5C4UA

Identification of a novel allosteric binding site for rorgt inhibitors
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
241
structure length
241
Chain Sequence
LTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLHKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of an allosteric binding site for ROR gamma t inhibition.
pubmed doi rcsb
molecule keywords Nuclear receptor ROR-gamma
molecule tags Transcription/transcription inhibitor
source organism Homo sapiens
total genus 90
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5c4uA00
5DX3B 5DUEA 1NQ7A 1S19A 2PJLA 2NW4A 1K74D 1Z5XE 2AX7A 4P6XA 5DKEA 5HJPB 1FCZA 1M7WA 2HAMA 4S14A 3O1EA 5G42A 3E00D 4PXMA 1YP0A 2QA8A 1DKFB 2NPAA 2OVMA 5DXPA 2VV1B 4M8EA 4N1YA 4OK1A 5APKA 3RLLA 3UU7A 3FC6B 4OZRE 5KRJA 1XVPB 2P15A 1XNNA 5DU5A 5DXRA 3BQDA 1T7TA 2Z4JA 1Q4XA 4J5WC 5DVSA 5G45A 5LWPA 4OKTA 5KRCA 2ZASA 3P8XA 1PCGA 4OJBA 3W0GA 1OSHA 2Q7JA 2ZFXA 5JJMB 3FXVA 2Q8SA 2YJAB 3R8IA 4NQAB 5HCVA 1P8DA 2Q5SA 4ZO1B 4FNEA 1R1KD 3PBAA 5DWIA 5AZTA 2BJ4A 1OVLB 4OIUA 1XAPA 1NRLA 2XYJA 3E94A 5KYAA 4YT1A 1R6GA 3V9TA 2FAIA 4Q13A 1FCYA 5E15A 3ERTA 4EMAA 1YYEA 3ZRBA 4N73A 5DXQA 3RY9A 2PNUA 2POBA 5A86A 2ZNNA 1XDKB 4J5XC 4S0SA 1XJ7A 3HC5A 3Q95B 4IU7A 4XTAA 3MNEA 2YJDA 5KCDA 5ACCA 3UUAB 3W0YA 5B41A 2J7XA 4G1ZA 2I0JA 2ZK0A 2G0HA 5B5BA 5AWJA 2ZK3A 4R2UA 2P1VA 5DKGA 3W0IA 3DCTA 3IPQA 1T65A 1R20D 2HBHA 2ZBSA 3OMOA 3UP0A 5KCUA 3V3QA 4QJRA 1XLSE 3FURA 3KPZA 3H0AA 2AB2A 5GT4A 1PK5A 2OZ7A 4CSJA 5K13A 4OEAA 5AAVB 5AWKA 3D5FA 2YLPA 4MG9B 3OLFA 5DSHA 5DV6A 5HYKA 3A40X 4ZNWA 1ZAFA 2HB7A 2I4ZA 2AA5A 1QKNA 3AZ1A 4G1DA 4OFUA 2I0GA 5DX3A 5HJSA 4BCRA 4ITEA 3OS8A 3VJIA 4RAKA 5HJPA 3RUTA 5KR9A 2P1TA 1DKFA 1Y0SA 1YOKA 2AA2A 2VV1A 2XYXA 4HEEX 4QK4A 1XZXX 3FC6A 2XYWA 4DM8A 4G21A 1XVPA 2H79A 1ZDTA 3HQ5A 2PITA 4IWFA 3VRVA 4YMQA 