCFA 1I7GA 1XP9A 3IMYA 1P93A 4QJRA 3KBAA 5DMFA 3VRTA 2I4JA 2P1TA 1H9UA 3W0IA 3RUTA 1XIUA 3L3ZA 3L0EA 3OSWA 1FM9A 3T03A 2PIPL 2YHDA 4NY9A 3VRWA 2ZLCA 5EHJA 4TUZA 1QKNA 3SZ1A 2IOKA 2V0VA 2Q5GA 2POBA 4IV2A 1OSHA 5EGVA 2VV4A 2GWXA 4ZJRA 1RDTD 3FXVA 3WFGA 1IE9A 5KRCA 3CLDA 1EXAA 3VSOA 3FEIA 2Q1VA 4A4VA 5AWKA 3W0YA 1T65A 3L03A 4B7WA 1YIMA 4MGBB 3VJSA 5AK2A 3PRGA 2YFEA 2BAWA 3G9EA 5EI1A 4IU7A 4R06A 3UP3A 3UU7A 4LBDA 3GWXA 3HC6A 4OHAA 4DM6A 1K7LA 2J14A 3BQDA 5KD9A 4OEYA 1XNNA 2Q8SA 3LMPA 5L11A 2Q7IA 4Q13A 3E00D 1S9PA 5APKA 2Q7LA 4WQPA 5HJPB 4ZNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OLF A;  1XQ3 A;  3VT5 A;  4YMQ A;  3ADX A;  5CJ6 A;  2PIN A;  3AZ1 A;  4ZJW A;  4OZT U;  1XV9 B;  4OZR E;  2QE4 A;  4ZNH A;  2Z4B A;  2ABI A;  5KCC A;  2YLP A;  5A86 A;  1KV6 A;  4IVW A;  3NSP A;  3V3E A;  5H1E A;  4ZOM A;  2P15 A;  1QKT A;  3RY9 A;  3OLL A;  3W0G A;  1Z5X E;  4E2J A;  2PIV A;  3OS8 C;  1E3G A;  1NUO A;  3CS8 A;  3HVL A;  2XKW A;  5SYZ A;  3IPU A;  1M7W A;  3TX7 B;  1GWR A;  3GBK A;  3X1I A;  3G0W A;  2HAM A;  3VT4 A;  3EYB A;  1FCY A;  5AVI A;  2ZK3 A;  4MGD B;  1XPC A;  2HB7 A;  3K23 A;  4APU A;  2Q61 A;  4IUI A;  3UUA B;  4E4K A;  5JY3 A;  1FBY A;  1DKF B;  4PVU A;  4QK4 A;  1A28 A;  2QSE A;  1YIN A;  1PQ9 A;  3PEQ A;  2Q6J A;  4OFR A;  4N5G A;  3VRU A;  4WLB A;  4ZNT A;  3OMM A;  2QA6 A;  1XDK A;  2VST A;  3OKI A;  3HZF A;  4A4W A;  2GPU A;  1G5Y A;  4K6I A;  2QW4 A;  3H0A A;  3UUD B;  1PRG A;  1ZKY A;  1XZX X;  2REW A;  3KMZ A;  4YT1 A;  2HBH A;  4J5X C;  3IA6 A;  4UDA A;  1X7R A;  5FQV A;  1T7M A;  3HOD A;  5E15 A;  4IW8 A;  1N4H A;  3B0T A;  2AXA A;  3FC6 B;  4MG6 A;  4OEA A;  2ZFX A;  4ZN9 A;  5IAW A;  4FHH A;  4LNW A;  4OLM A;  5C4S A;  3UUC A;  3ZQT A;  5DZH A;  3OSI A;  4J5W A;  4XI3 A;  3W5T A;  2Q7K A;  4PRG A;  1SKX A;  2J7X A;  5FQP A;  1T7R A;  5DWJ A;  4EMA A;  3D57 A;  5DV8 A;  1NQ0 A;  2BJ4 B;  2P54 A;  3MNP A;  1FCZ A;  3L0J A;  2PIX A;  1Z95 A;  3TKM A;  4OZR U;  4NUF A;  4FN9 A;  1K74 A;  3OMP A;  4N73 A;  2PIT A;  3HM1 A;  4OEZ A;  2EWP A;  1Z5X U;  3HQ5 A;  4MG7 B;  4G1D A;  5APJ A;  3AUN A;  3VHV A;  1EXX A;  3B65 A;  5L7H A;  4S14 A;  2QA8 A;  1PQC A;  2GPO A;  3FUG A;  2YLO A;  2ZNN A;  2I0G A;  3DZU D;  1Y0S A;  1YP0 A;  3PCU A;  3ADT A;  2YLY A;  3GYU A;  5DWG A;  3R2A A;  2Z4J A;  3OLS A;  5AWJ A;  4LSJ A;  3D90 A;  5C4O A;  5G42 A;  3L0L A;  2PIW A;  5KRH A;  1Y9R A;  2QGW A;  3Q95 A;  4MG9 A;  4OKB A;  1X7J A;  1MV9 A;  3WT5 A;  1PCG A;  3KFC A;  2ZK6 A;  4HEE X;  4RZG A;  4Y29 A;  5JJM B;  2XYJ A;  3AZ2 A;  4DK8 A;  5E0W A;  2NV7 A;  5ICK A;  3SP6 A;  5DXB B;  4IWC A;  1UPW A;  2VV1 A;  3B67 A;  1XVP A;  5AZT A;  2ZMJ A;  2HAS A;  2ZK5 A;  5GIE A;  1XJ7 A;  4RUJ A;  3A40 X;  3CQV A;  1T7T A;  3X36 A;  5AYG A;  2A3I A;  2P1V A;  4OIL A;  1G2N A;  2QXS A;  2ZK2 A;  3B0W A;  3ZR7 A;  5DIG A;  2YJA B;  2GTK A;  3IPS A;  1K4W A;  1R20 D;  4OK1 A;  1OVL B;  3A2J A;  2HFP A;  3OAP A;  3P0U A;  5FQR A;  4OH6 A;  4TV1 B;  2P1U A;  5KRL A;  3DCT A;  5DZI A;  3UP0 A;  4HLW A;  2AA7 A;  2GPP A;  3ET0 A;  3PO9 A;  3X1H A;  1RJK A;  5IXK A;  2NXX A;  5EC9 A;  4PXM A;  3AFR A;  3V9T A;  4RMC A;  4ZNV A;  5GIC A;  2OZ7 A;  1TXI A;  1YMT A;  2Q59 B;  3R8A A;  1T73 A;  3R29 A;  5AAV B;  1NQ2 A;  4FNE A;  1U9E A;  1ZUC A;  2VV0 A;  3GD2 A;  2ZXN A;  4WHG A;  5E1C A;  3N00 A;  4PLD A;  4XT9 A;  3WT7 A;  4IA7 A;  2AAX A;  3B1M A;  3O1D A;  2ACL B;  2PRG A;  4S15 A;  5KRJ A;  2I4P A;  4MGB A;  2JFA B;  1S19 A;  5DK9 A;  1T63 A;  1NQ7 A;  5DXG A;  5K13 A;  1NQ1 A;  4OAR A;  3A2I A;  4DOS A;  2Q60 A;  3F5C A;  4JAZ A;  1UHL B;  3ET1 A;  4DMA A;  3AUQ A;  4OKW A;  1ZAF A;  5DUG A;  3OKH A;  3P88 A;  3UVV B;  5KCT A;  4JYG A;  5AZV A;  4OED A;  5DI7 A;  3W0H A;  3FEJ A;  3JZC A;  1ZDU A;  1Y0X X;  3ET3 A;  3IXP A;  5HJP A;  4A2J A;  