4MG6A

Crystal structure of hera-lbd (y537s) in complex with benzylbutylphtalate
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
244
structure length
233
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLEAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional profiling of environmental ligands for estrogen receptors.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Hormone receptor
source organism Homo sapiens
total genus 86
structure length 233
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4mg6A00
4ZN9A 2QPYA 2ZASA 4OFUA 4PLDA 4ZNWA 2QZOB 3A78A 3K8SA 4Q0AC 3CS8A 3D57A 3UUDA 3WTQA 4OHAA 4E4KA 2HCDA 2NXXA 4OJ4A 4YT1A 2XKWA 4OJBA 3VJHA 3B66A 3G9EA 1YY4A 2PIQA 4J26A 3UUAB 2B1ZA 4NUFA 3RUUA 3CDPA 4Q13A 3W5RA 1LV2A 2Q61A 4RUJA 5H1EA 3AX8A 2OUZA 2POBA 3K22A 3PO9A 4TUZB 2ACLB 2OZ7A 5HYRA 3WT5A 4OZRU 5KYAA 3UUAA 3BQDA 1S0ZA 3TKMA 4MG6A 5DXMA 1RKHA 4HEEX 3KWYA 1I37A 5DK9A 3ADTA 2Q7KA 1R1KD 3ADVA 3KDTA 4R6SA 4TUZA 5DXPA 2AMBA 4DM6A 3NSPA 4G1YA 5G46A 3L0LA 3L3ZA 1YUCA 1T7FA 2OVMA 2PKLA 3IPQA 3FALB 4FGYA 1FCZA 4RZFA 4XHDA 3VT7A 1YMTA 2PIPL 5DZIA 5E15A 1T7RA 3B68A 4MGAB 1YYEA 5L7GA 2QR9A 5DSHA 2YLQA 1QKMA 3VT5A 1RKGA 4XI3A 5KCUA 3P88A 3FURA 3W0HA 2HASA 3L03A 4G1DA 4K4JA 3DZUD 1X7RA 1XVPA 3E00A 3VSOA 3X31A 4MGAA 4IVYA 1XLSE 3UP3A 1E3GA 3IXPD 4X1GA 1S19A 3L0JA 4OZTU 5DKSA 1N46A 4OKBA 1ZAFA 4JL4A 5APHA 4UDAA 3HM1A 3U9QA 3W0AA 2QW4A 3SZ1A 3V9VA 5B41A 5EHJA 3IMYA 1K74A 1NUOA 3OMQA 1YIMA 4PLEA 1XNXA 1XP1A 4J5XA 2PRGA 5G43A 3WWRA 3WGPA 2YJAB 1RDTA 2ZFXA 5L7EA 1MZNA 3FLIA 4UDBA 1FCXA 1SJ0A 4G1ZA 1NQ7A 3AN3A 5LGAA 5KYJA 3H52A 2AYRA 2HB7A 4PPSA 4ITFA 2HWQA 4P6XA 2AB2A 2AX8A 3OZ0A 5E14A 2VV3A 3GD2A 2NV7A 3PEQA 3B0QA 4UDCA 5DXKA 3OSIA 2ZNQA 2Q59B 2ZMJA 3K6PA 3V3EA 1TXIA 3VRWA 4UDDA 1ZKYA 5GT4A 4A4WA 3F5CB 2AA5A 2GPPA 5ICKA 4MGBB 3W0CA 5DXGA 1FM6A 2PIWA 1XB7A 2Q59A 3R29A 4LNWA 4OZTE 4LNXA 4QJRA 4S15A 3FS1A 1T63A 2ZNOA 3B67A 3AZ3A 4MGBA 3UVVB 4N1YA 4POJA 4NY9A 4PF3A 1NQ1A 1UOMA 2ZKCA 3X36A 4MG5A 1T7TA 1EXXA 1X7BA 3VTDA 1ZDTA 2HVCA 2R40A 4PP6A 4OIUA 2AM9A 3HODA 4OGHA 3UVVA 1G2NA 1R20A 2ZK1A 2ZK2A 3DR1A 3AURA 3E00D 1XDKB 3CS6A 5KRLA 3O1DA 2AO6A 3GWSX 4XT9A 4IA3A 5DWGA 3WFFA 4G2IA 2AA6A 4E4QA 3VT6A 3W0IA 2ZXZA 4ZNUA 4QK4A 5DYBA 5JJMB 2Q5GA 3P89A 3OMPA 5JY3A 2H77A 4X1FA 1OSHA 1X7EA 3CWDA 3D90A 3VT3A 4PPPA 2P4YA 1DKFB 3NSQA 2GP7A 3X1IA 4DQMA 2Q1VA 5DVVA 1XOWA 4EM9A 2GPVA 3BEJA 2HC4A 5ETHA 3HO0A 3IPUA 5DVCA 5JJMA 3G8IA 4FHIA 4XUMA 5JI0D 2YLPA 5C4TA 5DYDA 1DKFA 2R6YA 1FM9D 2ZL9A 2PIVA 5DXBB 3ZR7A 1A52A 3HZFA 1MVCA 3IPSA 3WMHA 2QH6A 3AZ1A 5KCDA 5AYGA 4K6IA 3VT8A 4DK7A 1UPWA 5AAUA 5AK2A 4A4VA 5DXBA 5HCVA 3HQ5A 5DWJA 3PLZA 3HLVA 1UPVA 3VJSA 5DKBA 5IXKA 2OVHA 5HJSA 4M8EA 3L1BA 4XAOA 5DV3A 2YJDA 3GYTA 4ZOMA 5F9BA 2QA6A 3F7DA 3ADXA 4OKWA 5KRFA 3D6DA 1M7WA 2JFAA 3ZQTA 1SR7A 5B5BA 3R2AA 2AX7A 4REFA 5E0XA 4OEAA 2VSTA 2P1VA 5KRJA 3VJIA 4IQRA 1R5KA 1U3SA 2PJLA 3MNOA 4TV1A 1RK3A 2H79A 3OS8A 4LBDA 4S0TA 1PCGA 3OSAA 3H0AA 5DX3B 4B7WA 5DUEA 5SYZA 2Q3YA 3EYBA 2Q60A 1S9QA 2QABA 5DV6A 5KCEA 5AZTA 1KV6A 1FCYA 3R5MA 4Q50A 4OIVA 1EREA 2B50A 3DCTA 2VV2A 3DT3A 3D5FA 5DX3A 5FQPA 5L11A 1X78A 3OLLA 2A3IA 3ILZA 4QE6A 3CDSA 3B0WA 3A3ZX 3VT9A 5DV8A 2FAIA 3CJWA 5I4VA 5DRMA 1XVPB 5E19A 3VI8A 5APKA 4OFRA 3GYUA 3OMMA 3AFRA 5G5WA 2XYXA 1YOWA 1RJKA 1Z5XU 5DLRA 2ZMIA 4WQPA 5DRJA 1IE9A 3W0GA 5DUHA 5KRIA 4G21A 3ZRAA 4JYIA 3M7RA 4WHGA 5AWJA 1OT7A 3AUQA 3FUGA 5KRKA 3KMZA 4LSJA 4ZNSA 1T76A 3FEIA 3W5QA 5M96A 1Y9RA 4ZNTA 1U9EA 2ZY0A 5A86A 2HBHA 5CJ6A 4IUIA 2I0JA 4WVDA 5E1CA 1K7LA 2ZXMA 4JGVA 1ZEOA 1N4HA 1XLSA 4RZEA 2Q5PA 5FQTA 1PK5A 1QKTA 1I7IA 1XV9B 2O4JA 1T65A 5KCTA 1VJBA 3S9SA 4J5WC 4YNKA 3WJ5A 4APUA 1XP9A 2G44A 3LMPA 1XV9A 5KRHA 2AX6A 2ZLAA 5ACCA 4ZI1A 2Q6SA 4QE8A 1Z5XE 5KRAA 3ET2A 3UUCA 2J4AA 3R8AA 2R6WA 1ILHA 1XJ7A 1ZGYA 2P54A 2YHDA 1ERRA 2ZK6A 3Q95B 1T5ZA 1OVLA 4DM8A 4NQAB 5HZCA 3K23A 2Q6JA 4KZJA 4ZO1B 4ZNHA 5DWEA 5G3JA 3RLJA 1XQCA 3VTBA 2ZK5A 4IW8A 3OS9A 3Q95A 2VSRA 1T79A 3P0UA 1X7JA 3V9YA 1S0XA 5DMFA 2IOGA 5DI7A 2GTKA 2ZK4A 5AZVA 4PP3A 5EGVA 4XTAA 2AA7A 3CLDA 5EC9A 4OJ9A 1XPCA 3WJ4A 2AMAA 3B5RA 2O4RA 3KBAA 4R2UA 4S0SA 1HJ1A 4IW6A 3VN2A 2VV4A 2Q6RA 3O1EA 1G5YA 5APJA 5GICA 4E2JA 1K74D 5KR9A 3B3KA 4IV2A 4RFWA 4OKTA 1RDTD 3N00A 4NB6A 2LBDA 5DWIA 4XUHA 2P7GA 5DL4A 4MGCA 3MNPA 4RZGA 5DY8A 3CTBA 5KRMA 4R06A 5KD9A 3L0EA 3OKHA 5GIDA 2QNVA 4DOSA 2J7XA 3TKCA 2P7AA 3VSPA 3B1MA 3V9TA 2I4ZA 1A28A 2GIUA 2NW4A 3DZYA 2AA2A 2BJ4B 2HWRA 3OZJA 1R1KA 4WHFA 1FM6D 1P8DA 2BAWA 4ZN7A 2ZNNA 5LWPA 1XQ3A 2JFAB 1EXAA 2G0HA 4N73A 4JYHA 3A40X 1LBDA 4RMEA 3BC5A 2BJ4A 5C4SA 3OAPA 4Y29A 3HC5A 3V3QA 2JF9A 1K4WA 4QM0A 3OOFA 5AVLA 5C4OA 4PP5A 2QXSA 4OKXA 4P6WA 1BSXA 3ET0A 4TV1B 1UHLB 2B1VA 1R6GA 3PBAA 2GWXA 2R40D 3DZUA 4DORA 2Q70A 3HC6A 5EI1A 2EWPA 2GPUA 2NXXE 5DKEA 4JAZA 1R20D 5G44A 4HLWA 4CI4A 1UHLA 3OMKA 5DMCA 3A2IA 1G50A 3IA6A 4MGDB 3JZBA 2G0GA 4IA7A 4DMAA 3WFGA 3KMGA 2ZK3A 1HG4A 1KKQA 1Y0XX 1E3KA 2YLYA 4MGDA 3OLFA 3V49A 5E7VA 1GS4A 3FXVA 3PRGA 5DZ0A 5EITA 5HJPB 4ZJRA 2QGTA 2V7CA 2PINA 4OK1A 3QT0A 4QL8A 2XYWA 4OEDA 2QZOA 4ZNVA 3VJTA 1T73A 3A9EB 4XLDA 2I4JA 1DB1A 3B65A 4G2HA 5DIEA 5DZ3A 5DUGA 3SP6A 5DXQA 3FC6B 5AWKA 3UU7B 4YMQA 2REWA 5HJPA 2E2RA 4L98A 5DU5A 3WT7A 1NRLA 4M8HA 2YFEA 3B0RA 3E94A 3A9EA 4IS8A 2IHQA 3DZYD 1S9PA 3P8XA 3FC6A 3LBDA 3UU7A 2ZK0A 3R8DA 4PWLA 3UP0A 3RUTA 2ACLA 2P1UA 3MNEA 3L3XA 4OC7A 2OAXA 3JZCA 3ZRBA 2OM9A 1Q4XA 1SQNA 1XP6A 1G1UA 1YP0A 3ADWA 3VHWA 1OSVA 4MDDA 3AUNA 5L7HA 3CQVA 4J24A 4DK8A 1T7MA 1ZH7A 5AAVB 2B23A 2OCFA 1YJEA 4J5XC 4IWFA 3ADUA 4FHHA 4IV4A 1GWQA 4OH5A 2AX9A 1ILGA 3G8OA 3X1HA 2P1TA 2AAXA 3R5NA 3VT4A 2Q7LA 3FALA 2Q1HA 1NAVA 2FSZA 1SKXA 2XYJA 3OLSA 1TFCA 4IVWA 1Z95A 2AXAA 3DY6A 5AAVA 1I38A 3V4AA 1ZUCA 1Y0SA 2PITA 1NHZA 5DTVA 4IA2A 1XZXX 2I0GA 5GIEA 5AVIA 1OVLB 4G20A 3H0AD 2ZMHA 3VRUA 4OZRE 3GN8A 2VV1B 2PNUA 1YA3A 4ONIA 3VTCA 4OLMA 4WPFA 2PIUA 4F9MA 5G45A 2ABIA 3ERDA 1M13A 4L96A 2QSEA 2Q7JA 2J7YA 2PIOA 1L2IA 2Q7IA 3DCUA 3KDUA 3KPZA 4IU7A 2FVJA 2YATA 5DZ1A 2HARA 2VV1A 5G42A 1NQ2A 1YOKA 5DIGA 3VHVA 1QKNA 2HAMA 4J5WA 1FM9A 2ATHA 1U3QA 3GWXA 4POHA 3GBKA 5E0WA 3AN4A 3A2JA 4MG8B 2VV0A 3RLLA 4WLBA 1GWXA 1PZLA 5IZ0A 5IAWA 1KNUA 4OEYA 3ADSA 2VV4B 4FN9A 4FNEA 3CS4A 4MG7B 3SP9A 5DXRA 1NDEA 2YLOA 2XHSA 3ET1A 4IA1A 4JYGA 4PXMA 3T03A 3FEJA 1H9UA 3VHUA 4RUOX 4MG8A 2I4PA 1MV9A 4KZIA 2Q5SA 2QXMA 3F5CA 1NYXA 2QMVA 4MG7A 4OILA 2Z4JA 1N83A 1PQ6A 2ZVTA 3ERTA 3W5PA 4RMDA 3KMRA 4RMCA 3TX7B 3KYTA 2QTUA 1GWRA 3AZ2A 1I7GA 2P15A 4N8RA 3GZ9A 5KCWA 3PCUA 4O8FA 1FD0A 2GPOA 3RVFA 4PVUA 1WM0X 1XAPA 4MG9B 2V0VA 3RY9A 4CI5A 4A2JA 4RAKA 4ITEA 3VRTA 1L2JA 2O9IA 4OH6A 3D24A 5DIDA 3B0TA 2ZBSA 1NQ0A 2POGA 1PQ9A 3W5TA 4MG9A 2HFPA 3A2HA 3OKIA 2NPAA 1XDKA 2PIRA 2Q8SA 3E7CA 3OSWA 4S14A 5DKGA 4NIEA 5EJVA 1IE8A 5KCFA 1T74A 3NOAA 3W0YA 3WT6A 5KROA 5DZHA 4N5GA 3OOKA 2AWHA 2HB8A 1NAXA 2PIXA 2QGWA 3TY0A 2ZXNA 2Z4BA 4ZJWA 1M2ZA 4REEA 5DWLA 4PRGA 2ZLCA 3R8IA 4RUPA 3KFCA 3HVLA 1U3RA 4EMAA 2W8YA 4K7AA 5KRCA 2F4BA 2P7ZA 5FQVA 1PRGA 3G0WA 4RE8A 5HYKA 4OARA 5DP0A 5FQRA 1FBYA 2QE4A 1XNNA 2ZNPA 3W0JA 3OMOA 1YINA 4BCRA 4KZMA 2QA8B 3ET3A 3IXPA 3VRVA 1PDUA 5C4UA 2GL8A 1QKUA 5DXEA 1P93A 1X76A 2J14A 3UUDB 4CSJA 4YPQA 5K13A 1XIUA 3OS8C 4OEZA 3OGTA 4ZO1X 1PQCA 1ZDUA 2JJ3A 5FQSA 5KCCA 2G5OA 5DVSA 4LTWA 4RWVA 4IWCA 2IOKA 2QA8A