5KRMA 3GZ9A 3VRWA 5KCEA 3HVLA 5DVVA 5CJ6A 3ILZA 2PINA 1ZUCA 1XP9A 3H52A 5HZCA 3MNPA 4RFWA 2P4YA 5AYGA 3W0JA 3R29A 5JJMA 5KCFA 3VT7A 2GPPA 4G20A 1SQNA 3ET3A 3ET2A 4MDDA 4PP5A 4IV2A 2FSZA 4KZIA 4DORA 5KCWA 4L98A 3VSPA 2JJ3A 2P7GA 1OVLA 5DL4A 2ZL9A 2AAXA 3A78A 5H1EA 3KWYA 4G2IA 4OIVA 5KYJA 1PRGA 2AX9A 3ERDA 2PIQA 4WQPA 2AX6A 3VRTA 4POHA 2ATHA 3VT3A 1XDKA 1U3SA 5L7HA 3W0CA 4OC7A 3Q95A 4IW6A 2Q7KA 4IUIA 1IE8A 4RZFA 5DXKA 3B67A 3UUAA 3GD2A 1T63A 4R06A 3B66A 3DT3A 1T73A 1UPVA 5IAWA 4A4WA 2Q59B 3UUCA 3VHUA 1A28A 1NAVA 4XI3A 5DRMA 3W5RA 1TFCA 1Z95A 3D6DA 5FQVA 3OSWA 5KROA 5AK2A 5DWLA 3V3EA 4QE8A 5DLRA 4REFA 3V9YA 1XOWA 3B0TA 3ADXA 4LNXA 4QM0A 2OCFA 1A52A 3OMPA 5DP0A 4MGCA 1NHZA 5AAVA 3VRUA 5L7EA 5HYRA 1NQ0A 3X1HA 3ET0A 4ONIA 4MG9A 5DXEA 5KRLA 2QW4A 4WLBA 5APHA 3A2IA 1VJBA 2QR9A 4HLWA 5DIGA 4NIEA 5DV3A 3GYUA 3SP9A 2A3IA 3EYBA 4QL8A 3AX8A 3VJHA 4EM9A 1BSXA 1ZGYA 4XT9A 3WFGA 3CQVA 5DZ1A 1SKXA 2HARA 4TV1B 1YUCA 4RE8A 2V0VA 2QMVA 2PIWA 5JI0D 3L03A 4OARA 1FCXA 1U9EA 1T5ZA 2GP7A 4PLEA 3V9VA 2ZNQA 1RJKA 1RK3A 2JFAB 5DTVA 4PPSA 5ETHA 3KMRA 2R6WA 3CTBA 4OKWA 3OZ0A 2Q6JA 2R40D 3HZFA 5I4VA 2AA7A 2OUZA 1YINA 3P89A 3F5CB 1G2NA 2B23A 3X36A 3G8IA 1GWQA 4QE6A 2YLYA 2P54A 2QABA 3WGPA 5IZ0A 2I4PA 4PLDA 2GL8A 3W5TA 2QE4A 5C4OA 5G46A 3VI8A 3WT6A 1PQ6A 2ZXNA 2O4RA 3HM1A 5E14A 3TX7B 1S0XA 5ICKA 3S9SA 4IQRA 2AMBA 2OAXA 2E2RA 3JZCA 3OS9A 1T79A 4IA2A 4ZNUA 4ITFA 2JF9A 3CLDA 2VV0A 1X7BA 1I7GA 1L2IA 2ZMIA 1ZEOA 2HC4A 5AAUA 2POGA 3KFCA 2QTUA 3OS8C 3CWDA 5C4SA 1N46A 4MG6A 3GYTA 1I38A 1T7RA 2NXXA 2Q59A 2XKWA 4JL4A 4B7WA 2VSTA 3VSOA 3R5MA 4RWVA 1NYXA 5AVIA 1FM9A 3B65A 3VHVA 4Q0AC 1R5KA 3PRGA 2PRGA 4N5GA 5DK9A 4MGDB 3K8SA 4IS8A 4OGHA 2AMAA 4XAOA 4OH5A 1NQ1A 1MVCA 1KV6A 3OZJA 4OJ9A 5DVCA 5LGAA 1XNXA 2GPUA 3KYTA 4J5WA 5G44A 3A3ZX 1FM6A 3HC6A 3K22A 2ZY0A 3BEJA 3ZQTA 2REWA 