5L7E A;  2OAX A;  1TFC A;  2P4Y A;  1R5K A;  4KZI A;  4OKX A;  3WWR A;  3VTD A;  3D5F A;  3DY6 A;  1P8D A;  4OJ9 A;  4PLE A;  3B68 A;  5DKB A;  1L2J A;  4ZI1 A;  4LNX A;  1S0X A;  2POG A;  2Q3Y A;  4PP5 A;  3VSP A;  3VTB A;  5DRJ A;  5G44 A;  3CWD A;  4OKT A;  3R8I A;  2AWH A;  2PKL A;  4R2U A;  1YOK A;  2OVH A;  2J7Y A;  1LBD A;  2GPV A;  5DUH A;  2P7Z A;  3GN8 A;  3ADV A;  4OJ4 A;  1XLS A;  3A9E B;  5DWI A;  2HAR A;  4NIE A;  5DYB A;  4MGD A;  4XLD A;  2QZO B;  3DCU A;  1ZH7 A;  2ZNO A;  3ADU A;  3OOF A;  4N1Y A;  5HCV A;  3PLZ A;  5DZ3 A;  4CI4 A;  2QPY A;  5LGA A;  3AZ3 A;  3VT3 A;  2AM9 A;  2XYX A;  4PP3 A;  1GS4 A;  3V49 A;  4PP6 A;  4RUO X;  5KRI A;  3VT9 A;  3OMK A;  4MG8 B;  4RME A;  2G5O A;  4IV4 A;  4XTA A;  5FQS A;  2V7C A;  2R40 D;  4QL8 A;  2GIU A;  3TKC A;  3DZU A;  5KCD A;  1I37 A;  3WMH A;  1DB1 A;  3UUD A;  3FAL B;  5C4U A;  1QKU A;  3CDS A;  4PWL A;  3VT8 A;  1OT7 A;  1YJE A;  3RUU A;  4F9M A;  2QR9 A;  2Q6S A;  1LV2 A;  3RLL A;  5E14 A;  1SJ0 A;  5F9B A;  3K6P A;  3R8D A;  3FC6 A;  5HYK A;  4YNK A;  2AO6 A;  3R5M A;  3W0J A;  3OS8 A;  4PPP A;  4RUP A;  1X78 A;  2AA6 A;  1X7E A;  4WVD A;  2BJ4 A;  4OC7 A;  4PPS A;  1FCX A;  5DX3 B;  4QE8 A;  4XUM A;  5EJV A;  1VJB A;  1XP1 A;  3OGT A;  2ZY0 A;  5APH A;  2G0H A;  5DXQ A;  3U9Q A;  3BC5 A;  5DXK A;  1QKM A;  2ZK0 A;  4MGA B;  2ZMI A;  4OIU A;  1SR7 A;  2QXM A;  4MG7 A;  2B23 A;  2FSZ A;  2Q6R A;  2YAT A;  5KCE A;  5DLR A;  1T76 A;  3ILZ A;  1R20 A;  2P7G A;  5KCW A;  2VV2 A;  4P6W A;  3OSA A;  4Q0A C;  3W0A A;  2R6W A;  5DKG A;  4REF A;  3E7C A;  1YYE A;  3CTB A;  3VJT A;  3KMR A;  4L98 A;  4RAK A;  3G8I A;  3B5R A;  3CS4 A;  4NB6 A;  5G45 A;  2PNU A;  3VJH A;  2G0G A;  3W0C A;  3NSQ A;  2ZK4 A;  4ZO1 X;  1RDT A;  3TY0 A;  3BEJ A;  3V3Q A;  5DSH A;  1ZDT A;  1N46 A;  4G1Y A;  1HG4 A;  1Q4X A;  3F7D A;  3HLV A;  4J24 A;  2QA8 B;  4RZE A;  4ZNU A;  3AN4 A;  3D6D A;  4ITF A;  1M13 A;  4J26 A;  3FLI A;  2ZNP A;  2NW4 A;  3VT7 A;  1YA3 A;  1OSV A;  2PIO A;  3H0A D;  5B41 A;  5JJM A;  1YOW A;  4N8R A;  5DXB A;  2OUZ A;  5B5B A;  4YPQ A;  5DV6 A;  2NPA A;  5KRF A;  4WHF A;  4JYH A;  4R6S A;  4ONI A;  3E00 A;  5DKS A;  1KKQ A;  4MG9 B;  4M8H A;  3W5R A;  1I7I A;  1PQ6 A;  3WTQ A;  1XAP A;  4FHI A;  3GWS X;  4TV1 A;  5DZ1 A;  3O1E A;  2JF9 A;  5KYA A;  2HB8 A;  4XAO A;  1YUC A;  2ZL9 A;  3ADS A;  2NXX E;  2ZVT A;  3KMG A;  1PK5 A;  5DP0 A;  3ET2 A;  2R6Y A;  4DOR A;  5I4V A;  1WM0 X;  3DT3 A;  4PF3 A;  1ERE A;  5L7G A;  2I0J A;  2ZXM A;  3DR1 A;  4RMD A;  1FM6 D;  1M2Z A;  2YLQ A;  4G20 A;  4Q50 A;  5GID A;  5DTV A;  2XHS A;  2Q59 A;  4G2I A;  4REE A;  3VN2 A;  1MVC A;  2VSR A;  4OJB A;  3KDT A;  1ZGY A;  2B1V A;  3NOA A;  2H79 A;  3WJ4 A;  4UDB A;  5AAV A;  5DXP A;  5KR9 A;  4ZN7 A;  3OZJ A;  1NYX A;  5DKE A;  3DZY D;  3VRV A;  4XUH A;  5DVS A;  2ZKC A;  2ZNQ A;  5ACC A;  2PIU A;  2E2R A;  4IA2 A;  3OOK A;  5DUE A;  5DXE A;  2ACL A;  4TUZ B;  3S9S A;  2JFA A;  1YY4 A;  3CDP A;  3G8O A;  5ETH A;  2VV4 B;  4MG5 A;  3AUR A;  3D24 A;  3ERT A;  2O4J A;  1SQN A;  1PZL A;  1T74 A;  1UHL A;  3KWY A;  1R1K D;  3L1B A;  5G5W A;  3UVV A;  5GT4 A;  3HO0 A;  2I4Z A;  1T7F A;  2R40 A;  2AA5 A;  5DIE A;  2B50 A;  2HWQ A;  4G2H A;  5AAU A;  2W8Y A;  1BSX A;  5KYJ A;  4MDD A;  1XV9 A;  1GWX A;  2GL8 A;  3B0R A;  4P6X A;  4QM0 A;  5E7V A;  5DVV A;  3E94 A;  3UU7 B;  1UOM A;  4RFW A;  3ERD A;  3B0Q A;  1ERR A;  2OVM A;  2AMB A;  4QE6 A;  3MNO A;  3F5C B;  4EM9 A;  2HVC A;  1N83 A;  5DRM A;  3PBA A;  2O9I A;  2FVJ A;  3V9Y A;  5DZ0 A;  4LTW A;  4KZJ A;  1PDU A;  1XOW A;  5DWL A;  2PIQ A;  1MZN A;  1XLS E;  1KNU A;  3A78 A;  5DU5 A;  1NRL A;  4O8F A;  1FM9 D;  4IVY A;  1XB7 A;  4UDC A;  3WFF A;  5IZ0 A;  3A9E A;  1ZEO A;  2FAI A;  3V4A A;  3A2H A;  3CS6 A;  1X76 A;  3UUA A;  2QZO A;  1DKF A;  3MNE