chains in the Genus database with same CATH superfamily
4ZN9A 2QPYA 2ZASA 4OFUA 4PLDA 4ZNWA 2QZOB 3A78A 3K8SA 4Q0AC 3CS8A 3D57A 3UUDA 3WTQA 4OHAA 4E4KA 2HCDA 2NXXA 4OJ4A 4YT1A 2XKWA 4OJBA 3VJHA 3B66A 3G9EA 1YY4A 2PIQA 4J26A 3UUAB 2B1ZA 4NUFA 3RUUA 3CDPA 4Q13A 3W5RA 1LV2A 2Q61A 4RUJA 5H1EA 3AX8A 2OUZA 2POBA 3K22A 3PO9A 4TUZB 2ACLB 2OZ7A 5HYRA 3WT5A 4OZRU 5KYAA 3UUAA 3BQDA 1S0ZA 3TKMA 4MG6A 5DXMA 1RKHA 4HEEX 3KWYA 1I37A 5DK9A 3ADTA 2Q7KA 1R1KD 3ADVA 3KDTA 4R6SA 4TUZA 5DXPA 2AMBA 4DM6A 3NSPA 4G1YA 5G46A 3L0LA 3L3ZA 1YUCA 1T7FA 2OVMA 2PKLA 3IPQA 3FALB 4FGYA 1FCZA 4RZFA 4XHDA 3VT7A 1YMTA 2PIPL 5DZIA 5E15A 1T7RA 3B68A 4MGAB 1YYEA 5L7GA 2QR9A 5DSHA 2YLQA 1QKMA 3VT5A 1RKGA 4XI3A 5KCUA 3P88A 3FURA 3W0HA 2HASA 3L03A 4G1DA 4K4JA 3DZUD 1X7RA 1XVPA 3E00A 3VSOA 3X31A 4MGAA 4IVYA 1XLSE 3UP3A 1E3GA 3IXPD 4X1GA 1S19A 3L0JA 4OZTU 5DKSA 1N46A 4OKBA 1ZAFA 4JL4A 5APHA 4UDAA 3HM1A 3U9QA 3W0AA 2QW4A 3SZ1A 3V9VA 5B41A 5EHJA 3IMYA 1K74A 1NUOA 3OMQA 1YIMA 4PLEA 1XNXA 1XP1A 4J5XA 2PRGA 5G43A 3WWRA 3WGPA 2YJAB 1RDTA 2ZFXA 5L7EA 1MZNA 3FLIA 4UDBA 1FCXA 1SJ0A 4G1ZA 1NQ7A 3AN3A 5LGAA 5KYJA 3H52A 2AYRA 2HB7A 4PPSA 4ITFA 2HWQA 4P6XA 2AB2A 2AX8A 3OZ0A 5E14A 2VV3A 3GD2A 2NV7A 3PEQA 3B0QA 4UDCA 5DXKA 3OSIA 2ZNQA 2Q59B 2ZMJA 3K6PA 3V3EA 1TXIA 3VRWA 4UDDA 1ZKYA 5GT4A 4A4WA 3F5CB 2AA5A 2GPPA 5ICKA 4MGBB 3W0CA 5DXGA 1FM6A 2PIWA 1XB7A 2Q59A 3R29A 4LNWA 4OZTE 4LNXA 4QJRA 4S15A 3FS1A 1T63A 2ZNOA 3B67A 3AZ3A 4MGBA 3UVVB 4N1YA 4POJA 4NY9A 4PF3A 1NQ1A 1UOMA 2ZKCA 3X36A 4MG5A 1T7TA 1EXXA 1X7BA 3VTDA 1ZDTA 2HVCA 2R40A 4PP6A 4OIUA 2AM9A 3HODA 4OGHA 3UVVA 1G2NA 1R20A 2ZK1A 2ZK2A 3DR1A 3AURA 3E00D 1XDKB 3CS6A 5KRLA 3O1DA 2AO6A 3GWSX 4XT9A 4IA3A 5DWGA 3WFFA 4G2IA 2AA6A 4E4QA 3VT6A 3W0IA 2ZXZA 4ZNUA 4QK4A 5DYBA 5JJMB 2Q5GA 3P89A 3OMPA 5JY3A 2H77A 4X1FA 1OSHA 1X7EA 3CWDA 3D90A 3VT3A 4PPPA 2P4YA 1DKFB 3NSQA 2GP7A 3X1IA 4DQMA 2Q1VA 5DVVA 1XOWA 4EM9A 2GPVA 3BEJA 2HC4A 5ETHA 3HO0A 3IPUA 5DVCA 5JJMA 3G8IA 4FHIA 4XUMA 5JI0D 2YLPA 5C4TA 5DYDA 1DKFA 2R6YA 1FM9D 2ZL9A 2PIVA 5DXBB 3ZR7A 1A52A 3HZFA 1MVCA 3IPSA 3WMHA 2QH6A 3AZ1A 5KCDA 5AYGA 4K6IA 3VT8A 4DK7A 1UPWA 5AAUA 5AK2A 4A4VA 5DXBA 5HCVA 3HQ5A 5DWJA 3PLZA 3HLVA 1UPVA 3VJSA 5DKBA 5IXKA 2OVHA 5HJSA 4M8EA 3L1BA 4XAOA 5DV3A 2YJDA 3GYTA 4ZOMA 5F9BA 2QA6A 3F7DA 3ADXA 4OKWA 5KRFA 3D6DA 1M7WA 2JFAA 3ZQTA 1SR7A 5B5BA 3R2AA 2AX7A 4REFA 5E0XA 4OEAA 2VSTA 2P1VA 5KRJA 3VJIA 4IQRA 1R5KA 1U3SA 2PJLA 3MNOA 4TV1A 1RK3A 2H79A 3OS8A 4LBDA 4S0TA 1PCGA 3OSAA 3H0AA 5DX3B 4B7WA 5DUEA 5SYZA 2Q3YA 3EYBA 2Q60A 1S9QA 2QABA 5DV6A 5KCEA 5AZTA 1KV6A 1FCYA 3R5MA 4Q50A 4OIVA 1EREA 2B50A 3DCTA 2VV2A 3DT3A 3D5FA 5DX3A 5FQPA 5L11A 1X78A 3OLLA 2A3IA 3ILZA 4QE6A 3CDSA 3B0WA 3A3ZX 3VT9A 5DV8A 2FAIA 3CJWA 5I4VA 5DRMA 1XVPB 5E19A 3VI8A 5APKA 4OFRA 3GYUA 3OMMA 3AFRA 5G5WA 2XYXA 1YOWA 1RJKA 1Z5XU 5DLRA 2ZMIA 4WQPA 5DRJA 1IE9A 3W0GA 5DUHA 5KRIA 4G21A 3ZRAA 4JYIA 3M7RA 4WHGA 5AWJA 1OT7A 3AUQA 3FUGA 5KRKA 3KMZA 4LSJA 4ZNSA 1T76A 3FEIA 3W5QA 5M96A 1Y9RA 4ZNTA 1U9EA 2ZY0A 5A86A 2HBHA 5CJ6A 4IUIA 2I0JA 4WVDA 5E1CA 1K7LA 2ZXMA 4JGVA 1ZEOA 1N4HA 1XLSA 4RZEA 2Q5PA 5FQTA 1PK5A 1QKTA 1I7IA 1XV9B 2O4JA 1T65A 5KCTA 1VJBA 3S9SA 4J5WC 4YNKA 3WJ5A 4APUA 1XP9A 2G44A 3LMPA 1XV9A 5KRHA 2AX6A 2ZLAA 5ACCA 4ZI1A 2Q6SA 4QE8A 1Z5XE 5KRAA 3ET2A 3UUCA 2J4AA 3R8AA 2R6WA 1ILHA 1XJ7A 1ZGYA 2P54A 2YHDA 1ERRA 2ZK6A 3Q95B 1T5ZA 1OVLA 4DM8A 4NQAB 5HZCA 3K23A 2Q6JA 4KZJA 4ZO1B 4ZNHA 5DWEA 5G3JA 3RLJA 1XQCA 3VTBA 2ZK5A 4IW8A 3OS9A 3Q95A 2VSRA 1T79A 3P0UA 1X7JA 3V9YA 1S0XA 5DMFA 2IOGA 5DI7A 2GTKA 2ZK4A 5AZVA 4PP3A 5EGVA 4XTAA 2AA7A 3CLDA 5EC9A 4OJ9A 1XPCA 3WJ4A 2AMAA 3B5RA 2O4RA 3KBAA 4R2UA 4S0SA 1HJ1A 4IW6A 3VN2A 2VV4A 2Q6RA 3O1EA 1G5YA 5APJA 5GICA 4E2JA 1K74D 5KR9A 3B3KA 4IV2A 4RFWA 4OKTA 1RDTD 3N00A 4NB6A 2LBDA 5DWIA 4XUHA 2P7GA 5DL4A 4MGCA 3MNPA 4RZGA 5DY8A 3CTBA 5KRMA 4R06A 5KD9A 3L0EA 3OKHA 5GIDA 2QNVA 4DOSA 2J7XA 3TKCA 2P7AA 3VSPA 3B1MA 3V9TA 2I4ZA 1A28A 2GIUA 2NW4A 3DZYA 2AA2A 2BJ4B 2HWRA 3OZJA 1R1KA 4WHFA 1FM6D 1P8DA 2BAWA 4ZN7A 2ZNNA 5LWPA 1XQ3A 2JFAB 1EXAA 2G0HA 4N73A 4JYHA 3A40X 1LBDA 4RMEA 3BC5A 2BJ4A 5C4SA 3OAPA 4Y29A 3HC5A 3V3QA 2JF9A 1K4WA 4QM0A 3OOFA 5AVLA 5C4OA 4PP5A 2QXSA 4OKXA 4P6WA 1BSXA 3ET0A 4TV1B 1UHLB 2B1VA 1R6GA 3PBAA 2GWXA 2R40D 3DZUA 4DORA 2Q70A 3HC6A 5EI1A 2EWPA 2GPUA 2NXXE 5DKEA 4JAZA 1R20D 5G44A 4HLWA 4CI4A 1UHLA 3OMKA 5DMCA 3A2IA 1G50A 3IA6A 4MGDB 3JZBA 2G0GA 4IA7A 4DMAA 3WFGA 3KMGA 2ZK3A 1HG4A 1KKQA 1Y0XX 1E3KA 2YLYA 4MGDA 3OLFA 3V49A 5E7VA 1GS4A 3FXVA 3PRGA 5DZ0A 5EITA 5HJPB 4ZJRA 2QGTA 2V7CA 2PINA 4OK1A 3QT0A 4QL8A 2XYWA 4OEDA 2QZOA 4ZNVA 3VJTA 1T73A 3A9EB 4XLDA 2I4JA 1DB1A 3B65A 4G2HA 5DIEA 5DZ3A 5DUGA 3SP6A 5DXQA 3FC6B 5AWKA 3UU7B 4YMQA 2REWA 5HJPA 2E2RA 4L98A 5DU5A 3WT7A 1NRLA 4M8HA 2YFEA 3B0RA 3E94A 3A9EA 4IS8A 2IHQA 3DZYD 1S9PA 3P8XA 3FC6A 3LBDA 3UU7A 2ZK0A 3R8DA 4PWLA 3UP0A 3RUTA 2ACLA 2P1UA 3MNEA 3L3XA 4OC7A 2OAXA 3JZCA 3ZRBA 2OM9A 1Q4XA 1SQNA 1XP6A 1G1UA 1YP0A 3ADWA 3VHWA 1OSVA 4MDDA 3AUNA 5L7HA 3CQVA 4J24A 4DK8A 1T7MA 1ZH7A 5AAVB 2B23A 2OCFA 1YJEA 4J5XC 4IWFA 3ADUA 4FHHA 4IV4A 1GWQA 4OH5A 2AX9A 1ILGA 3G8OA 3X1HA 2P1TA 2AAXA 3R5NA 3VT4A 2Q7LA 3FALA 2Q1HA 1NAVA 2FSZA 1SKXA 2XYJA 3OLSA 1TFCA 4IVWA 1Z95A 2AXAA 3DY6A 5AAVA 1I38A 3V4AA 1ZUCA 1Y0SA 2PITA 1NHZA 5DTVA 4IA2A 1XZXX 2I0GA 5GIEA 5AVIA 1OVLB 4G20A 3H0AD 2ZMHA 3VRUA 4OZRE 3GN8A 2VV1B 2PNUA 1YA3A 4ONIA 3VTCA 4OLMA 4WPFA 2PIUA 4F9MA 5G45A 2ABIA 3ERDA 1M13A 4L96A 2QSEA 2Q7JA 2J7YA 2PIOA 1L2IA 2Q7IA 3DCUA 3KDUA 3KPZA 4IU7A 2FVJA 2YATA 5DZ1A 2HARA 2VV1A 5G42A 1NQ2A 1YOKA 5DIGA 3VHVA 1QKNA 2HAMA 