4TV1A 1QKMA 4MG8B 4OEDA 5KRFA 4ZNHA 1X7RA 2ZMHA 3T03A 1XQCA 2AXAA 3BC5A 3GWXA 5DWJA 1PDUA 3B5RA 5DMCA 5E7VA 3KDTA 2O4JA 4FHIA 4WHGA 4NB6A 2G5OA 2F4BA 1T7MA 2JFAA 3FS1A 1X76A 3GWSX 1XIUA 3K23A 4IWCA 2AYRA 4OJ4A 4JGVA 4K7AA 1RKGA 1QKUA 2Q60A 3R5NA 1I37A 4NUFA 1DB1A 5GIEA 1N4HA 5E19A 2ZK2A 3F5CA 5KRKA 4MGAB 1M13A 1YMTA 3NSPA 2Q7LA 4KZMA 2B1VA 5DZ0A 1G50A 1UHLB 4OZTU 3VN2A 3W0AA 4OILA 5KRIA 3CS8A 5DXGA 1RDTA 4K6IA 2ACLB 3LBDA 3F7DA 1GWRA 5E1CA 3E00A 3HODA 4UDBA 3OLLA 5E0XA 2EWPA 3B0WA 2ZXZA 3ADVA 4OZTE 3DCUA 5DYBA 3OLSA 4OKXA 1YY4A 2HCDA 2ZK6A 3A2JA 4OEYA 2QNVA 2FVJA 3W0HA 1NDEA 2V7CA 3IA6A 4K4JA 4MG7B 5SYZA 2IOKA 5EHJA 2AO6A 1T7FA 1TXIA 1ZDUA 4RMDA 5DUGA 5KRAA 5L7GA 2VV4B 3AFRA 1KNUA 4PP3A 2G0GA 2P1UA 2HASA 2Q5PA 4LBDA 3WMHA 4ZN9A 5KRHA 3DZYA 4OH6A 2GPVA 1FM9D 2ZLAA 1FBYA 3ADWA 4MGDA 4OEZA 4G1YA 3R8AA 2GIUA 1E3KA 1G5YA 3H0AD 5DIDA 2VSRA 3B0QA 3WJ5A 1N83A 3OOFA 4DMAA 3L0JA 1U3RA 4DQMA 1QKTA 2GPOA 3ZRAA 1XPCA 1EREA 1XV9B 1Y0XX 2O9IA 1U3QA 3WTQA 1ZKYA 3V4AA 1FM6D 3WJ4A 1NQ2A 4IVYA 4MG8A 4UDCA 1OSVA 3AN3A 4JAZA 2YLQA 3UVVB 2P7AA 3B3KA 3DZUA 4XHDA 1YJEA 2ZLCA 5DWGA 1UPWA 3OAPA 4IW8A 5EJVA 3VTCA 1XP6A 4WVDA 2HB8A 4Y29A 2HVCA 1MZNA 4LSJA 4ZOMA 4DK7A 2QSEA 1M2ZA 2PIPL 3D90A 1XQ3A 3ADTA 3L0LA 2AX8A 2ZKCA 4IA3A 4PPPA 2ZXMA 4MGAA 4ZJRA 2HWQA 3DZYD 4TUZB 1UHLA 2QZOB 3R2AA 1GS4A 5DIEA 3VT4A 2ACLA 3NOAA 2YHDA 1RDTD 1WM0X 4JYGA 3OKHA 1S0ZA 1X7JA 2PKLA 3PEQA 2QGWA 5DV8A 4E4KA 1PQ9A 2NXXE 1X7EA 2ZNPA 3NSQA 4MGBB 1PQCA 5APJA 4APUA 4CI4A 2ZNOA 5JY3A 4F9MA 4RZGA 3W5QA 3L3XA 3RLJA 4IV4A 3AUQA 3FEJA 5DUHA 1K4WA 3B0RA 1G1UA 2Q61A 5GICA 4RZEA 4X1FA 1Y9RA 3VT8A 3X31A 4RUPA 3WFFA 4MG7A 5E0WA 4R6SA 2B1ZA 3AN4A 4PVUA 4ZNSA 4X1GA 3ZR7A 5DWEA 2VV4A 3MNOA 5KD9A 2QGTA 2OVHA 2PIXA 3KMZA 4IA7A 2Q7IA 4REEA 3L1BA 4N8RA 5DRJA 2Q70A 3G9EA 4LNWA 4ZO1X 1P93A 3A2HA 5DZ3A 3VT9A 