A;  4WPF A;  1T5Z A;  3VJI A;  3AX8 A;  4J5W C;  2ZBS A;  5C4T A;  3VT6 A;  4IS8 A;  3IPQ A;  4XHD A;  2Q5S A;  2Q1H A;  4OGH A;  3FS1 A;  1NDE A;  4S0T A;  5DV3 A;  4MG8 A;  2VV3 A;  2Q7J A;  1U3S A;  2H77 A;  4RWV A;  3X31 A;  5DY8 A;  5HJS A;  3FUR A;  3FAL A;  5DYD A;  2AX7 A;  3B3K A;  1XNX A;  2P7A A;  3CJW A;  5DVC A;  3WT6 A;  5DXM A;  2AX9 A;  4M8E A;  1IE8 A;  4RZF A;  5DID A;  4ZNS A;  4CI5 A;  1A52 A;  2AX6 A;  4IWF A;  3KYT A;  2OM9 A;  1XDK B;  5KCF A;  4RE8 A;  5E0X A;  5AVL A;  2GP7 A;  5KRM A;  4JYI A;  4POH A;  2Q70 A;  4OH5 A;  5EIT A;  2QTU A;  3IXP D;  1U3Q A;  4S0S A;  2F4B A;  3LBD A;  5DX3 A;  4OIV A;  2LBD A;  2ZXZ A;  4K4J A;  3V9V A;  3A3Z X;  5JI0 D;  5KRK A;  2HC4 A;  3RVF A;  1ILG A;  2XYW A;  1G1U A;  1XP6 A;  2QNV A;  3JZB A;  3AN3 A;  2QGT A;  3KPZ A;  4MGA A;  1ILH A;  5LWP A;  4BCR A;  4KZM A;  4UDD A;  5KRA A;  3B66 A;  4K7A A;  1L2I A;  4CSJ A;  2YJD A;  4POJ A;  4DM8 A;  5KRO A;  4J5X A;  4MGC A;  2IHQ A;  3GZ9 A;  3ZRA A;  4IW6 A;  5HYR A;  1HJ1 A;  3VHU A;  2IOG A;  2PJL A;  2ZMH A;  3P8X A;  5DWE A;  4FGY A;  2O4R A;  4DK7 A;  1G50 A;  4G21 A;  1FM6 A;  2ZAS A;  3ADW A;  3P89 A;  1S0Z A;  1RKH A;  4X1G A;  3OZ0 A;  1FD0 A;  3KDU A;  1S9Q A;  1NHZ A;  3W5Q A;  4L96 A;  3VI8 A;  3RLJ A;  3SP9 A;  3WJ5 A;  3GYT A;  5HZC A;  3HC5 A;  2QH6 A;  4E4Q A;  3DZY A;  1R6G A;  3ZRB A;  2JJ3 A;  4OFU A;  2AB2 A;  3L3X A;  2QMV A;  3M7R A;  3K22 A;  5G3J A;  2AYR A;  2AMA A;  1RK3 A;  1UPV A;  2B1Z A;  2G44 A;  3K8S A;  1T79 A;  2PIR A;  5FQT A;  3WGP A;  5DL4 A;  5KCU A;  3OMO A;  2Q5P A;  5E19 A;  1GWQ A;  3QT0 A;  2HCD A;  2AA2 A;  4ITE A;  4JL4 A;  4IQR A;  5G43 A;  3Q95 B;  2ZK1 A;  4ZO1 B;  1R1K A;  1XQC A;  1OVL A;  4NQA B;  4X1F A;  1RKG A;  5DXR A;  2ATH A;  2J4A A;  4JGV A;  4IA3 A;  3VHW A;  3R5N A;  4DQM A;  1E3K A;  5G46 A;  2VV1 B;  3W5P A;  1XVP B;  1K74 D;  1NAV A;  1NAX A;  3OMQ A;  4OZT E;  2QAB A;  5M96 A;  1U3R A;  2ZLA A;  2HWR A;  3OS9 A;  1I38 A;  4G1Z A;  3VTC A;  2AX8 A;  1X7B A;  4IA1 A;  3H52 A;  5DMC A;  2OCF A;  1I7G A;  1XP9 A;  3IMY A;  1P93 A;  4QJR A;  3KBA A;  5DMF A;  3VRT A;  2I4J A;  2P1T A;  1H9U A;  3W0I A;  3RUT A;  1XIU A;  3L3Z A;  3L0E A;  3OSW A;  1FM9 A;  3T03 A;  2PIP L;  2YHD A;  4NY9 A;  3VRW A;  2ZLC A;  5EHJ A;  4TUZ A;  1QKN A;  3SZ1 A;  2IOK A;  2V0V A;  2Q5G A;  2POB A;  4IV2 A;  1OSH A;  5EGV A;  2VV4 A;  2GWX A;  4ZJR A;  1RDT D;  3FXV A;  3WFG A;  1IE9 A;  5KRC A;  3CLD A;  1EXA A;  3VSO A;  3FEI A;  2Q1V A;  4A4V A;  5AWK A;  3W0Y A;  1T65 A;  3L03 A;  4B7W A;  1YIM A;  4MGB B;  3VJS A;  5AK2 A;  3PRG A;  2YFE A;  2BAW A;  3G9E A;  5EI1 A;  4IU7 A;  4R06 A;  3UP3 A;  3UU7 A;  4LBD A;  3GWX A;  3HC6 A;  4OHA A;  4DM6 A;  1K7L A;  2J14 A;  3BQD A;  5KD9 A;  4OEY A;  1XNN A;  2Q8S A;  3LMP A;  5L11 A;  2Q7I A;  4Q13 A;  3E00 D;  1S9P A;  5APK A;  2Q7L A;  4WQP A;  5HJP B;  4ZNW A; 
#chains in the Genus database with same CATH topology
 3OLF A;  1XQ3 A;  3VT5 A;  4YMQ A;  3ADX A;  5CJ6 A;  2PIN A;  3AZ1 A;  4ZJW A;  4OZT U;  1XV9 B;  4OZR E;  2QE4 A;  4ZNH A;  2Z4B A;  2ABI A;  5KCC A;  2YLP A;  5A86 A;  1KV6 A;  4IVW A;  3NSP A;  3V3E A;  5H1E A;  4ZOM A;  2P15 A;  1QKT A;  3RY9 A;  3OLL A;  3W0G A;  1Z5X E;  4E2J A;  2PIV A;  3OS8 C;  1E3G A;  1NUO A;  3CS8 A;  3HVL A;  2XKW A;  5SYZ A;  3IPU A;  1M7W A;  3TX7 B;  1GWR A;  3GBK A;  3X1I A;  3G0W A;  2HAM A;  3VT4 A;  3EYB A;  1FCY A;  5AVI A;  2ZK3 A;  4MGD B;  1XPC A;  2HB7 A;  3K23 A;  4APU A;  2Q61 A;  4IUI A;  3UUA B;  4E4K A;  5JY3 A;  1FBY A;  1DKF B;  4PVU A;  4QK4 A;  1A28 A;  2QSE A;  1YIN A;  1PQ9 A;  3PEQ A;  2Q6J A;  4OFR A;  4N5G A;  3VRU A;  4WLB A;  4ZNT A;  3OMM A;  2QA6 A;  1XDK A;  2VST A;  3OKI A;  3HZF A;  4A4W A;  2GPU A;  1G5Y A;  4K6I A;  2QW4 A;  3H0A A;  3UUD B;  1PRG A;  1ZKY A;  