4J5WA 1FM9A 2ATHA 1U3QA 3GWXA 4POHA 3GBKA 5E0WA 3AN4A 3A2JA 4MG8B 2VV0A 3RLLA 4WLBA 1GWXA 1PZLA 5IZ0A 5IAWA 1KNUA 4OEYA 3ADSA 2VV4B 4FN9A 4FNEA 3CS4A 4MG7B 3SP9A 5DXRA 1NDEA 2YLOA 2XHSA 3ET1A 4IA1A 4JYGA 4PXMA 3T03A 3FEJA 1H9UA 3VHUA 4RUOX 4MG8A 2I4PA 1MV9A 4KZIA 2Q5SA 2QXMA 3F5CA 1NYXA 2QMVA 4MG7A 4OILA 2Z4JA 1N83A 1PQ6A 2ZVTA 3ERTA 3W5PA 4RMDA 3KMRA 4RMCA 3TX7B 3KYTA 2QTUA 1GWRA 3AZ2A 1I7GA 2P15A 4N8RA 3GZ9A 5KCWA 3PCUA 4O8FA 1FD0A 2GPOA 3RVFA 4PVUA 1WM0X 1XAPA 4MG9B 2V0VA 3RY9A 4CI5A 4A2JA 4RAKA 4ITEA 3VRTA 1L2JA 2O9IA 4OH6A 3D24A 5DIDA 3B0TA 2ZBSA 1NQ0A 2POGA 1PQ9A 3W5TA 4MG9A 2HFPA 3A2HA 3OKIA 2NPAA 1XDKA 2PIRA 2Q8SA 3E7CA 3OSWA 4S14A 5DKGA 4NIEA 5EJVA 1IE8A 5KCFA 1T74A 3NOAA 3W0YA 3WT6A 5KROA 5DZHA 4N5GA 3OOKA 2AWHA 2HB8A 1NAXA 2PIXA 2QGWA 3TY0A 2ZXNA 2Z4BA 4ZJWA 1M2ZA 4REEA 5DWLA 4PRGA 2ZLCA 3R8IA 4RUPA 3KFCA 3HVLA 1U3RA 4EMAA 2W8YA 4K7AA 5KRCA 2F4BA 2P7ZA 5FQVA 1PRGA 3G0WA 4RE8A 5HYKA 4OARA 5DP0A 5FQRA 1FBYA 2QE4A 1XNNA 2ZNPA 3W0JA 3OMOA 1YINA 4BCRA 4KZMA 2QA8B 3ET3A 3IXPA 3VRVA 1PDUA 5C4UA 2GL8A 1QKUA 5DXEA 1P93A 1X76A 2J14A 3UUDB 4CSJA 4YPQA 5K13A 1XIUA 3OS8C 4OEZA 3OGTA 4ZO1X 1PQCA 1ZDUA 2JJ3A 5FQSA 5KCCA 2G5OA 5DVSA 4LTWA 4RWVA 4IWCA 2IOKA 2QA8A
chains in the Genus database with same CATH topology
4ZN9A 2QPYA 2ZASA 4OFUA 4PLDA 4ZNWA 2QZOB 3A78A 3K8SA 4Q0AC 3CS8A 3D57A 3UUDA 3WTQA 4OHAA 4E4KA 2HCDA 2NXXA 4OJ4A 4YT1A 2XKWA 4OJBA 3VJHA 3B66A 3G9EA 1YY4A 2PIQA 4J26A 3UUAB 2B1ZA 4NUFA 3RUUA 3CDPA 4Q13A 3W5RA 1LV2A 2Q61A 4RUJA 5H1EA 3AX8A 2OUZA 2POBA 3K22A 3PO9A 4TUZB 2ACLB 2OZ7A 5HYRA 3WT5A 4OZRU 5KYAA 3UUAA 3BQDA 1S0ZA 3TKMA 4MG6A 5DXMA 1RKHA 4HEEX 3KWYA 1I37A 5DK9A 3ADTA 2Q7KA 1R1KD 3ADVA 3KDTA 4R6SA 4TUZA 5DXPA 2AMBA 4DM6A 3NSPA 4G1YA 5G46A 3L0LA 3L3ZA 1YUCA 1T7FA 2OVMA 2PKLA 3IPQA 3FALB 4FGYA 1FCZA 4RZFA 4XHDA 3VT7A 1YMTA 2PIPL 5DZIA 5E15A 1T7RA 3B68A 4MGAB 1YYEA 5L7GA 2QR9A 5DSHA 2YLQA 1QKMA 3VT5A 1RKGA 4XI3A 5KCUA 3P88A 3FURA 3W0HA 2HASA 3L03A 4G1DA 4K4JA 3DZUD 1X7RA 1XVPA 3E00A 3VSOA 3X31A 4MGAA 4IVYA 1XLSE 3UP3A 1E3GA 3IXPD 4X1GA 1S19A 3L0JA 4OZTU 5DKSA 1N46A 4OKBA 1ZAFA 4JL4A 5APHA 4UDAA 3HM1A 3U9QA 3W0AA 2QW4A 3SZ1A 3V9VA 5B41A 5EHJA 3IMYA 1K74A 1NUOA 3OMQA 1YIMA 4PLEA 1XNXA 1XP1A 4J5XA 2PRGA 5G43A 3WWRA 3WGPA 2YJAB 1RDTA 2ZFXA 5L7EA 1MZNA 3FLIA 4UDBA 1FCXA 1SJ0A 4G1ZA 1NQ7A 3AN3A 5LGAA 5KYJA 3H52A 2AYRA 2HB7A 4PPSA 4ITFA 2HWQA 4P6XA 2AB2A 2AX8A 3OZ0A 5E14A 2VV3A 3GD2A 2NV7A 3PEQA 3B0QA 4UDCA 5DXKA 3OSIA 2ZNQA 2Q59B 2ZMJA 3K6PA 3V3EA 1TXIA 3VRWA 4UDDA 1ZKYA 5GT4A 4A4WA 3F5CB 2AA5A 2GPPA 5ICKA 4MGBB 3W0CA 5DXGA 1FM6A 2PIWA 1XB7A 2Q59A 3R29A 4LNWA 4OZTE 4LNXA 4QJRA 4S15A 3FS1A 1T63A 2ZNOA 3B67A 3AZ3A 4MGBA 3UVVB 4N1YA 4POJA 4NY9A 4PF3A 1NQ1A 1UOMA 2ZKCA 3X36A 4MG5A 1T7TA 1EXXA 1X7BA 3VTDA 1ZDTA 2HVCA 2R40A 4PP6A 4OIUA 2AM9A 3HODA 4OGHA 3UVVA 1G2NA 1R20A 2ZK1A 2ZK2A 3DR1A 3AURA 3E00D 1XDKB 3CS6A 5KRLA 3O1DA 2AO6A 3GWSX 4XT9A 4IA3A 5DWGA 3WFFA 4G2IA 2AA6A 4E4QA 3VT6A 3W0IA 2ZXZA 4ZNUA 4QK4A 5DYBA 5JJMB 2Q5GA 3P89A 3OMPA 5JY3A 2H77A 4X1FA 1OSHA 1X7EA 3CWDA 3D90A 3VT3A 4PPPA 2P4YA 1DKFB 3NSQA 2GP7A 3X1IA 4DQMA 2Q1VA 5DVVA 1XOWA 4EM9A 2GPVA 3BEJA 2HC4A 5ETHA 3HO0A 3IPUA 5DVCA 5JJMA 3G8IA 4FHIA 4XUMA 5JI0D 2YLPA 5C4TA 5DYDA 1DKFA 2R6YA 1FM9D 2ZL9A 2PIVA 5DXBB 3ZR7A 1A52A 3HZFA 1MVCA 3IPSA 3WMHA 2QH6A 3AZ1A 5KCDA 5AYGA 4K6IA 3VT8A 4DK7A 1UPWA 5AAUA 5AK2A 4A4VA 5DXBA 5HCVA 3HQ5A 5DWJA 3PLZA 3HLVA 1UPVA 3VJSA 5DKBA 5IXKA 2OVHA 5HJSA 4M8EA 3L1BA 4XAOA 5DV3A 2YJDA 3GYTA 4ZOMA 5F9BA 2QA6A 3F7DA 3ADXA 4OKWA 5KRFA 3D6DA 1M7WA 2JFAA 3ZQTA 1SR7A 5B5BA 3R2AA 2AX7A 4REFA 5E0XA 4OEAA 2VSTA 2P1VA 5KRJA 3VJIA 4IQRA 1R5KA 1U3SA 2PJLA 3MNOA 4TV1A 1RK3A 2H79A 3OS8A 4LBDA 4S0TA 1PCGA 3OSAA 3H0AA 5DX3B 4B7WA 5DUEA 5SYZA 2Q3YA 3EYBA 2Q60A 1S9QA 2QABA 5DV6A 5KCEA 5AZTA 1KV6A 1FCYA 3R5MA 4Q50A 4OIVA 1EREA 2B50A 3DCTA 2VV2A 3DT3A 3D5FA 5DX3A 5FQPA 5L11A 1X78A 3OLLA 2A3IA 3ILZA 4QE6A 3CDSA 3B0WA 3A3ZX 3VT9A 5DV8A 2FAIA 3CJWA 5I4VA 5DRMA 1XVPB 5E19A 3VI8A 5APKA 4OFRA 3GYUA 3OMMA 3AFRA 5G5WA 2XYXA 1YOWA 1RJKA 1Z5XU 5DLRA 2ZMIA 4WQPA 5DRJA 1IE9A 3W0GA 5DUHA 5KRIA 4G21A 3ZRAA 4JYIA 3M7RA 4WHGA 5AWJA 1OT7A 3AUQA 3FUGA 5KRKA 3KMZA 4LSJA 4ZNSA 1T76A 3FEIA 3W5QA 5M96A 1Y9RA 4ZNTA 1U9EA 2ZY0A 5A86A 2HBHA 5CJ6A 4IUIA 2I0JA 4WVDA 5E1CA 1K7LA 2ZXMA 4JGVA 1ZEOA 1N4HA 1XLSA 4RZEA 2Q5PA 5FQTA 1PK5A 1QKTA 1I7IA 1XV9B 2O4JA 1T65A 5KCTA 1VJBA 3S9SA 4J5WC 4YNKA 3WJ5A 4APUA 1XP9A 2G44A 3LMPA 1XV9A 5KRHA 2AX6A 2ZLAA 5ACCA 4ZI1A 2Q6SA 4QE8A 1Z5XE 5KRAA 3ET2A 3UUCA 2J4AA 3R8AA 2R6WA 1ILHA 1XJ7A 1ZGYA 2P54A 2YHDA 1ERRA 2ZK6A 3Q95B 1T5ZA 1OVLA 4DM8A 4NQAB 5HZCA 3K23A 2Q6JA 4KZJA 4ZO1B 4ZNHA 5DWEA 5G3JA 3RLJA 1XQCA 3VTBA 2ZK5A 4IW8A 3OS9A 3Q95A 2VSRA 1T79A 3P0UA 1X7JA 3V9YA 1S0XA 5DMFA 2IOGA 5DI7A 2GTKA 2ZK4A 5AZVA 4PP3A 5EGVA 4XTAA 2AA7A 3CLDA 5EC9A 4OJ9A 1XPCA 3WJ4A 2AMAA 3B5RA 2O4RA 3KBAA 4R2UA 4S0SA 1HJ1A 4IW6A 3VN2A 2VV4A 2Q6RA 3O1EA 1G5YA 5APJA 5GICA 4E2JA 1K74D 5KR9A 3B3KA 4IV2A 4RFWA 4OKTA 1RDTD 3N00A 4NB6A 2LBDA 5DWIA 4XUHA 2P7GA 5DL4A 4MGCA 3MNPA 4RZGA 5DY8A 3CTBA 5KRMA 4R06A 5KD9A 3L0EA 3OKHA 5GIDA 2QNVA 4DOSA 2J7XA 3TKCA 2P7AA 3VSPA 3B1MA 3V9TA 2I4ZA 1A28A 2GIUA 2NW4A 3DZYA 2AA2A 2BJ4B 2HWRA 3OZJA 1R1KA 4WHFA 1FM6D 1P8DA 2BAWA 4ZN7A 2ZNNA 5LWPA 1XQ3A 2JFAB 1EXAA 2G0HA 4N73A 4JYHA 3A40X 1LBDA 4RMEA 3BC5A 2BJ4A 5C4SA 3OAPA 4Y29A 3HC5A 3V3QA 2JF9A 1K4WA 4QM0A 3OOFA 5AVLA 5C4OA 4PP5A 2QXSA 4OKXA 4P6WA 1BSXA 3ET0A 4TV1B 1UHLB 2B1VA 1R6GA 3PBAA 2GWXA 2R40D 3DZUA 4DORA 2Q70A 3HC6A 5EI1A 2EWPA 2GPUA 2NXXE 5DKEA 4JAZA 1R20D 5G44A 4HLWA 4CI4A 1UHLA 3OMKA 5DMCA 3A2IA 1G50A 3IA6A 4MGDB 3JZBA 2G0GA 4IA7A 4DMAA 3WFGA 3KMGA 2ZK3A 1HG4A 1KKQA 1Y0XX 1E3KA 2YLYA 4MGDA 3OLFA 3V49A 5E7VA 1GS4A 3FXVA 3PRGA 5DZ0A 5EITA 5HJPB 4ZJRA 2QGTA 2V7CA 2PINA 4OK1A 3QT0A 4QL8A 2XYWA 4OEDA 2QZOA 4ZNVA 3VJTA 1T73A 3A9EB 4XLDA 2I4JA 1DB1A 3B65A 4G2HA 5DIEA 5DZ3A 5DUGA 3SP6A 5DXQA 3FC6B 5AWKA 3UU7B 4YMQA 2REWA 5HJPA 2E2RA 4L98A 5DU5A 3WT7A 1NRLA 4M8HA 2YFEA 3B0RA 3E94A 3A9EA 4IS8A 2IHQA 3DZYD 1S9PA 3P8XA 3FC6A 3LBDA 3UU7A 2ZK0A 3R8DA 4PWLA 3UP0A 3RUTA 2ACLA 2P1UA 3MNEA 3L3XA 4OC7A 2OAXA 3JZCA 3ZRBA 2OM9A 1Q4XA 1SQNA 1XP6A 1G1UA 1YP0A 3ADWA 3VHWA 1OSVA 4MDDA 3AUNA 5L7HA 3CQVA 4J24A 4DK8A 1T7MA 1ZH7A 5AAVB 2B23A 2OCFA 1YJEA 4J5XC 4IWFA 3ADUA 4FHHA 4IV4A 1GWQA 4OH5A 2AX9A 1ILGA 3G8OA 3X1HA 2P1TA 2AAXA 3R5NA 3VT4A 2Q7LA 3FALA 2Q1HA 1NAVA 2FSZA 1SKXA 2XYJA 3OLSA 1TFCA 4IVWA 1Z95A 