1XZX X;  2REW A;  3KMZ A;  4YT1 A;  2HBH A;  4J5X C;  3IA6 A;  4UDA A;  1X7R A;  5FQV A;  1T7M A;  3HOD A;  5E15 A;  4IW8 A;  1N4H A;  3B0T A;  2AXA A;  3FC6 B;  4MG6 A;  4OEA A;  2ZFX A;  4ZN9 A;  5IAW A;  4FHH A;  4LNW A;  4OLM A;  5C4S A;  3UUC A;  3ZQT A;  5DZH A;  3OSI A;  4J5W A;  4XI3 A;  3W5T A;  2Q7K A;  4PRG A;  1SKX A;  2J7X A;  5FQP A;  1T7R A;  5DWJ A;  4EMA A;  3D57 A;  5DV8 A;  1NQ0 A;  2BJ4 B;  2P54 A;  3MNP A;  1FCZ A;  3L0J A;  2PIX A;  1Z95 A;  3TKM A;  4OZR U;  4NUF A;  4FN9 A;  1K74 A;  3OMP A;  4N73 A;  2PIT A;  3HM1 A;  4OEZ A;  2EWP A;  1Z5X U;  3HQ5 A;  4MG7 B;  4G1D A;  5APJ A;  3AUN A;  3VHV A;  1EXX A;  3B65 A;  5L7H A;  4S14 A;  2QA8 A;  1PQC A;  2GPO A;  3FUG A;  2YLO A;  2ZNN A;  2I0G A;  3DZU D;  1Y0S A;  1YP0 A;  3PCU A;  3ADT A;  2YLY A;  3GYU A;  5DWG A;  3R2A A;  2Z4J A;  3OLS A;  5AWJ A;  4LSJ A;  3D90 A;  5C4O A;  5G42 A;  3L0L A;  2PIW A;  5KRH A;  1Y9R A;  2QGW A;  3Q95 A;  4MG9 A;  4OKB A;  1X7J A;  1MV9 A;  3WT5 A;  1PCG A;  3KFC A;  2ZK6 A;  4HEE X;  4RZG A;  4Y29 A;  5JJM B;  2XYJ A;  3AZ2 A;  4DK8 A;  5E0W A;  2NV7 A;  5ICK A;  3SP6 A;  5DXB B;  4IWC A;  1UPW A;  2VV1 A;  3B67 A;  1XVP A;  5AZT A;  2ZMJ A;  2HAS A;  2ZK5 A;  5GIE A;  1XJ7 A;  4RUJ A;  3A40 X;  3CQV A;  1T7T A;  3X36 A;  5AYG A;  2A3I A;  2P1V A;  4OIL A;  1G2N A;  2QXS A;  2ZK2 A;  3B0W A;  3ZR7 A;  5DIG A;  2YJA B;  2GTK A;  3IPS A;  1K4W A;  1R20 D;  4OK1 A;  1OVL B;  3A2J A;  2HFP A;  3OAP A;  3P0U A;  5FQR A;  4OH6 A;  4TV1 B;  2P1U A;  5KRL A;  3DCT A;  5DZI A;  3UP0 A;  4HLW A;  2AA7 A;  2GPP A;  3ET0 A;  3PO9 A;  3X1H A;  1RJK A;  5IXK A;  2NXX A;  5EC9 A;  4PXM A;  3AFR A;  3V9T A;  4RMC A;  4ZNV A;  5GIC A;  2OZ7 A;  1TXI A;  1YMT A;  2Q59 B;  3R8A A;  1T73 A;  3R29 A;  5AAV B;  1NQ2 A;  4FNE A;  1U9E A;  1ZUC A;  2VV0 A;  3GD2 A;  2ZXN A;  4WHG A;  5E1C A;  3N00 A;  4PLD A;  4XT9 A;  3WT7 A;  4IA7 A;  2AAX A;  3B1M A;  3O1D A;  2ACL B;  2PRG A;  4S15 A;  5KRJ A;  2I4P A;  4MGB A;  2JFA B;  1S19 A;  5DK9 A;  1T63 A;  1NQ7 A;  5DXG A;  5K13 A;  1NQ1 A;  4OAR A;  3A2I A;  4DOS A;  2Q60 A;  3F5C A;  4JAZ A;  1UHL B;  3ET1 A;  4DMA A;  3AUQ A;  4OKW A;  1ZAF A;  5DUG A;  3OKH A;  3P88 A;  3UVV B;  5KCT A;  4JYG A;  5AZV A;  4OED A;  5DI7 A;  3W0H A;  3FEJ A;  3JZC A;  1ZDU A;  1Y0X X;  3ET3 A;  3IXP A;  5HJP A;  4A2J A;  5L7E A;  2OAX A;  1TFC A;  2P4Y A;  1R5K A;  4KZI A;  4OKX A;  3WWR A;  3VTD A;  3D5F A;  3DY6 A;  1P8D A;  4OJ9 A;  4PLE A;  3B68 A;  5DKB A;  1L2J A;  4ZI1 A;  4LNX A;  1S0X A;  2POG A;  2Q3Y A;  4PP5 A;  3VSP A;  3VTB A;  5DRJ A;  5G44 A;  3CWD A;  4OKT A;  3R8I A;  2AWH A;  2PKL A;  4R2U A;  1YOK A;  2OVH A;  2J7Y A;  1LBD A;  2GPV A;  5DUH A;  2P7Z A;  3GN8 A;  3ADV A;  4OJ4 A;  1XLS A;  3A9E B;  5DWI A;  2HAR A;  4NIE A;  5DYB A;  4MGD A;  4XLD A;  2QZO B;  3DCU A;  1ZH7 A;  2ZNO A;  3ADU A;  3OOF A;  4N1Y A;  5HCV A;  3PLZ A;  5DZ3 A;  4CI4 A;  2QPY A;  5LGA A;  3AZ3 A;  3VT3 A;  2AM9 A;  2XYX A;  4PP3 A;  1GS4 A;  3V49 A;  4PP6 A;  4RUO X;  5KRI A;  3VT9 A;  3OMK A;  4MG8 B;  4RME A;  2G5O A;  4IV4 A;  4XTA A;  5FQS A;  2V7C A;  2R40 D;  4QL8 A;  2GIU A;  3TKC A;  3DZU A;  5KCD A;  1I37 A;  3WMH A;  1DB1 A;  3UUD A;  3FAL B;  5C4U A;  1QKU A;  3CDS A;  4PWL A;  3VT8 A;  1OT7 A;  1YJE A;  3RUU A;  4F9M A;  2QR9 A;  2Q6S A;  1LV2 A;  3RLL A;  5E14 A;  1SJ0 A;  5F9B A;  3K6P A;  3R8D A;  3FC6 A;  5HYK A;  4YNK A;  2AO6 A;  3R5M A;  3W0J A;  3OS8 A;  4PPP A;  4RUP A;  1X78 A;  2AA6 A;  1X7E A;  4WVD A;  2BJ4 A;  4OC7 A;  4PPS A;  1FCX A;  5DX3 B;  4QE8 A;  4XUM A;  5EJV A;  1VJB A;  1XP1 A;  3OGT A;  2ZY0 A;  5APH A;  2G0H A;  5DXQ A;  3U9Q A;  3BC5 A;  5DXK A;  1QKM A;  2ZK0 A;  4MGA B;  2ZMI A;  4OIU A;  1SR7 A;  2QXM A;  4MG7 A;  2B23 A;  2FSZ A;  2Q6R A;  2YAT A;  5KCE A;  5DLR A;  1T76 A;  3ILZ A;  1R20 A;  2P7G A;  5KCW A;  2VV2 A;  4P6W A;  3OSA A;  4Q0A C;  3W0A A;  2R6W A;  5DKG A;  4REF A;  3E7C A;  1YYE A;  3CTB A;  3VJT A;  3KMR A;  4L98 A;  4RAK A;  3G8I A;  3B5R A;  3CS4 A;  4NB6 A;  5G45 A;  2PNU A;  3VJH A;  2G0G A;  3W0C A;  3NSQ A;  2ZK4 A;  4ZO1 X;  1RDT A;  3TY0 A;  3BEJ A;  3V3Q A;  5DSH A;  1ZDT A;  1N46 A;  4G1Y A;  1HG4 A;  1Q4X A;  3F7D A;  3HLV A;  4J24 A;  2QA8 B;  4RZE A;  4ZNU A;  3AN4 A;  3D6D A;  4ITF A;  1M13 A;  4J26 A;  3FLI A;  2ZNP A;  2NW4 A;  3VT7 A;  1YA3 A;  1OSV A;  2PIO A;  3H0A D;  5B41 A;  5JJM A;  1YOW A;  4N8R A;  5DXB A;  2OUZ A;  5B5B A;  4YPQ A;  5DV6 A;  2NPA A;  5KRF A;  4WHF A;  4JYH A;  4R6S A;  4ONI A;  3E00 A;  5DKS A;  1KKQ A;  4MG9 B;  4M8H A;  3W5R A;  1I7I A;  1PQ6 A;  3WTQ A;  1XAP A;  4FHI A;  3GWS X;  4TV1 A;  5DZ1 A;  3O1E A;  2JF9 A;  5KYA A;  2HB8 A;  4XAO A;  1YUC A;  2ZL9 A;  3ADS A;  2NXX E;  2ZVT A;  3KMG A;  1PK5 A;  5DP0 A;  3ET2 A;  2R6Y A;  4DOR A;  5I4V A;  1WM0 X;  3DT3 A;  4PF3 A;  1ERE A;  5L7G A;  2I0J A;  2ZXM A;  3DR1 A;  4RMD A;  1FM6 D;  1M2Z A;  2YLQ A;  4G20 A;  4Q50 A;  5GID A;  5DTV A;  2XHS A;  2Q59 A;  4G2I A;  4REE A;  3VN2 A;  1MVC A;  2VSR A;  4OJB A;  3KDT A;  1ZGY A;  2B1V A;  3NOA A;  2H79 A;  3WJ4 A;  4UDB A;  5AAV A;  5DXP A;  5KR9 A;  4ZN7 A;  3OZJ A;  1NYX A;  5DKE A;  3DZY D;  3VRV A;  4XUH A;  5DVS A;  2ZKC A;  2ZNQ A;  5ACC A;  2PIU A;  2E2R A;  4IA2 A;  3OOK A;  5DUE A;  5DXE A;  2ACL A;  4TUZ B;  3S9S A;  2JFA A;  1YY4 A;  3CDP A;  3G8O A;  5ETH A;  2VV4 B;  4MG5 A;  3AUR A;  3D24 A;  3ERT A;  2O4J A;  1SQN A;  1PZL A;  1T74 A;  1UHL A;  3KWY A;  1R1K D;  3L1B A;  5G5W A;  3UVV A;  5GT4 A;  3HO0 A;  2I4Z A;  1T7F A;  2R40 A;  2AA5 A;  5DIE A;  2B50 A;  2HWQ A;  4G2H A;  5AAU A;  2W8Y A;  1BSX A;  5KYJ A;  4MDD A;  1XV9 A;  1GWX A;  2GL8 A;  3B0R A;  4P6X A;  4QM0 A;  5E7V A;  5DVV A;  3E94 A;  3UU7 B;  1UOM A;  4RFW A;  3ERD A;  3B0Q A;  1ERR A;  2OVM A;  2AMB A;  4QE6 A;  3MNO A;  3F5C B;  4EM9 A;  2HVC A;  1N83 A;  5DRM A;  3PBA A;  2O9I A;  2FVJ A;  3V9Y A;  5DZ0 A;  4LTW A;  4KZJ A;  1PDU A;  1XOW A;  5DWL A;  2PIQ A;  1MZN A;  1XLS E;  1KNU A;  3A78 A;  5DU5 A;  1NRL A;  4O8F A;  1FM9 D;  4IVY A;  1XB7 A;  4UDC A;  3WFF A;  5IZ0 A;  3A9E A;  1ZEO A;  2FAI A;  3V4A A;  3A2H A;  3CS6 A;  1X76 A;  3UUA A;  2QZO A;  1DKF A;  3MNE A;  4WPF A;  1T5Z A;  3VJI A;  3AX8 A;  4J5W C;  2ZBS A;  5C4T A;  3VT6 A;  4IS8 A;  3IPQ A;  4XHD A;  2Q5S A;  2Q1H A;  4OGH A;  3FS1 A;  1NDE A;  4S0T A;  5DV3 A;  4MG8 A;  2VV3 A;  2Q7J A;  1U3S A;  2H77 A;  4RWV A;  3X31 A;  5DY8 A;  5HJS A;  3FUR A;  3FAL A;  5DYD A;  2AX7 A;  3B3K A;  1XNX A;  2P7A A;  3CJW A;  5DVC A;  3WT6 A;  5DXM A;  2AX9 A;  4M8E A;  1IE8 A;  4RZF A;  5DID A;  4ZNS A;  4CI5 A;  1A52 A;  2AX6 A;  4IWF A;  3KYT A;  2OM9 A;  1XDK B;  5KCF A;  4RE8 A;  5E0X A;  5AVL A;  2GP7 A;  5KRM A;  4JYI A;  4POH A;  2Q70 A;  4OH5 A;  5EIT A;  2QTU A;  3IXP D;  1U3Q A;  4S0S A;  2F4B A;  3LBD A;  5DX3 A;  4OIV A;  2LBD A;  2ZXZ A;  4K4J A;  3V9V A;  3A3Z X;  5JI0 D;  5KRK A;  2HC4 A;  3RVF A;  1ILG A;  2XYW A;  1G1U A;  1XP6 A;  2QNV A;  3JZB A;  3AN3 A;  2QGT A;  3KPZ A;  4MGA A;  1ILH A;  5LWP A;  4BCR A;  4KZM A;  4UDD A;  5KRA A;  3B66 A;  4K7A A;  1L2I A;  4CSJ A;  2YJD A;  4POJ A;  4DM8 A;  5KRO A;  4J5X A;  4MGC A;  2IHQ A;  3GZ9 A;  3ZRA A;  4IW6 A;  5HYR A;  1HJ1 A;  3VHU A;  2IOG A;  2PJL A;  2ZMH A;  3P8X A;  5DWE A;  4FGY A;  2O4R A;  4DK7 A;  1G50 A;  4G21 A;  1FM6 A;  2ZAS A;  3ADW A;  3P89 A;  1S0Z A;  1RKH A;  4X1G A;  3OZ0 A;  1FD0 A;  3KDU A;  1S9Q A;  1NHZ A;  3W5Q A;  4L96 A;  3VI8 A;  3RLJ A;  3SP9 A;  3WJ5 A;  3GYT A;  5HZC A;  3HC5 A;  2QH6 A;  4E4Q A;  3DZY A;  1R6G A;  3ZRB A;  2JJ3 A;  4OFU A;  2AB2 A;  3L3X A;  2QMV A;  3M7R A;  3K22 A;  5G3J A;  2AYR A;  2AMA A;  1RK3 