2AXAA 3DY6A 5AAVA 1I38A 3V4AA 1ZUCA 1Y0SA 2PITA 1NHZA 5DTVA 4IA2A 1XZXX 2I0GA 5GIEA 5AVIA 1OVLB 4G20A 3H0AD 2ZMHA 3VRUA 4OZRE 3GN8A 2VV1B 2PNUA 1YA3A 4ONIA 3VTCA 4OLMA 4WPFA 2PIUA 4F9MA 5G45A 2ABIA 3ERDA 1M13A 4L96A 2QSEA 2Q7JA 2J7YA 2PIOA 1L2IA 2Q7IA 3DCUA 3KDUA 3KPZA 4IU7A 2FVJA 2YATA 5DZ1A 2HARA 2VV1A 5G42A 1NQ2A 1YOKA 5DIGA 3VHVA 1QKNA 2HAMA 4J5WA 1FM9A 2ATHA 1U3QA 3GWXA 4POHA 3GBKA 5E0WA 3AN4A 3A2JA 4MG8B 2VV0A 3RLLA 4WLBA 1GWXA 1PZLA 5IZ0A 5IAWA 1KNUA 4OEYA 3ADSA 2VV4B 4FN9A 4FNEA 3CS4A 4MG7B 3SP9A 5DXRA 1NDEA 2YLOA 2XHSA 3ET1A 4IA1A 4JYGA 4PXMA 3T03A 3FEJA 1H9UA 3VHUA 4RUOX 4MG8A 2I4PA 1MV9A 4KZIA 2Q5SA 2QXMA 3F5CA 1NYXA 2QMVA 4MG7A 4OILA 2Z4JA 1N83A 1PQ6A 2ZVTA 3ERTA 3W5PA 4RMDA 3KMRA 4RMCA 3TX7B 3KYTA 2QTUA 1GWRA 3AZ2A 1I7GA 2P15A 4N8RA 3GZ9A 5KCWA 3PCUA 4O8FA 1FD0A 2GPOA 3RVFA 4PVUA 1WM0X 1XAPA 4MG9B 2V0VA 3RY9A 4CI5A 4A2JA 4RAKA 4ITEA 3VRTA 1L2JA 2O9IA 4OH6A 3D24A 5DIDA 3B0TA 2ZBSA 1NQ0A 2POGA 1PQ9A 3W5TA 4MG9A 2HFPA 3A2HA 3OKIA 2NPAA 1XDKA 2PIRA 2Q8SA 3E7CA 3OSWA 4S14A 5DKGA 4NIEA 5EJVA 1IE8A 5KCFA 1T74A 3NOAA 3W0YA 3WT6A 5KROA 5DZHA 4N5GA 3OOKA 2AWHA 2HB8A 1NAXA 2PIXA 2QGWA 3TY0A 2ZXNA 2Z4BA 4ZJWA 1M2ZA 4REEA 5DWLA 4PRGA 2ZLCA 3R8IA 4RUPA 3KFCA 3HVLA 1U3RA 4EMAA 2W8YA 4K7AA 5KRCA 2F4BA 2P7ZA 5FQVA 1PRGA 3G0WA 4RE8A 5HYKA 4OARA 5DP0A 5FQRA 1FBYA 2QE4A 1XNNA 2ZNPA 3W0JA 3OMOA 1YINA 4BCRA 4KZMA 2QA8B 3ET3A 3IXPA 3VRVA 1PDUA 5C4UA 2GL8A 1QKUA 5DXEA 1P93A 1X76A 2J14A 3UUDB 4CSJA 4YPQA 5K13A 1XIUA 3OS8C 4OEZA 3OGTA 4ZO1X 1PQCA 1ZDUA 2JJ3A 5FQSA 5KCCA 2G5OA 5DVSA 4LTWA 4RWVA 4IWCA 2IOKA 2QA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZN9 A;  2QPY A;  2ZAS A;  4OFU A;  4PLD A;  4ZNW A;  2QZO B;  3A78 A;  3K8S A;  4Q0A C;  3CS8 A;  3D57 A;  3UUD A;  3WTQ A;  4OHA A;  4E4K A;  2HCD A;  2NXX A;  4OJ4 A;  4YT1 A;  2XKW A;  4OJB A;  3VJH A;  3B66 A;  3G9E A;  1YY4 A;  2PIQ A;  4J26 A;  3UUA B;  2B1Z A;  4NUF A;  3RUU A;  3CDP A;  4Q13 A;  3W5R A;  1LV2 A;  2Q61 A;  4RUJ A;  5H1E A;  3AX8 A;  2OUZ A;  2POB A;  3K22 A;  3PO9 A;  4TUZ B;  2ACL B;  2OZ7 A;  5HYR A;  3WT5 A;  4OZR U;  5KYA A;  3UUA A;  3BQD A;  1S0Z A;  3TKM A;  4MG6 A;  5DXM A;  1RKH A;  4HEE X;  3KWY A;  1I37 A;  5DK9 A;  3ADT A;  2Q7K A;  1R1K D;  3ADV A;  3KDT A;  4R6S A;  4TUZ A;  5DXP A;  2AMB A;  4DM6 A;  3NSP A;  4G1Y A;  5G46 A;  3L0L A;  3L3Z A;  1YUC A;  1T7F A;  2OVM A;  2PKL A;  3IPQ A;  3FAL B;  4FGY A;  1FCZ A;  4RZF A;  4XHD A;  3VT7 A;  1YMT A;  2PIP L;  5DZI A;  5E15 A;  1T7R A;  3B68 A;  4MGA B;  1YYE A;  5L7G A;  2QR9 A;  5DSH A;  2YLQ A;  1QKM A;  3VT5 A;  1RKG A;  4XI3 A;  5KCU A;  3P88 A;  3FUR A;  3W0H A;  2HAS A;  3L03 A;  4G1D A;  4K4J A;  3DZU D;  1X7R A;  1XVP A;  3E00 A;  3VSO A;  3X31 A;  4MGA A;  4IVY A;  1XLS E;  3UP3 A;  1E3G A;  3IXP D;  4X1G A;  1S19 A;  3L0J A;  4OZT U;  5DKS A;  1N46 A;  4OKB A;  1ZAF A;  4JL4 A;  5APH A;  4UDA A;  3HM1 A;  3U9Q A;  3W0A A;  2QW4 A;  3SZ1 A;  3V9V A;  5B41 A;  5EHJ A;  3IMY A;  1K74 A;  1NUO A;  3OMQ A;  1YIM A;  4PLE A;  1XNX A;  1XP1 A;  4J5X A;  2PRG A;  5G43 A;  3WWR A;  3WGP A;  2YJA B;  1RDT A;  2ZFX A;  5L7E A;  1MZN A;  3FLI A;  4UDB A;  1FCX A;  1SJ0 A;  4G1Z A;  1NQ7 A;  3AN3 A;  5LGA A;  5KYJ A;  3H52 A;  2AYR A;  2HB7 A;  4PPS A;  4ITF A;  2HWQ A;  4P6X A;  2AB2 A;  2AX8 A;  3OZ0 A;  5E14 A;  2VV3 A;  3GD2 A;  2NV7 A;  3PEQ A;  3B0Q A;  4UDC A;  5DXK A;  3OSI A;  2ZNQ A;  2Q59 B;  2ZMJ A;  3K6P A;  3V3E A;  1TXI A;  3VRW A;  4UDD A;  1ZKY A;  5GT4 A;  4A4W A;  3F5C B;  2AA5 A;  2GPP A;  5ICK A;  4MGB B;  3W0C A;  5DXG A;  1FM6 A;  2PIW A;  1XB7 A;  2Q59 A;  3R29 A;  4LNW A;  4OZT E;  4LNX A;  4QJR A;  4S15 A;  3FS1 A;  1T63 A;  2ZNO A;  3B67 A;  3AZ3 A;  4MGB A;  3UVV B;  4N1Y A;  4POJ A;  4NY9 A;  4PF3 A;  1NQ1 A;  1UOM A;  2ZKC A;  3X36 A;  4MG5 A;  1T7T A;  1EXX A;  1X7B A;  3VTD A;  1ZDT A;  2HVC A;  2R40 A;  4PP6 A;  4OIU A;  2AM9 A;  3HOD A;  4OGH A;  3UVV A;  1G2N A;  1R20 A;  2ZK1 A;  2ZK2 A;  3DR1 A;  3AUR A;  3E00 D;  1XDK B;  3CS6 A;  5KRL A;  3O1D A;  2AO6 A;  3GWS X;  4XT9 A;  4IA3 A;  5DWG A;  3WFF A;  4G2I A;  2AA6 A;  4E4Q A;  3VT6 A;  3W0I A;  2ZXZ A;  4ZNU A;  4QK4 A;  5DYB A;  5JJM B;  2Q5G A;  3P89 A;  3OMP A;  5JY3 A;  2H77 A;  4X1F A;  1OSH A;  1X7E A;  3CWD A;  3D90 A;  3VT3 A;  4PPP A;  2P4Y A;  1DKF B;  3NSQ A;  2GP7 A;  3X1I A;  4DQM A;  2Q1V A;  5DVV A;  1XOW A;  4EM9 A;  2GPV A;  3BEJ A;  2HC4 A;  5ETH A;  3HO0 A;  3IPU A;  5DVC A;  5JJM A;  3G8I A;  4FHI A;  4XUM A;  5JI0 D;  2YLP A;  5C4T A;  5DYD A;  1DKF A;  2R6Y A;  1FM9 D;  2ZL9 A;  2PIV A;  5DXB B;  3ZR7 A;  1A52 A;  3HZF A;  1MVC A;  3IPS A;  3WMH A;  2QH6 A;  3AZ1 A;  5KCD A;  5AYG A;  4K6I A;  3VT8 A;  4DK7 A;  1UPW A;  5AAU A;  5AK2 A;  4A4V A;  5DXB A;  5HCV A;  3HQ5 A;  5DWJ A;  3PLZ A;  3HLV A;  1UPV A;  3VJS A;  5DKB A;  5IXK A;  2OVH A;  5HJS A;  4M8E A;  3L1B A;  4XAO A;  5DV3 A;  2YJD A;  3GYT A;  4ZOM A;  5F9B A;  2QA6 A;  3F7D A;  3ADX A;  4OKW A;  5KRF A;  3D6D A;  1M7W A;  2JFA A;  3ZQT A;  1SR7 A;  5B5B A;  3R2A A;  2AX7 A;  4REF A;  5E0X A;  4OEA A;  2VST A;  2P1V A;  5KRJ A;  3VJI A;  4IQR A;  1R5K A;  1U3S A;  2PJL A;  3MNO A;  4TV1 A;  1RK3 A;  2H79 A;  3OS8 A;  4LBD A;  4S0T A;  1PCG A;  3OSA A;  3H0A A;  5DX3 B;  4B7W A;  5DUE A;  5SYZ A;  2Q3Y A;  3EYB A;  2Q60 A;  1S9Q A;  2QAB A;  5DV6 A;  5KCE A;  5AZT A;  1KV6 A;  1FCY A;  3R5M A;  4Q50 A;  4OIV A;  1ERE A;  2B50 A;  3DCT A;  2VV2 A;  3DT3 A;  3D5F A;  5DX3 A;  5FQP A;  5L11 A;  1X78 A;  3OLL A;  2A3I A;  3ILZ A;  4QE6 A;  3CDS A;  3B0W A;  3A3Z X;  3VT9 A;  5DV8 A;  2FAI A;  3CJW A;  5I4V A;  5DRM A;  1XVP B;  5E19 A;  3VI8 A;  5APK A;  4OFR A;  3GYU A;  3OMM A;  3AFR A;  5G5W A;  2XYX A;  1YOW A;  1RJK A;  1Z5X U;  5DLR A;  2ZMI A;  4WQP A;  5DRJ A;  1IE9 A;  3W0G A;  5DUH A;  5KRI A;  4G21 A;  3ZRA A;  4JYI A;  3M7R A;  4WHG A;  5AWJ A;  1OT7 A;  3AUQ A;  3FUG A;  5KRK A;  3KMZ A;  4LSJ A;  4ZNS A;  1T76 A;  3FEI A;  3W5Q A;  5M96 A;  1Y9R A;  4ZNT A;  1U9E A;  2ZY0 A;  5A86 A;  2HBH A;  5CJ6 A;  4IUI A;  2I0J A;  4WVD A;  5E1C A;  1K7L A;  2ZXM A;  4JGV A;  1ZEO A;  1N4H A;  1XLS A;  4RZE A;  2Q5P A;  5FQT A;  1PK5 A;  1QKT A;  1I7I A;  1XV9 B;  2O4J A;  1T65 A;  5KCT A;  1VJB A;  3S9S A;  4J5W C;  4YNK A;  3WJ5 A;  4APU A;  1XP9 A;  2G44 A;  3LMP A;  1XV9 A;  5KRH A;  2AX6 A;  2ZLA A;  5ACC