A;  1UPV A;  2B1Z A;  2G44 A;  3K8S A;  1T79 A;  2PIR A;  5FQT A;  3WGP A;  5DL4 A;  5KCU A;  3OMO A;  2Q5P A;  5E19 A;  1GWQ A;  3QT0 A;  2HCD A;  2AA2 A;  4ITE A;  4JL4 A;  4IQR A;  5G43 A;  3Q95 B;  2ZK1 A;  4ZO1 B;  1R1K A;  1XQC A;  1OVL A;  4NQA B;  4X1F A;  1RKG A;  5DXR A;  2ATH A;  2J4A A;  4JGV A;  4IA3 A;  3VHW A;  3R5N A;  4DQM A;  1E3K A;  5G46 A;  2VV1 B;  3W5P A;  1XVP B;  1K74 D;  1NAV A;  1NAX A;  3OMQ A;  4OZT E;  2QAB A;  5M96 A;  1U3R A;  2ZLA A;  2HWR A;  3OS9 A;  1I38 A;  4G1Z A;  3VTC A;  2AX8 A;  1X7B A;  4IA1 A;  3H52 A;  5DMC A;  2OCF A;  1I7G A;  1XP9 A;  3IMY A;  1P93 A;  4QJR A;  3KBA A;  5DMF A;  3VRT A;  2I4J A;  2P1T A;  1H9U A;  3W0I A;  3RUT A;  1XIU A;  3L3Z A;  3L0E A;  3OSW A;  1FM9 A;  3T03 A;  2PIP L;  2YHD A;  4NY9 A;  3VRW A;  2ZLC A;  5EHJ A;  4TUZ A;  1QKN A;  3SZ1 A;  2IOK A;  2V0V A;  2Q5G A;  2POB A;  4IV2 A;  1OSH A;  5EGV A;  2VV4 A;  2GWX A;  4ZJR A;  1RDT D;  3FXV A;  3WFG A;  1IE9 A;  5KRC A;  3CLD A;  1EXA A;  3VSO A;  3FEI A;  2Q1V A;  4A4V A;  5AWK A;  3W0Y A;  1T65 A;  3L03 A;  4B7W A;  1YIM A;  4MGB B;  3VJS A;  5AK2 A;  3PRG A;  2YFE A;  2BAW A;  3G9E A;  5EI1 A;  4IU7 A;  4R06 A;  3UP3 A;  3UU7 A;  4LBD A;  3GWX A;  3HC6 A;  4OHA A;  4DM6 A;  1K7L A;  2J14 A;  3BQD A;  5KD9 A;  4OEY A;  1XNN A;  2Q8S A;  3LMP A;  5L11 A;  2Q7I A;  4Q13 A;  3E00 D;  1S9P A;  5APK A;  2Q7L A;  4WQP A;  5HJP B;  4ZNW A; 
#chains in the Genus database with same CATH homology
 3OLF A;  1XQ3 A;  3VT5 A;  4YMQ A;  3ADX A;  5CJ6 A;  2PIN A;  3AZ1 A;  4ZJW A;  4OZT U;  1XV9 B;  4OZR E;  2QE4 A;  4ZNH A;  2Z4B A;  2ABI A;  5KCC A;  2YLP A;  5A86 A;  1KV6 A;  4IVW A;  3NSP A;  3V3E A;  5H1E A;  4ZOM A;  2P15 A;  1QKT A;  3RY9 A;  3OLL A;  3W0G A;  1Z5X E;  4E2J A;  2PIV A;  3OS8 C;  1E3G A;  1NUO A;  3CS8 A;  3HVL A;  2XKW A;  5SYZ A;  3IPU A;  1M7W A;  3TX7 B;  1GWR A;  3GBK A;  3X1I A;  3G0W A;  2HAM A;  3VT4 A;  3EYB A;  1FCY A;  5AVI A;  2ZK3 A;  4MGD B;  1XPC A;  2HB7 A;  3K23 A;  4APU A;  2Q61 A;  4IUI A;  3UUA B;  4E4K A;  5JY3 A;  1FBY A;  1DKF B;  4PVU A;  4QK4 A;  1A28 A;  2QSE A;  1YIN A;  1PQ9 A;  3PEQ A;  2Q6J A;  4OFR A;  4N5G A;  3VRU A;  4WLB A;  4ZNT A;  3OMM A;  2QA6 A;  1XDK A;  2VST A;  3OKI A;  3HZF A;  4A4W A;  2GPU A;  1G5Y A;  4K6I A;  2QW4 A;  3H0A A;  3UUD B;  1PRG A;  1ZKY A;  1XZX X;  2REW A;  3KMZ A;  4YT1 A;  2HBH A;  4J5X C;  3IA6 A;  4UDA A;  1X7R A;  5FQV A;  1T7M A;  3HOD A;  5E15 A;  4IW8 A;  1N4H A;  3B0T A;  2AXA A;  3FC6 B;  4MG6 A;  4OEA A;  2ZFX A;  4ZN9 A;  5IAW A;  4FHH A;  4LNW A;  4OLM A;  5C4S A;  3UUC A;  3ZQT A;  5DZH A;  3OSI A;  4J5W A;  4XI3 A;  3W5T A;  2Q7K A;  4PRG A;  1SKX A;  2J7X A;  5FQP A;  1T7R A;  5DWJ A;  4EMA A;  3D57 A;  5DV8 A;  1NQ0 A;  2BJ4 B;  2P54 A;  3MNP A;  1FCZ A;  3L0J A;  2PIX A;  1Z95 A;  3TKM A;  4OZR U;  4NUF A;  4FN9 A;  1K74 A;  3OMP A;  4N73 A;  2PIT A;  3HM1 A;  4OEZ A;  2EWP A;  1Z5X U;  3HQ5 A;  4MG7 B;  4G1D A;  5APJ A;  3AUN A;  3VHV A;  1EXX A;  3B65 A;  5L7H A;  4S14 A;  2QA8 A;  1PQC A;  2GPO A;  3FUG A;  2YLO A;  2ZNN A;  2I0G A;  3DZU D;  1Y0S A;  1YP0 A;  3PCU A;  3ADT A;  2YLY A;  3GYU A;  5DWG A;  3R2A A;  2Z4J A;  3OLS A;  5AWJ A;  4LSJ A;  3D90 A;  5C4O A;  5G42 A;  3L0L A;  2PIW A;  5KRH A;  1Y9R A;  2QGW A;  3Q95 A;  4MG9 A;  4OKB A;  1X7J A;  1MV9 A;  3WT5 A;  1PCG A;  3KFC A;  2ZK6 A;  4HEE X;  4RZG A;  4Y29 A;  5JJM B;  2XYJ A;  3AZ2 A;  4DK8 A;  5E0W A;  2NV7 A;  5ICK A;  3SP6 A;  5DXB B;  4IWC A;  1UPW A;  2VV1 A;  3B67 A;  1XVP A;  5AZT A;  2ZMJ A;  2HAS A;  2ZK5 A;  5GIE A;  1XJ7 A;  4RUJ A;  3A40 X;  3CQV A;  1T7T A;  3X36 A;  5AYG A;  2A3I A;  2P1V A;  4OIL A;  1G2N A;  2QXS A;  2ZK2 A;  3B0W A;  3ZR7 A;  5DIG A;  2YJA B;  2GTK A;  3IPS A;  1K4W A;  1R20 D;  4OK1 A;  1OVL B;  3A2J A;  2HFP A;  3OAP A;  3P0U A;  5FQR A;  4OH6 A;  4TV1 B;  2P1U A;  5KRL A;  3DCT A;  5DZI A;  3UP0 A;  4HLW A;  2AA7 A;  2GPP A;  3ET0 A;  3PO9 A;  3X1H A;  1RJK A;  5IXK A;  2NXX A;  5EC9 A;  4PXM A;  3AFR A;  3V9T A;  4RMC A;  4ZNV A;  5GIC A;  2OZ7 A;  1TXI A;  1YMT A;  2Q59 B;  3R8A A;  1T73 A;  3R29 A;  5AAV B;  1NQ2 A;  4FNE A;  1U9E A;  1ZUC A;  2VV0 A;  3GD2 A;  2ZXN A;  4WHG A;  5E1C A;  3N00 A;  4PLD A;  4XT9 A;  3WT7 A;  4IA7 A;  2AAX A;  3B1M A;  3O1D A;  2ACL B;  2PRG A;  4S15 A;  5KRJ A;  2I4P A;  4MGB A;  2JFA B;  1S19 A;  5DK9 A;  1T63 A;  1NQ7 A;  5DXG A;  5K13 A;  1NQ1 A;  4OAR A;  3A2I A;  4DOS A;  2Q60 A;  3F5C A;  4JAZ A;  1UHL B;  3ET1 A;  4DMA A;  3AUQ A;  4OKW A;  1ZAF A;  5DUG A;  3OKH A;  3P88 A;  3UVV B;  5KCT A;  4JYG A;  5AZV A;  4OED A;  5DI7 A;  3W0H A;  3FEJ A;  3JZC A;  1ZDU A;  1Y0X X;  3ET3 A;  3IXP A;  5HJP A;  4A2J A;  5L7E A;  2OAX A;  1TFC A;  2P4Y A;  1R5K A;  4KZI A;  4OKX A;  3WWR A;  3VTD A;  3D5F A;  3DY6 A;  1P8D A;  4OJ9 A;  4PLE A;  3B68 A;  5DKB A;  1L2J A;  4ZI1 A;  4LNX A;  1S0X A;  2POG A;  2Q3Y A;  4PP5 A;  3VSP A;  3VTB A;  5DRJ A;  5G44 A;  3CWD A;  4OKT A;  3R8I A;  2AWH A;  2PKL A;  4R2U A;  1YOK A;  2OVH A;  2J7Y A;  1LBD A;  2GPV A;  5DUH A;  2P7Z A;  3GN8 A;  3ADV A;  4OJ4 A;  1XLS A;  3A9E B;  5DWI A;  2HAR A;  4NIE A;  5DYB A;  4MGD A;  4XLD A;  2QZO B;  3DCU A;  1ZH7 A;  2ZNO A;  3ADU A;  3OOF A;  4N1Y A;  5HCV A;  3PLZ A;  5DZ3 A;  4CI4 A;  2QPY A;  5LGA A;  3AZ3 A;  3VT3 A;  2AM9 A;  2XYX A;  4PP3 A;  1GS4 A;  3V49 A;  4PP6 A;  4RUO X;  5KRI A;  3VT9 A;  3OMK A;  4MG8 B;  4RME A;  2G5O A;  4IV4 A;  4XTA A;  5FQS A;  2V7C A;  2R40 D;  4QL8 A;  2GIU A;  3TKC A;  3DZU A;  5KCD A;  1I37 A;  3WMH A;  1DB1 A;  3UUD A;  3FAL B;  5C4U A;  1QKU A;  3CDS A;  4PWL A;  3VT8 A;  1OT7 A;  1YJE A;  3RUU A;  4F9M A;  2QR9 A;  2Q6S A;  1LV2 A;  3RLL A;  5E14 A;  1SJ0 A;  5F9B A;  3K6P A;  3R8D A;  3FC6 A;  5HYK A;  4YNK A;  2AO6 A;  3R5M A;  3W0J A;  3OS8 A;  4PPP A;  4RUP A;  1X78 A;  2AA6 A;  1X7E A;  4WVD A;  2BJ4 A;  4OC7 A;  4PPS A;  1FCX A;  5DX3 B;  4QE8 A;  4XUM A;  5EJV A;  1VJB A;  1XP1 A;  3OGT A;  2ZY0 A;  5APH A;  2G0H A;  5DXQ A;  3U9Q A;  3BC5 A;  5DXK A;  1QKM A;  2ZK0 A;  4MGA B;  2ZMI A;  4OIU A;  1SR7 A;  2QXM A;  4MG7 A;  2B23 A;  2FSZ A;  2Q6R A;  2YAT A;  5KCE A;  5DLR A;  1T76 A;  3ILZ A;  1R20 A;  2P7G A;  5KCW A;  2VV2 A;  4P6W A;  3OSA A;  4Q0A C;  3W0A A;  2R6W A;  5DKG A;  4REF A;  3E7C A;  1YYE A;  3CTB A;  3VJT A;  3KMR A;  4L98 A;  4RAK A;  3G8I A;  3B5R A;  3CS4 A;  4NB6 A;  5G45 A;  2PNU A;  3VJH A;  2G0G A;  3W0C A;  3NSQ A;  2ZK4 A;  4ZO1 X;  1RDT A;  3TY0 A;  3BEJ A;  3V3Q A;  5DSH A;  1ZDT A;  1N46 A;  4G1Y A;  1HG4 A;  1Q4X A;  3F7D A;  3HLV A;  4J24 A;  2QA8 B;  4RZE A;  4ZNU A;  3AN4 A;  3D6D A;  4ITF A;  1M13 A;  4J26 A;  3FLI A;  2ZNP A;  2NW4 A;  3VT7 A;  1YA3 A;  1OSV A;  2PIO A;  3H0A D;  5B41 A;  5JJM A;  1YOW A;  4N8R A;  5DXB A;  2OUZ A;  5B5B A;  4YPQ A;  5DV6 A;  2NPA A;  5KRF A;  4WHF A;  4JYH A;  4R6S A;  4ONI A;  3E00 A;  5DKS A;  1KKQ A;  4MG9 B;  4M8H A;  3W5R A;  1I7I A;  1PQ6 A;  3WTQ A;  1XAP A;  4FHI A;  3GWS X;  4TV1 A;  5DZ1 A;  3O1E A;  2JF9 A;  5KYA A;  2HB8 A;  4XAO A;  1YUC A;  2ZL9 A;  3ADS A;  2NXX E;  2ZVT A;  3KMG A;  1PK5 A;  5DP0 A;  3ET2 A;  2R6Y A;  4DOR A;  5I4V A;  1WM0 X;  3DT3 A;  4PF3 A;  1ERE A;  5L7G A;  2I0J A;  2ZXM A;  3DR1 A;  4RMD A;  1FM6 D;  1M2Z A;  2YLQ A;  4G20 A;  4Q50 A;  5GID A;  5DTV A;  2XHS A;  2Q59 A;  4G2I A;  4REE A;  3VN2 A;  1MVC A;  2VSR A;  4OJB A;  3KDT A;  1ZGY A;  2B1V A;  3NOA A;  2H79 A;  3WJ4 A;  4UDB A;  5AAV A;  5DXP A;  5KR9 A;  4ZN7 A;  3OZJ A;  1NYX A;  5DKE A;  3DZY D;  3VRV A;  4XUH A;  5DVS A;  2ZKC A;  2ZNQ A;  5ACC A;  2PIU A;  2E2R A;  4IA2 A;  3OOK A;  5DUE A;  5DXE A;  2ACL A;  4TUZ B;  3S9S A;  