A;  4ZI1 A;  2Q6S A;  4QE8 A;  1Z5X E;  5KRA A;  3ET2 A;  3UUC A;  2J4A A;  3R8A A;  2R6W A;  1ILH A;  1XJ7 A;  1ZGY A;  2P54 A;  2YHD A;  1ERR A;  2ZK6 A;  3Q95 B;  1T5Z A;  1OVL A;  4DM8 A;  4NQA B;  5HZC A;  3K23 A;  2Q6J A;  4KZJ A;  4ZO1 B;  4ZNH A;  5DWE A;  5G3J A;  3RLJ A;  1XQC A;  3VTB A;  2ZK5 A;  4IW8 A;  3OS9 A;  3Q95 A;  2VSR A;  1T79 A;  3P0U A;  1X7J A;  3V9Y A;  1S0X A;  5DMF A;  2IOG A;  5DI7 A;  2GTK A;  2ZK4 A;  5AZV A;  4PP3 A;  5EGV A;  4XTA A;  2AA7 A;  3CLD A;  5EC9 A;  4OJ9 A;  1XPC A;  3WJ4 A;  2AMA A;  3B5R A;  2O4R A;  3KBA A;  4R2U A;  4S0S A;  1HJ1 A;  4IW6 A;  3VN2 A;  2VV4 A;  2Q6R A;  3O1E A;  1G5Y A;  5APJ A;  5GIC A;  4E2J A;  1K74 D;  5KR9 A;  3B3K A;  4IV2 A;  4RFW A;  4OKT A;  1RDT D;  3N00 A;  4NB6 A;  2LBD A;  5DWI A;  4XUH A;  2P7G A;  5DL4 A;  4MGC A;  3MNP A;  4RZG A;  5DY8 A;  3CTB A;  5KRM A;  4R06 A;  5KD9 A;  3L0E A;  3OKH A;  5GID A;  2QNV A;  4DOS A;  2J7X A;  3TKC A;  2P7A A;  3VSP A;  3B1M A;  3V9T A;  2I4Z A;  1A28 A;  2GIU A;  2NW4 A;  3DZY A;  2AA2 A;  2BJ4 B;  2HWR A;  3OZJ A;  1R1K A;  4WHF A;  1FM6 D;  1P8D A;  2BAW A;  4ZN7 A;  2ZNN A;  5LWP A;  1XQ3 A;  2JFA B;  1EXA A;  2G0H A;  4N73 A;  4JYH A;  3A40 X;  1LBD A;  4RME A;  3BC5 A;  2BJ4 A;  5C4S A;  3OAP A;  4Y29 A;  3HC5 A;  3V3Q A;  2JF9 A;  1K4W A;  4QM0 A;  3OOF A;  5AVL A;  5C4O A;  4PP5 A;  2QXS A;  4OKX A;  4P6W A;  1BSX A;  3ET0 A;  4TV1 B;  1UHL B;  2B1V A;  1R6G A;  3PBA A;  2GWX A;  2R40 D;  3DZU A;  4DOR A;  2Q70 A;  3HC6 A;  5EI1 A;  2EWP A;  2GPU A;  2NXX E;  5DKE A;  4JAZ A;  1R20 D;  5G44 A;  4HLW A;  4CI4 A;  1UHL A;  3OMK A;  5DMC A;  3A2I A;  1G50 A;  3IA6 A;  4MGD B;  3JZB A;  2G0G A;  4IA7 A;  4DMA A;  3WFG A;  3KMG A;  2ZK3 A;  1HG4 A;  1KKQ A;  1Y0X X;  1E3K A;  2YLY A;  4MGD A;  3OLF A;  3V49 A;  5E7V A;  1GS4 A;  3FXV A;  3PRG A;  5DZ0 A;  5EIT A;  5HJP B;  4ZJR A;  2QGT A;  2V7C A;  2PIN A;  4OK1 A;  3QT0 A;  4QL8 A;  2XYW A;  4OED A;  2QZO A;  4ZNV A;  3VJT A;  1T73 A;  3A9E B;  4XLD A;  2I4J A;  1DB1 A;  3B65 A;  4G2H A;  5DIE A;  5DZ3 A;  5DUG A;  3SP6 A;  5DXQ A;  3FC6 B;  5AWK A;  3UU7 B;  4YMQ A;  2REW A;  5HJP A;  2E2R A;  4L98 A;  5DU5 A;  3WT7 A;  1NRL A;  4M8H A;  2YFE A;  3B0R A;  3E94 A;  3A9E A;  4IS8 A;  2IHQ A;  3DZY D;  1S9P A;  3P8X A;  3FC6 A;  3LBD A;  3UU7 A;  2ZK0 A;  3R8D A;  4PWL A;  3UP0 A;  3RUT A;  2ACL A;  2P1U A;  3MNE A;  3L3X A;  4OC7 A;  2OAX A;  3JZC A;  3ZRB A;  2OM9 A;  1Q4X A;  1SQN A;  1XP6 A;  1G1U A;  1YP0 A;  3ADW A;  3VHW A;  1OSV A;  4MDD A;  3AUN A;  5L7H A;  3CQV A;  4J24 A;  4DK8 A;  1T7M A;  1ZH7 A;  5AAV B;  2B23 A;  2OCF A;  1YJE A;  4J5X C;  4IWF A;  3ADU A;  4FHH A;  4IV4 A;  1GWQ A;  4OH5 A;  2AX9 A;  1ILG A;  3G8O A;  3X1H A;  2P1T A;  2AAX A;  3R5N A;  3VT4 A;  2Q7L A;  3FAL A;  2Q1H A;  1NAV A;  2FSZ A;  1SKX A;  2XYJ A;  3OLS A;  1TFC A;  4IVW A;  1Z95 A;  2AXA A;  3DY6 A;  5AAV A;  1I38 A;  3V4A A;  1ZUC A;  1Y0S A;  2PIT A;  1NHZ A;  5DTV A;  4IA2 A;  1XZX X;  2I0G A;  5GIE A;  5AVI A;  1OVL B;  4G20 A;  3H0A D;  2ZMH A;  3VRU A;  4OZR E;  3GN8 A;  2VV1 B;  2PNU A;  1YA3 A;  4ONI A;  3VTC A;  4OLM A;  4WPF A;  2PIU A;  4F9M A;  5G45 A;  2ABI A;  3ERD A;  1M13 A;  4L96 A;  2QSE A;  2Q7J A;  2J7Y A;  2PIO A;  1L2I A;  2Q7I A;  3DCU A;  3KDU A;  3KPZ A;  4IU7 A;  2FVJ A;  2YAT A;  5DZ1 A;  2HAR A;  2VV1 A;  5G42 A;  1NQ2 A;  1YOK A;  5DIG A;  3VHV A;  1QKN A;  2HAM A;  4J5W A;  1FM9 A;  2ATH A;  1U3Q A;  3GWX A;  4POH A;  3GBK A;  5E0W A;  3AN4 A;  3A2J A;  4MG8 B;  2VV0 A;  3RLL A;  4WLB A;  1GWX A;  1PZL A;  5IZ0 A;  5IAW A;  1KNU A;  4OEY A;  3ADS A;  2VV4 B;  4FN9 A;  4FNE A;  3CS4 A;  4MG7 B;  3SP9 A;  5DXR A;  1NDE A;  2YLO A;  2XHS A;  3ET1 A;  4IA1 A;  4JYG A;  4PXM A;  3T03 A;  3FEJ A;  1H9U A;  3VHU A;  4RUO X;  4MG8 A;  2I4P A;  1MV9 A;  4KZI A;  2Q5S A;  2QXM A;  3F5C A;  1NYX A;  2QMV A;  4MG7 A;  4OIL A;  2Z4J A;  1N83 A;  1PQ6 A;  2ZVT A;  3ERT A;  3W5P A;  4RMD A;  3KMR A;  4RMC A;  3TX7 B;  3KYT A;  2QTU A;  1GWR A;  3AZ2 A;  1I7G A;  2P15 A;  4N8R A;  3GZ9 A;  5KCW A;  3PCU A;  4O8F A;  1FD0 A;  2GPO A;  3RVF A;  4PVU A;  1WM0 X;  1XAP A;  4MG9 B;  2V0V A;  3RY9 A;  4CI5 A;  4A2J A;  4RAK A;  4ITE A;  3VRT A;  1L2J A;  2O9I A;  4OH6 A;  3D24 A;  5DID A;  3B0T A;  2ZBS A;  1NQ0 A;  2POG A;  1PQ9 A;  3W5T A;  4MG9 A;  2HFP A;  3A2H A;  3OKI A;  2NPA A;  1XDK A;  2PIR A;  2Q8S A;  3E7C A;  3OSW A;  4S14 A;  5DKG A;  4NIE A;  5EJV A;  1IE8 A;  5KCF A;  1T74 A;  3NOA A;  3W0Y A;  3WT6 A;  5KRO A;  5DZH A;  4N5G A;  3OOK A;  2AWH A;  2HB8 A;  1NAX A;  2PIX A;  2QGW A;  3TY0 A;  2ZXN A;  2Z4B A;  4ZJW A;  1M2Z A;  4REE A;  5DWL A;  4PRG A;  2ZLC A;  3R8I A;  4RUP A;  3KFC A;  3HVL A;  1U3R A;  4EMA A;  2W8Y A;  4K7A A;  5KRC A;  2F4B A;  2P7Z A;  5FQV A;  1PRG A;  3G0W A;  4RE8 A;  5HYK A;  4OAR A;  5DP0 A;  5FQR A;  1FBY A;  2QE4 A;  1XNN A;  2ZNP A;  3W0J A;  3OMO A;  1YIN A;  4BCR A;  4KZM A;  2QA8 B;  3ET3 A;  3IXP A;  3VRV A;  1PDU A;  5C4U A;  2GL8 A;  1QKU A;  5DXE A;  1P93 A;  1X76 A;  2J14 A;  3UUD B;  4CSJ A;  4YPQ A;  5K13 A;  1XIU A;  3OS8 C;  4OEZ A;  3OGT A;  4ZO1 X;  1PQC A;  1ZDU A;  2JJ3 A;  5FQS A;  5KCC A;  2G5O A;  5DVS A;  4LTW A;  4RWV A;  4IWC A;  2IOK A;  2QA8 A; 
#chains in the Genus database with same CATH topology
 4ZN9 A;  2QPY A;  2ZAS A;  4OFU A;  4PLD A;  4ZNW A;  2QZO B;  3A78 A;  3K8S A;  4Q0A C;  3CS8 A;  3D57 A;  3UUD A;  3WTQ A;  4OHA A;  4E4K A;  2HCD A;  2NXX A;  4OJ4 A;  4YT1 A;  2XKW A;  4OJB A;  3VJH A;  3B66 A;  3G9E A;  1YY4 A;  2PIQ A;  4J26 A;  3UUA B;  2B1Z A;  4NUF A;  3RUU A;  3CDP A;  4Q13 A;  3W5R A;  1LV2 A;  2Q61 A;  4RUJ A;  5H1E A;  3AX8 A;  2OUZ A;  2POB A;  3K22 A;  3PO9 A;  4TUZ B;  2ACL B;  2OZ7 A;  5HYR A;  3WT5 A;  4OZR U;  5KYA A;  3UUA A;  3BQD A;  1S0Z A;  3TKM A;  4MG6 A;  5DXM A;  1RKH A;  4HEE X;  3KWY A;  1I37 A;  5DK9 A;  3ADT A;  2Q7K A;  1R1K D;  3ADV A;  3KDT A;  4R6S A;  4TUZ A;  5DXP A;  2AMB A;  4DM6 A;  3NSP A;  4G1Y A;  5G46 A;  3L0L A;  3L3Z A;  1YUC A;  1T7F A;  2OVM A;  2PKL A;  3IPQ A;  3FAL B;  4FGY A;  1FCZ A;  4RZF A;  4XHD A;  3VT7 A;  1YMT A;  2PIP L;  5DZI A;  5E15 A;  1T7R A;  3B68 A;  4MGA B;  1YYE A;  5L7G A;  2QR9 A;  5DSH A;  2YLQ A;  1QKM A;  3VT5 A;  1RKG A;  4XI3 A;  5KCU A;  3P88 A;  3FUR A;  3W0H A;  2HAS A;  3L03 A;  4G1D A;  4K4J A;  3DZU D;  1X7R A;  1XVP A;  3E00 A;  3VSO A;  3X31 A;  4MGA A;  4IVY A;  1XLS E;  3UP3 A;  1E3G A;  3IXP D;  4X1G A;  1S19 A;  3L0J A;  4OZT U;  5DKS A;  1N46 A;  4OKB A;  1ZAF A;  4JL4 A;  5APH A;  4UDA A;  3HM1 A;  3U9Q A;  3W0A A;  2QW4 A;  3SZ1 A;  3V9V A;  5B41 A;  5EHJ A;  3IMY A;  1K74 A;  1NUO A;  3OMQ A;  1YIM A;  4PLE A;  1XNX A;  1XP1 A;  4J5X A;  2PRG A;  5G43 A;  3WWR A;  3WGP A;  2YJA B;  1RDT A;  2ZFX A;  5L7E A;  1MZN A;  3FLI A;  4UDB A;  1FCX A;  1SJ0 A;  4G1Z A;  1NQ7 A;  3AN3 A;  5LGA A;  5KYJ A;  3H52 A;  2AYR A;  2HB7 A;  4PPS A;  4ITF A;  2HWQ A;  4P6X A;  2AB2 A;  2AX8 A;  3OZ0 A;  5E14 A;  2VV3 A;  3GD2 A;  2NV7 A;  3PEQ A;  3B0Q A;  4UDC A;  5DXK A;  3OSI A;  2ZNQ A;  2Q59 B;  2ZMJ A;  3K6P A;  3V3E A;  1TXI A;  3VRW A;  4UDD A;  1ZKY A;  5GT4 A;  4A4W A;  3F5C B;  2AA5 A;  2GPP A;  5ICK A;  4MGB B;  3W0C A;  5DXG A;  1FM6 A;  2PIW A;  1XB7 A;  2Q59 A;  3R29 A;  4LNW A;  4OZT E;  4LNX A;  4QJR A;  4S15 A;  3FS1 A;  1T63 A;  2ZNO A;  3B67 A;  3AZ3 A;  4MGB A;  3UVV B;  4N1Y A;  4POJ A;  4NY9 A;  4PF3 A;  1NQ1 A;  1UOM A;  2ZKC A;  3X36 A;  4MG5 A;  1T7T A;  1EXX A;  1X7B A;  3VTD A;  1ZDT A;  2HVC A;  2R40 A;  4PP6 A;  4OIU A;  2AM9 A;  3HOD A;  4OGH A;  3UVV A;  1G2N A;  1R20 A;  2ZK1 A;  2ZK2 A;  3DR1 A;  3AUR A;  3E00 D;  1XDK B;  3CS6 A;  5KRL A;  3O1D A;  2AO6 A;  3GWS X;  4XT9 A;  4IA3 A;  5DWG A;  3WFF A;  4G2I A;  2AA6 A;  4E4Q A;  3VT6 A;  3W0I A;  2ZXZ A;  4ZNU A;  4QK4 A;  5DYB A;  5JJM B;  2Q5G A;  3P89 A;  3OMP A;  5JY3 A;  2H77 A;  4X1F A;  1OSH A;  1X7E A;  3CWD A;  3D90 A;  3VT3 A;  4PPP A;  2P4Y A;  1DKF B;  3NSQ A;  2GP7 A;  3X1I A;  4DQM A;  2Q1V A;  5DVV A;  1XOW A;  4EM9 A;  2GPV A;  3BEJ A;  2HC4 A;  5ETH A;  3HO0 A;  3IPU A;  5DVC A;  5JJM A;  3G8I A;  4FHI A;  4XUM A;  5JI0 D;  2YLP A;  5C4T A;  5DYD A;  1DKF A;  2R6Y A;  1FM9 D;  2ZL9 A;  2PIV A;  5DXB B;  3ZR7 A;  1A52 A;  3HZF A;  1MVC A;  3IPS A;  3WMH A;  2QH6 A;  3AZ1 A;  5KCD A;  5AYG A;  4K6I A;  3VT8 A;  4DK7 A;  1UPW A;  5AAU A;  5AK2 A;  4A4V A;  5DXB A;  5HCV A;  3HQ5 A;  5DWJ A;  3PLZ A;  3HLV A;  1UPV A;  3VJS A;  5DKB A;  5IXK A;  2OVH A;  5HJS A;  4M8E A;  3L1B A;  4XAO A;  5DV3 A;  2YJD A;  3GYT A;  4ZOM A;  5F9B A;  2QA6 A;  3F7D A;  3ADX A;  4OKW A;  5KRF A;  3D6D A;  1M7W A;  2JFA A;  3ZQT A;  1SR7 A;  5B5B A;  3R2A A;  2AX7 A;  4REF A;  5E0X A;  4OEA A;  2VST A;  2P1V A;  5KRJ A;  3VJI A;  4IQR A;  1R5K A;  1U3S A;  2PJL A;  3MNO A;  4TV1 A;  1RK3 A;  2H79 A;  3OS8 A;  4LBD A;  4S0T A;  1PCG A;  3OSA A;  3H0A A;  5DX3 B;  4B7W A;  5DUE A;  5SYZ A;  2Q3Y A;  3EYB A;  2Q60 A;  1S9Q A;  2QAB A;  5DV6 A;  5KCE A;  5AZT A;  1KV6 A;  1FCY A;  3R5M A;  4Q50 A;  4OIV A;  1ERE A;  2B50 A;  3DCT A;  2VV2 A;  3DT3 A;  3D5F A;  5DX3 A;  5FQP A;  5L11 A;  1X78 A;  3OLL A;  2A3I A;  3ILZ A;  4QE6 A;  3CDS A;  3B0W A;  3A3Z X;  3VT9 A;  5DV8 A;  2FAI A;  3CJW A;  5I4V A;  5DRM A;  1XVP B;  5E19 A;  3VI8 A;  5APK A;  4OFR A;  3GYU A;  3OMM A;  3AFR A;  5G5W A;  2XYX A;  1YOW A;  1RJK A;  1Z5X U;  5DLR A;  2ZMI A;  4WQP A;  5DRJ A;  1IE9 A;  3W0G A;  5DUH A;  5KRI A;  4G21 A;  3ZRA A;  4JYI A;  3M7R A;  4WHG A;  5AWJ A;  1OT7 A;  3AUQ A;  3FUG A;  5KRK A;  3KMZ A;  4LSJ A;  4ZNS A;  1T76 A;  3FEI A;  3W5Q A;  5M96 A;  1Y9R A;  4ZNT A;  1U9E A;  2ZY0 A;  5A86 A;  2HBH A;  5CJ6 A;  4IUI A;  2I0J A;  4WVD A;  5E1C A;  1K7L A;  2ZXM A;  4JGV A;  1ZEO A;  1N4H A;  1XLS A;  4RZE A;  2Q5P A;  5FQT A;  1PK5 A;  1QKT A;  1I7I A;  1XV9 B;  2O4J A;  1T65 A;  5KCT A;  1VJB A;  3S9S A;  4J5W C;  4YNK A;  3WJ5 A;  4APU A;  1XP9 A;  2G44 A;  3LMP A;  1XV9 A;  5KRH A;  2AX6 A;  2ZLA A;  5ACC A;  4ZI1 A;  2Q6S A;  4QE8 A;  1Z5X E;  5KRA A;  3ET2 A;  3UUC A;  2J4A A;  3R8A A;  2R6W A;  1ILH A;  1XJ7 A;  1ZGY A;  2P54 A;  2YHD A;  1ERR A;  2ZK6 A;  3Q95 B;  1T5Z A;  1OVL A;  4DM8 A;  4NQA B;  5HZC A;  3K23 A;  2Q6J A;  4KZJ A;  4ZO1 B;  4ZNH A;  5DWE A;  5G3J A;  3RLJ A;  1XQC A;  3VTB A;  2ZK5 A;  4IW8 A;  3OS9 A;  3Q95 A;  2VSR A;  1T79 A;  3P0U A;  1X7J A;  3V9Y A;  1S0X A;  5DMF A;  2IOG A;  5DI7 A;  2GTK A;  2ZK4 A;  5AZV A;  4PP3 A;  5EGV A;  4XTA A;  2AA7 A;  3CLD A;  5EC9 A;  4OJ9 A;  1XPC A;  3WJ4 A;  2AMA A;  3B5R A;  2O4R A;  3KBA A;  4R2U A;  4S0S A;  1HJ1 A;  4IW6 A;  3VN2 A;  2VV4 A;  2Q6R A;  3O1E A;  1G5Y A;  5APJ A;  5GIC A;  4E2J A;  1K74 D;  5KR9 A;  3B3K A;  4IV2 A;  4RFW A;  4OKT A;  1RDT D;  3N00 A;  4NB6 A;  2LBD A;  5DWI A;  4XUH A;  2P7G A;  5DL4 A;  4MGC A;  3MNP A;  4RZG A;  5DY8 A;  3CTB A;  5KRM A;  4R06 A;  5KD9 A;  3L0E A;  3OKH A;  5GID A;  2QNV A;  4DOS A;  2J7X A;  3TKC A;  2P7A A;  3VSP A;  3B1M A;  3V9T A;  2I4Z A;  1A28 A;  2GIU A;  2NW4 A;  3DZY A;  2AA2 A;  2BJ4 B;  2HWR A;  3OZJ A;  1R1K A;  4WHF A;  1FM6 D;  1P8D A;  2BAW A;  4ZN7 A;  2ZNN A;  5LWP A;  1XQ3 A;  2JFA B;  1EXA A;  2G0H A;  4N73 A;  4JYH A;  3A40 X;  1LBD A;  4RME A;  3BC5 A;  2BJ4 A;  5C4S A;  3OAP A;  4Y29 A;  3HC5 A;  3V3Q A;  2JF9 A;  1K4W A;  4QM0 A;  3OOF A;  5AVL A;  5C4O A;  4PP5 A;  2QXS A;  4OKX A;  4P6W A;  1BSX A;  3ET0 A;  4TV1 B;  1UHL B;  2B1V A;  1R6G A;  3PBA A;  2GWX A;  2R40 D;  3DZU A;  4DOR A;  2Q70 A;  3HC6 A;  5EI1 A;  2EWP A;  2GPU A;  2NXX E;  5DKE A;  4JAZ A;  1R20 D;  5G44 A;  4HLW A;  4CI4 A;  1UHL A;  3OMK A;  5DMC A;  3A2I A;  1G50 A;  3IA6 A;  4MGD B;  3JZB A;  2G0G A;  4IA7 A;  4DMA A;  3WFG A;  3KMG A;  2ZK3 A;  1HG4 A;  1KKQ A;  1Y0X X;  1E3K A;  2YLY A;  4MGD A;  3OLF A;  3V49 A;  5E7V A;  1GS4 A;  3FXV A;  3PRG A;  5DZ0 A;  5EIT A;  5HJP B;  4ZJR A;  2QGT A;  2V7C A;  2PIN A;  4OK1 A;  3QT0 A;  4QL8 A;  2XYW A;  4OED A;  2QZO A;  4ZNV A;  3VJT A;  1T73 A;  3A9E B;  4XLD A;  2I4J A;  1DB1 A;  3B65 A;  4G2H A;  5DIE A;  5DZ3 A;  5DUG A;  3SP6 A;  5DXQ A;  3FC6 B;  5AWK A;  3UU7 B;  4YMQ A;  2REW A;  5HJP A;  2E2R A;  4L98 A;  5DU5 A;  3WT7 A;  1NRL A;  4M8H A;  2YFE A;  3B0R A;  3E94 A;  3A9E A;  4IS8 A;  2IHQ A;  3DZY D;  1S9P A;  3P8X A;  3FC6 A;  3LBD A;  3UU7 A;  2ZK0 A;  3R8D A;  4PWL A;  3UP0 A;  3RUT A;  2ACL A;  2P1U A;  3MNE A;  3L3X A;  4OC7 A;  2OAX A;  3JZC A;  3ZRB A;  2OM9 A;  1Q4X A;  1SQN A;  1XP6 A;  1G1U A;  1YP0 A;  3ADW A;  3VHW A;  1OSV A;  4MDD A;  3AUN A;  5L7H A;  3CQV A;  4J24 A;  4DK8 A;  1T7M A;  1ZH7 A;  5AAV B;  2B23 A;  2OCF A;  1YJE A;  4J5X