2JFA A;  1YY4 A;  3CDP A;  3G8O A;  5ETH A;  2VV4 B;  4MG5 A;  3AUR A;  3D24 A;  3ERT A;  2O4J A;  1SQN A;  1PZL A;  1T74 A;  1UHL A;  3KWY A;  1R1K D;  3L1B A;  5G5W A;  3UVV A;  5GT4 A;  3HO0 A;  2I4Z A;  1T7F A;  2R40 A;  2AA5 A;  5DIE A;  2B50 A;  2HWQ A;  4G2H A;  5AAU A;  2W8Y A;  1BSX A;  5KYJ A;  4MDD A;  1XV9 A;  1GWX A;  2GL8 A;  3B0R A;  4P6X A;  4QM0 A;  5E7V A;  5DVV A;  3E94 A;  3UU7 B;  1UOM A;  4RFW A;  3ERD A;  3B0Q A;  1ERR A;  2OVM A;  2AMB A;  4QE6 A;  3MNO A;  3F5C B;  4EM9 A;  2HVC A;  1N83 A;  5DRM A;  3PBA A;  2O9I A;  2FVJ A;  3V9Y A;  5DZ0 A;  4LTW A;  4KZJ A;  1PDU A;  1XOW A;  5DWL A;  2PIQ A;  1MZN A;  1XLS E;  1KNU A;  3A78 A;  5DU5 A;  1NRL A;  4O8F A;  1FM9 D;  4IVY A;  1XB7 A;  4UDC A;  3WFF A;  5IZ0 A;  3A9E A;  1ZEO A;  2FAI A;  3V4A A;  3A2H A;  3CS6 A;  1X76 A;  3UUA A;  2QZO A;  1DKF A;  3MNE A;  4WPF A;  1T5Z A;  3VJI A;  3AX8 A;  4J5W C;  2ZBS A;  5C4T A;  3VT6 A;  4IS8 A;  3IPQ A;  4XHD A;  2Q5S A;  2Q1H A;  4OGH A;  3FS1 A;  1NDE A;  4S0T A;  5DV3 A;  4MG8 A;  2VV3 A;  2Q7J A;  1U3S A;  2H77 A;  4RWV A;  3X31 A;  5DY8 A;  5HJS A;  3FUR A;  3FAL A;  5DYD A;  2AX7 A;  3B3K A;  1XNX A;  2P7A A;  3CJW A;  5DVC A;  3WT6 A;  5DXM A;  2AX9 A;  4M8E A;  1IE8 A;  4RZF A;  5DID A;  4ZNS A;  4CI5 A;  1A52 A;  2AX6 A;  4IWF A;  3KYT A;  2OM9 A;  1XDK B;  5KCF A;  4RE8 A;  5E0X A;  5AVL A;  2GP7 A;  5KRM A;  4JYI A;  4POH A;  2Q70 A;  4OH5 A;  5EIT A;  2QTU A;  3IXP D;  1U3Q A;  4S0S A;  2F4B A;  3LBD A;  5DX3 A;  4OIV A;  2LBD A;  2ZXZ A;  4K4J A;  3V9V A;  3A3Z X;  5JI0 D;  5KRK A;  2HC4 A;  3RVF A;  1ILG A;  2XYW A;  1G1U A;  1XP6 A;  2QNV A;  3JZB A;  3AN3 A;  2QGT A;  3KPZ A;  4MGA A;  1ILH A;  5LWP A;  4BCR A;  4KZM A;  4UDD A;  5KRA A;  3B66 A;  4K7A A;  1L2I A;  4CSJ A;  2YJD A;  4POJ A;  4DM8 A;  5KRO A;  4J5X A;  4MGC A;  2IHQ A;  3GZ9 A;  3ZRA A;  4IW6 A;  5HYR A;  1HJ1 A;  3VHU A;  2IOG A;  2PJL A;  2ZMH A;  3P8X A;  5DWE A;  4FGY A;  2O4R A;  4DK7 A;  1G50 A;  4G21 A;  1FM6 A;  2ZAS A;  3ADW A;  3P89 A;  1S0Z A;  1RKH A;  4X1G A;  3OZ0 A;  1FD0 A;  3KDU A;  1S9Q A;  1NHZ A;  3W5Q A;  4L96 A;  3VI8 A;  3RLJ A;  3SP9 A;  3WJ5 A;  3GYT A;  5HZC A;  3HC5 A;  2QH6 A;  4E4Q A;  3DZY A;  1R6G A;  3ZRB A;  2JJ3 A;  4OFU A;  2AB2 A;  3L3X A;  2QMV A;  3M7R A;  3K22 A;  5G3J A;  2AYR A;  2AMA A;  1RK3 A;  1UPV A;  2B1Z A;  2G44 A;  3K8S A;  1T79 A;  2PIR A;  5FQT A;  3WGP A;  5DL4 A;  5KCU A;  3OMO A;  2Q5P A;  5E19 A;  1GWQ A;  3QT0 A;  2HCD A;  2AA2 A;  4ITE A;  4JL4 A;  4IQR A;  5G43 A;  3Q95 B;  2ZK1 A;  4ZO1 B;  1R1K A;  1XQC A;  1OVL A;  4NQA B;  4X1F A;  1RKG A;  5DXR A;  2ATH A;  2J4A A;  4JGV A;  4IA3 A;  3VHW A;  3R5N A;  4DQM A;  1E3K A;  5G46 A;  2VV1 B;  3W5P A;  1XVP B;  1K74 D;  1NAV A;  1NAX A;  3OMQ A;  4OZT E;  2QAB A;  5M96 A;  1U3R A;  2ZLA A;  2HWR A;  3OS9 A;  1I38 A;  4G1Z A;  3VTC A;  2AX8 A;  1X7B A;  4IA1 A;  3H52 A;  5DMC A;  2OCF A;  1I7G A;  1XP9 A;  3IMY A;  1P93 A;  4QJR A;  3KBA A;  5DMF A;  3VRT A;  2I4J A;  2P1T A;  1H9U A;  3W0I A;  3RUT A;  1XIU A;  3L3Z A;  3L0E A;  3OSW A;  1FM9 A;  3T03 A;  2PIP L;  2YHD A;  4NY9 A;  3VRW A;  2ZLC A;  5EHJ A;  4TUZ A;  1QKN A;  3SZ1 A;  2IOK A;  2V0V A;  2Q5G A;  2POB A;  4IV2 A;  1OSH A;  5EGV A;  2VV4 A;  2GWX A;  4ZJR A;  1RDT D;  3FXV A;  3WFG A;  1IE9 A;  5KRC A;  3CLD A;  1EXA A;  3VSO A;  3FEI A;  2Q1V A;  4A4V A;  5AWK A;  3W0Y A;  1T65 A;  3L03 A;  4B7W A;  1YIM A;  4MGB B;  3VJS A;  5AK2 A;  3PRG A;  2YFE A;  2BAW A;  3G9E A;  5EI1 A;  4IU7 A;  4R06 A;  3UP3 A;  3UU7 A;  4LBD A;  3GWX A;  3HC6 A;  4OHA A;  4DM6 A;  1K7L A;  2J14 A;  3BQD A;  5KD9 A;  4OEY A;  1XNN A;  2Q8S A;  3LMP A;  5L11 A;  2Q7I A;  4Q13 A;  3E00 D;  1S9P A;  5APK A;  2Q7L A;  4WQP A;  5HJP B;  4ZNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...