C;  4IWF A;  3ADU A;  4FHH A;  4IV4 A;  1GWQ A;  4OH5 A;  2AX9 A;  1ILG A;  3G8O A;  3X1H A;  2P1T A;  2AAX A;  3R5N A;  3VT4 A;  2Q7L A;  3FAL A;  2Q1H A;  1NAV A;  2FSZ A;  1SKX A;  2XYJ A;  3OLS A;  1TFC A;  4IVW A;  1Z95 A;  2AXA A;  3DY6 A;  5AAV A;  1I38 A;  3V4A A;  1ZUC A;  1Y0S A;  2PIT A;  1NHZ A;  5DTV A;  4IA2 A;  1XZX X;  2I0G A;  5GIE A;  5AVI A;  1OVL B;  4G20 A;  3H0A D;  2ZMH A;  3VRU A;  4OZR E;  3GN8 A;  2VV1 B;  2PNU A;  1YA3 A;  4ONI A;  3VTC A;  4OLM A;  4WPF A;  2PIU A;  4F9M A;  5G45 A;  2ABI A;  3ERD A;  1M13 A;  4L96 A;  2QSE A;  2Q7J A;  2J7Y A;  2PIO A;  1L2I A;  2Q7I A;  3DCU A;  3KDU A;  3KPZ A;  4IU7 A;  2FVJ A;  2YAT A;  5DZ1 A;  2HAR A;  2VV1 A;  5G42 A;  1NQ2 A;  1YOK A;  5DIG A;  3VHV A;  1QKN A;  2HAM A;  4J5W A;  1FM9 A;  2ATH A;  1U3Q A;  3GWX A;  4POH A;  3GBK A;  5E0W A;  3AN4 A;  3A2J A;  4MG8 B;  2VV0 A;  3RLL A;  4WLB A;  1GWX A;  1PZL A;  5IZ0 A;  5IAW A;  1KNU A;  4OEY A;  3ADS A;  2VV4 B;  4FN9 A;  4FNE A;  3CS4 A;  4MG7 B;  3SP9 A;  5DXR A;  1NDE A;  2YLO A;  2XHS A;  3ET1 A;  4IA1 A;  4JYG A;  4PXM A;  3T03 A;  3FEJ A;  1H9U A;  3VHU A;  4RUO X;  4MG8 A;  2I4P A;  1MV9 A;  4KZI A;  2Q5S A;  2QXM A;  3F5C A;  1NYX A;  2QMV A;  4MG7 A;  4OIL A;  2Z4J A;  1N83 A;  1PQ6 A;  2ZVT A;  3ERT A;  3W5P A;  4RMD A;  3KMR A;  4RMC A;  3TX7 B;  3KYT A;  2QTU A;  1GWR A;  3AZ2 A;  1I7G A;  2P15 A;  4N8R A;  3GZ9 A;  5KCW A;  3PCU A;  4O8F A;  1FD0 A;  2GPO A;  3RVF A;  4PVU A;  1WM0 X;  1XAP A;  4MG9 B;  2V0V A;  3RY9 A;  4CI5 A;  4A2J A;  4RAK A;  4ITE A;  3VRT A;  1L2J A;  2O9I A;  4OH6 A;  3D24 A;  5DID A;  3B0T A;  2ZBS A;  1NQ0 A;  2POG A;  1PQ9 A;  3W5T A;  4MG9 A;  2HFP A;  3A2H A;  3OKI A;  2NPA A;  1XDK A;  2PIR A;  2Q8S A;  3E7C A;  3OSW A;  4S14 A;  5DKG A;  4NIE A;  5EJV A;  1IE8 A;  5KCF A;  1T74 A;  3NOA A;  3W0Y A;  3WT6 A;  5KRO A;  5DZH A;  4N5G A;  3OOK A;  2AWH A;  2HB8 A;  1NAX A;  2PIX A;  2QGW A;  3TY0 A;  2ZXN A;  2Z4B A;  4ZJW A;  1M2Z A;  4REE A;  5DWL A;  4PRG A;  2ZLC A;  3R8I A;  4RUP A;  3KFC A;  3HVL A;  1U3R A;  4EMA A;  2W8Y A;  4K7A A;  5KRC A;  2F4B A;  2P7Z A;  5FQV A;  1PRG A;  3G0W A;  4RE8 A;  5HYK A;  4OAR A;  5DP0 A;  5FQR A;  1FBY A;  2QE4 A;  1XNN A;  2ZNP A;  3W0J A;  3OMO A;  1YIN A;  4BCR A;  4KZM A;  2QA8 B;  3ET3 A;  3IXP A;  3VRV A;  1PDU A;  5C4U A;  2GL8 A;  1QKU A;  5DXE A;  1P93 A;  1X76 A;  2J14 A;  3UUD B;  4CSJ A;  4YPQ A;  5K13 A;  1XIU A;  3OS8 C;  4OEZ A;  3OGT A;  4ZO1 X;  1PQC A;  1ZDU A;  2JJ3 A;  5FQS A;  5KCC A;  2G5O A;  5DVS A;  4LTW A;  4RWV A;  4IWC A;  2IOK A;  2QA8 A; 
#chains in the Genus database with same CATH homology
 4ZN9 A;  2QPY A;  2ZAS A;  4OFU A;  4PLD A;  4ZNW A;  2QZO B;  3A78 A;  3K8S A;  4Q0A C;  3CS8 A;  3D57 A;  3UUD A;  3WTQ A;  4OHA A;  4E4K A;  2HCD A;  2NXX A;  4OJ4 A;  4YT1 A;  2XKW A;  4OJB A;  3VJH A;  3B66 A;  3G9E A;  1YY4 A;  2PIQ A;  4J26 A;  3UUA B;  2B1Z A;  4NUF A;  3RUU A;  3CDP A;  4Q13 A;  3W5R A;  1LV2 A;  2Q61 A;  4RUJ A;  5H1E A;  3AX8 A;  2OUZ A;  2POB A;  3K22 A;  3PO9 A;  4TUZ B;  2ACL B;  2OZ7 A;  5HYR A;  3WT5 A;  4OZR U;  5KYA A;  3UUA A;  3BQD A;  1S0Z A;  3TKM A;  4MG6 A;  5DXM A;  1RKH A;  4HEE X;  3KWY A;  1I37 A;  5DK9 A;  3ADT A;  2Q7K A;  1R1K D;  3ADV A;  3KDT A;  4R6S A;  4TUZ A;  5DXP A;  2AMB A;  4DM6 A;  3NSP A;  4G1Y A;  5G46 A;  3L0L A;  3L3Z A;  1YUC A;  1T7F A;  2OVM A;  2PKL A;  3IPQ A;  3FAL B;  4FGY A;  1FCZ A;  4RZF A;  4XHD A;  3VT7 A;  1YMT A;  2PIP L;  5DZI A;  5E15 A;  1T7R A;  3B68 A;  4MGA B;  1YYE A;  5L7G A;  2QR9 A;  5DSH A;  2YLQ A;  1QKM A;  3VT5 A;  1RKG A;  4XI3 A;  5KCU A;  3P88 A;  3FUR A;  3W0H A;  2HAS A;  3L03 A;  4G1D A;  4K4J A;  3DZU D;  1X7R A;  1XVP A;  3E00 A;  3VSO A;  3X31 A;  4MGA A;  4IVY A;  1XLS E;  3UP3 A;  1E3G A;  3IXP D;  4X1G A;  1S19 A;  3L0J A;  4OZT U;  5DKS A;  1N46 A;  4OKB A;  1ZAF A;  4JL4 A;  5APH A;  4UDA A;  3HM1 A;  3U9Q A;  3W0A A;  2QW4 A;  3SZ1 A;  3V9V A;  5B41 A;  5EHJ A;  3IMY A;  1K74 A;  1NUO A;  3OMQ A;  1YIM A;  4PLE A;  1XNX A;  1XP1 A;  4J5X A;  2PRG A;  5G43 A;  3WWR A;  3WGP A;  2YJA B;  1RDT A;  2ZFX A;  5L7E A;  1MZN A;  3FLI A;  4UDB A;  1FCX A;  1SJ0 A;  4G1Z A;  1NQ7 A;  3AN3 A;  5LGA A;  5KYJ A;  3H52 A;  2AYR A;  2HB7 A;  4PPS A;  4ITF A;  2HWQ A;  4P6X A;  2AB2 A;  2AX8 A;  3OZ0 A;  5E14 A;  2VV3 A;  3GD2 A;  2NV7 A;  3PEQ A;  3B0Q A;  4UDC A;  5DXK A;  3OSI A;  2ZNQ A;  2Q59 B;  2ZMJ A;  3K6P A;  3V3E A;  1TXI A;  3VRW A;  4UDD A;  1ZKY A;  5GT4 A;  4A4W A;  3F5C B;  2AA5 A;  2GPP A;  5ICK A;  4MGB B;  3W0C A;  5DXG A;  1FM6 A;  2PIW A;  1XB7 A;  2Q59 A;  3R29 A;  4LNW A;  4OZT E;  4LNX A;  4QJR A;  4S15 A;  3FS1 A;  1T63 A;  2ZNO A;  3B67 A;  3AZ3 A;  4MGB A;  3UVV B;  4N1Y A;  4POJ A;  4NY9 A;  4PF3 A;  1NQ1 A;  1UOM A;  2ZKC A;  3X36 A;  4MG5 A;  1T7T A;  1EXX A;  1X7B A;  3VTD A;  1ZDT A;  2HVC A;  2R40 A;  4PP6 A;  4OIU A;  2AM9 A;  3HOD A;  4OGH A;  3UVV A;  1G2N A;  1R20 A;  2ZK1 A;  2ZK2 A;  3DR1 A;  3AUR A;  3E00 D;  1XDK B;  3CS6 A;  5KRL A;  3O1D A;  2AO6 A;  3GWS X;  4XT9 A;  4IA3 A;  5DWG A;  3WFF A;  4G2I A;  2AA6 A;  4E4Q A;  3VT6 A;  3W0I A;  2ZXZ A;  4ZNU A;  4QK4 A;  5DYB A;  5JJM B;  2Q5G A;  3P89 A;  3OMP A;  5JY3 A;  2H77 A;  4X1F A;  1OSH A;  1X7E A;  3CWD A;  3D90 A;  3VT3 A;  4PPP A;  2P4Y A;  1DKF B;  3NSQ A;  2GP7 A;  3X1I A;  4DQM A;  2Q1V A;  5DVV A;  1XOW A;  4EM9 A;  2GPV A;  3BEJ A;  2HC4 A;  5ETH A;  3HO0 A;  3IPU A;  5DVC A;  5JJM A;  3G8I A;  4FHI A;  4XUM A;  5JI0 D;  2YLP A;  5C4T A;  5DYD A;  1DKF A;  2R6Y A;  1FM9 D;  2ZL9 A;  2PIV A;  5DXB B;  3ZR7 A;  1A52 A;  3HZF A;  1MVC A;  3IPS A;  3WMH A;  2QH6 A;  3AZ1 A;  5KCD A;  5AYG A;  4K6I A;  3VT8 A;  4DK7 A;  1UPW A;  5AAU A;  5AK2 A;  4A4V A;  5DXB A;  5HCV A;  3HQ5 A;  5DWJ A;  3PLZ A;  3HLV A;  1UPV A;  3VJS A;  5DKB A;  5IXK A;  2OVH A;  5HJS A;  4M8E A;  3L1B A;  4XAO A;  5DV3 A;  2YJD A;  3GYT A;  4ZOM A;  5F9B A;  2QA6 A;  3F7D A;  3ADX A;  4OKW A;  5KRF A;  3D6D A;  1M7W A;  2JFA A;  3ZQT A;  1SR7 A;  5B5B A;  3R2A A;  2AX7 A;  4REF A;  5E0X A;  4OEA A;  2VST A;  2P1V A;  5KRJ A;  3VJI A;  4IQR A;  1R5K A;  1U3S A;  2PJL A;  3MNO A;  4TV1 A;  1RK3 A;  2H79 A;  3OS8 A;  4LBD A;  4S0T A;  1PCG A;  3OSA A;  3H0A A;  5DX3 B;  4B7W A;  5DUE A;  5SYZ A;  2Q3Y A;  3EYB A;  2Q60 A;  1S9Q A;  2QAB A;  5DV6 A;  5KCE A;  5AZT A;  1KV6 A;  1FCY A;  3R5M A;  4Q50 A;  4OIV A;  1ERE A;  2B50 A;  3DCT A;  2VV2 A;  3DT3 A;  3D5F A;  5DX3 A;  5FQP A;  5L11 A;  1X78 A;  3OLL A;  2A3I A;  3ILZ A;  4QE6 A;  3CDS A;  3B0W A;  3A3Z X;  3VT9 A;  5DV8 A;  2FAI A;  3CJW A;  5I4V A;  5DRM A;  1XVP B;  5E19 A;  3VI8 A;  5APK A;  4OFR A;  3GYU A;  3OMM A;  3AFR A;  5G5W A;  2XYX A;  1YOW A;  1RJK A;  1Z5X U;  5DLR A;  2ZMI A;  4WQP A;  5DRJ A;  1IE9 A;  3W0G A;  5DUH A;  5KRI A;  4G21 A;  3ZRA A;  4JYI A;  3M7R A;  4WHG A;  5AWJ A;  1OT7 A;  3AUQ A;  3FUG A;  5KRK A;  3KMZ A;  4LSJ A;  4ZNS A;  1T76 A;  3FEI A;  3W5Q A;  5M96 A;  1Y9R A;  4ZNT A;  1U9E A;  2ZY0 A;  5A86 A;  2HBH A;  5CJ6 A;  4IUI A;  2I0J A;  4WVD A;  5E1C A;  1K7L A;  2ZXM A;  4JGV A;  1ZEO A;  1N4H A;  1XLS A;  4RZE A;  2Q5P A;  5FQT A;  1PK5 A;  1QKT A;  1I7I A;  1XV9 B;  2O4J A;  1T65 A;  5KCT A;  1VJB A;  3S9S A;  4J5W C;  4YNK A;  3WJ5 A;  4APU A;  1XP9 A;  2G44 A;  3LMP A;  1XV9 A;  5KRH A;  2AX6 A;  2ZLA A;  5ACC A;  4ZI1 A;  2Q6S A;  4QE8 A;  1Z5X E;  5KRA A;  3ET2 A;  3UUC A;  2J4A A;  3R8A A;  2R6W A;  1ILH A;  1XJ7 A;  1ZGY A;  2P54 A;  2YHD A;  1ERR A;  2ZK6 A;  3Q95 B;  1T5Z A;  1OVL A;  4DM8 A;  4NQA B;  5HZC A;  3K23 A;  2Q6J A;  4KZJ A;  4ZO1 B;  4ZNH A;  5DWE A;  5G3J A;  3RLJ A;  1XQC A;  3VTB A;  2ZK5 A;  4IW8 A;  3OS9 A;  3Q95 A;  2VSR A;  1T79 A;  3P0U A;  1X7J A;  3V9Y A;  1S0X A;  5DMF A;  2IOG A;  5DI7 A;  2GTK A;  2ZK4 A;  5AZV A;  4PP3 A;  5EGV A;  4XTA A;  2AA7 A;  3CLD A;  5EC9 A;  4OJ9 A;  1XPC A;  3WJ4 A;  2AMA A;  3B5R A;  2O4R A;  3KBA A;  4R2U A;  4S0S A;  1HJ1 A;  4IW6 A;  3VN2 A;  2VV4 A;  2Q6R A;  3O1E A;  1G5Y A;  5APJ A;  5GIC A;  4E2J A;  1K74 D;  5KR9 A;  3B3K A;  4IV2 A;  4RFW A;  4OKT A;  1RDT D;  3N00 A;  4NB6 A;  2LBD A;  5DWI A;  4XUH A;  2P7G A;  5DL4 A;  4MGC A;  3MNP A;  4RZG A;  5DY8 A;  3CTB A;  5KRM A;  4R06 A;  5KD9 A;  3L0E A;  3OKH A;  5GID A;  2QNV A;  4DOS A;  2J7X A;  3TKC A;  2P7A A;  3VSP A;  3B1M A;  3V9T A;  2I4Z A;  1A28 A;  2GIU A;  2NW4 A;  3DZY A;  2AA2 A;  2BJ4 B;  2HWR A;  3OZJ A;  1R1K A;  4WHF A;  1FM6 D;  1P8D A;  2BAW A;  4ZN7 A;  2ZNN A;  5LWP A;  1XQ3 A;  2JFA B;  1EXA A;  2G0H A;  4N73 A;  4JYH A;  3A40 X;  1LBD A;  4RME A;  3BC5 A;  2BJ4 A;  5C4S A;  3OAP A;  4Y29 A;  3HC5 A;  3V3Q A;  2JF9 A;  1K4W A;  4QM0 A;  3OOF A;  5AVL A;  5C4O A;  4PP5 A;  2QXS A;  4OKX A;  4P6W A;  1BSX A;  3ET0 A;  4TV1 B;  1UHL B;  2B1V A;  1R6G A;  3PBA A;  2GWX A;  2R40 D;  3DZU A;  4DOR A;  2Q70 A;  3HC6 A;  5EI1 A;  2EWP A;  2GPU A;  2NXX E;  5DKE A;  4JAZ A;  1R20 D;  5G44 A;  4HLW A;  4CI4 A;  1UHL A;  3OMK A;  5DMC A;  3A2I A;  1G50 A;  3IA6 A;  4MGD B;  3JZB A;  2G0G A;  4IA7 A;  4DMA A;  3WFG A;  3KMG A;  2ZK3 A;  1HG4 A;  1KKQ A;  1Y0X X;  1E3K A;  2YLY A;  4MGD A;  3OLF A;  3V49 A;  5E7V A;  1GS4 A;  3FXV A;  3PRG A;  5DZ0 A;  5EIT A;  5HJP B;  4ZJR A;  2QGT A;  2V7C A;  2PIN A;  4OK1 A;  3QT0 A;  4QL8 A;  2XYW A;  4OED A;  2QZO A;  4ZNV A;  3VJT A;  1T73 A;  3A9E B;  4XLD A;  2I4J A;  1DB1 A;  3B65 A;  4G2H A;  5DIE A;  5DZ3 A;  5DUG A;  3SP6 A;  5DXQ A;  3FC6 B;  5AWK A;  3UU7 B;  4YMQ A;  2REW A;  5HJP A;  2E2R A;  4L98 A;  5DU5 A;  3WT7 A;  1NRL A;  4M8H A;  2YFE A;  3B0R A;  3E94 A;  3A9E A;  4IS8 A;  2IHQ A;  3DZY D;  1S9P A;  3P8X A;  3FC6 A;  3LBD A;  3UU7 A;  2ZK0 A;  3R8D A;  4PWL A;  3UP0 A;  3RUT A;  2ACL A;  2P1U A;  3MNE A;  3L3X A;  4OC7 A;  2OAX A;  3JZC A;  3ZRB A;  2OM9 A;  1Q4X A;  1SQN A;  1XP6 A;  1G1U A;  1YP0 A;  3ADW A;  3VHW A;  1OSV A;  4MDD A;  3AUN A;  5L7H A;  3CQV A;  4J24 A;  4DK8 A;  1T7M A;  1ZH7 A;  5AAV B;  2B23 A;  2OCF A;  1YJE A;  4J5X C;  4IWF A;  3ADU A;  4FHH A;  4IV4 A;  1GWQ A;  4OH5 A;  2AX9 A;  1ILG A;  3G8O A;  3X1H A;  2P1T A;  2AAX A;  3R5N A;  3VT4 A;  2Q7L A;  3FAL A;  2Q1H A;  1NAV A;  2FSZ A;  1SKX A;  2XYJ A;  3OLS A;  1TFC A;  4IVW A;  1Z95 A;  2AXA A;  3DY6 A;  5AAV A;  1I38 A;  3V4A A;  1ZUC A;  1Y0S A;  2PIT A;  1NHZ A;  5DTV A;  4IA2 A;  1XZX X;  2I0G A;  5GIE A;  5AVI A;  1OVL B;  4G20 A;  3H0A D;  2ZMH A;  3VRU A;  4OZR E;  3GN8 A;  2VV1 B;  2PNU A;  1YA3 A;  4ONI A;  3VTC A;  4OLM A;  4WPF A;  2PIU A;  4F9M A;  5G45 A;  2ABI A;  3ERD A;  1M13 A;  4L96 A;  2QSE A;  2Q7J A;  2J7Y A;  2PIO A;  1L2I A;  2Q7I A;  3DCU A;  3KDU A;  3KPZ A;  4IU7 A;  2FVJ A;  2YAT A;  5DZ1 A;  2HAR A;  2VV1 A;  5G42 A;  1NQ2 A;  1YOK A;  5DIG A;  3VHV A;  1QKN A;  2HAM A;  4J5W A;  1FM9 A;  2ATH A;  1U3Q A;  3GWX A;  4POH A;  3GBK A;  5E0W A;  3AN4 A;  3A2J A;  4MG8 B;  2VV0 A;  3RLL A;  4WLB A;  1GWX A;  1PZL A;  5IZ0 A;  5IAW A;  1KNU A;  4OEY A;  3ADS A;  2VV4 B;  4FN9 A;  4FNE A;  3CS4 A;  4MG7 B;  3SP9 A;  5DXR A;  1NDE A;  2YLO A;  2XHS A;  3ET1 A;  4IA1 A;  4JYG A;  4PXM A;  3T03 A;  3FEJ A;  1H9U A;  3VHU A;  4RUO X;  4MG8 A;  2I4P A;  1MV9 A;  4KZI A;  2Q5S A;  2QXM A;  3F5C A;  1NYX A;  2QMV A;  4MG7 A;  4OIL A;  2Z4J A;  1N83 A;  1PQ6 A;  2ZVT A;  3ERT A;  3W5P A;  4RMD A;  3KMR A;  4RMC A;  3TX7 B;  3KYT A;  2QTU A;  1GWR A;  3AZ2 A;  1I7G A;  2P15 A;  4N8R A;  3GZ9 A;  5KCW A;  3PCU A;  4O8F A;  1FD0 A;  2GPO A;  3RVF A;  4PVU A;  1WM0 X;  1XAP A;  4MG9 B;  2V0V A;  3RY9 A;  4CI5 A;  4A2J A;  4RAK A;  4ITE A;  3VRT A;  1L2J A;  2O9I A;  4OH6 A;  3D24 A;  5DID A;  3B0T A;  2ZBS A;  1NQ0 A;  2POG A;  1PQ9 A;  3W5T A;  4MG9 A;  2HFP A;  3A2H A;  3OKI A;  2NPA A;  1XDK A;  2PIR A;  2Q8S A;  3E7C A;  3OSW A;  4S14 A;  5DKG A;  4NIE A;  5EJV A;  1IE8 A;  5KCF A;  1T74 A;  3NOA A;  3W0Y A;  3WT6 A;  5KRO A;  5DZH A;  4N5G A;  3OOK A;  2AWH A;  2HB8 A;  1NAX A;  2PIX A;  2QGW A;  3TY0 A;  2ZXN A;  2Z4B A;  4ZJW A;  1M2Z A;  4REE A;  5DWL A;  4PRG A;  2ZLC A;  3R8I A;  4RUP A;  3KFC A;  3HVL A;  1U3R A;  4EMA A;  2W8Y A;  4K7A A;  5KRC A;  2F4B A;  2P7Z A;  5FQV A;  1PRG A;  3G0W A;  4RE8 A;  5HYK A;  4OAR A;  5DP0 A;  5FQR A;  1FBY A;  2QE4 A;  1XNN A;  2ZNP A;  3W0J A;  3OMO A;  1YIN A;  4BCR A;  4KZM A;  2QA8 B;  3ET3 A;  3IXP A;  3VRV A;  1PDU A;  5C4U A;  2GL8 A;  1QKU A;  5DXE A;  1P93 A;  1X76 A;  2J14 A;  3UUD B;  4CSJ A;  4YPQ A;  5K13 A;  1XIU A;  3OS8 C;  4OEZ A;  3OGT A;  4ZO1 X;  1PQC A;  1ZDU A;  2JJ3 A;  5FQS A;  5KCC A;  2G5O A;  5DVS A;  4LTW A;  4RWV A;  4IWC A;  2IOK A;  2QA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...