3D57A 5DYDA 1EXAA 4ZNTA 2NV7A 1YIMA 2Q6RA 3E7CA 3IPSA 3OMQA 5AZVA 4WPFA 1MV9A 3TKMA 3VJSA 4ZN7A 3WT7A 4NY9A 5AVLA 3AUNA 4OLMA 4IA1A 3DY6A 5C4TA 3B68A 3AZ2A 3B1MA 1KKQA 4YPQA 3CS4A 1IE9A 2YATA 3DR1A 3L0EA 4FN9A 1XV9A 2G44A 2GTKA 5EC9A 3K6PA 4DOSA 4J26A 3SP6A 3PO9A 3P0UA 5EITA 3UVVA 3KDUA 3IXPA 3O1DA 5IXKA 1XB7A 2IHQA 2ABIA 2LBDA 3OOKA 3FALB 3OSIA 3QT0A 5FQPA 1SR7A 2ZK1A 3KBAA 3L3ZA 4ZI1A 2YLOA 1LV2A 4L96A 3DZUD 3X1IA 1RKHA 4CI5A 1ERRA 4FHHA 4RMCA 3UUDB 3P88A 5DKSA 5G3JA 5DXBB 2Q6SA 5C4UA 3UP3A 3VTBA 2AM9A 2QXMA 4WHFA 5F9BA 4LTWA 2AA6A 1NAXA 3KMGA 4TUZA 2AWHA 3GBKA 1HG4A 2QXSA 2QZOA 3AURA 3N00A 3VJTA 3TY0A 2HFPA 1OT7A 3HLVA 1I7IA 4J24A 3V49A 1YA3A 4JYIA 3A9EB 1SJ0A 4J5XA 1XLSA 2W8YA 5M96A 2QH6A 1K74A 2B50A 4DM6A 2QA6A 2ZMJA 5L11A 4S0TA 2ZVTA 4MGBA 4PF3A 3WT5A 1S9QA 5DZHA 2HWRA 2IOGA 4A4VA 2QA8B 2VV3A 3UU7B 3CS6A 4ZJWA 1UOMA 3ADSA 4UDAA 1T74A 4RUOX 4S15A 5DY8A 4E4QA 3FEIA 4FGYA 2R40A 3JZBA 1ILGA 5EGVA 1PZLA 3AZ3A 2VV2A 2GWXA 4PP6A 4E2JA 5G5WA 3TKCA 4XUMA 5EI1A 3OMMA 1YOWA 4OHAA 5G43A 1LBDA 2PIVA 4A2JA 3LMPA 4OKBA 4RMEA 1R1KA 2Q1HA 2Q5GA 4Q50A 4UDDA 3HO0A 3IPUA 2PIOA 5DMFA 2BJ4B 5FQSA 3ADUA 4PRGA 3FUGA 3OGTA 4KZJA 3GN8A 2OM9A 2Z4BA 5FQRA 3VHWA 4DK8A 2Q3YA 3ET1A 2BAWA 3IMYA 1X78A 4XUHA 2R6YA 3VT5A 3U9QA 4PWLA 3CDPA 2YFEA 1HJ1A 5DXMA 3D24A 2PIRA 4RUJA 1T76A 3RVFA 2QPYA 2ZK5A 2ZK4A 3CDSA 1H9UA 1S9PA 1L2JA 4OFRA 1E3GA 5DKBA 3FALA 2H77A 3IXPD 3OMKA 3PLZA 3RUUA 2J14A 5DZIA 5FQTA 5KCTA 1ZH7A 2Q1VA 3CJWA 4M8HA 3M7RA 3OSAA 4POJA 2P7ZA 1R20A 4ZNVA 3PCUA 5GIDA 1K7LA 3UUDA 1GWXA 2J4AA 5DXBA 3OKIA 2J7YA 3VT6A 4P6WA 1NUOA 3FLIA 3W5PA 1FD0A 4JYHA 4YNKA 2PIUA 1EXXA 1Z5XU 4G2HA 4IVWA 4O8FA 4XLDA 5DI7A 3G0WA 3SZ1A 2I4JA 3G8OA 1ILHA 3VTDA 5KCCA 3A9EA 2XHSA 3R8DA 1XP1A 4MG5A 4OZRU 3WWRA
chains in the Genus database with same CATH superfamily
5DX3B 5DUEA 1NQ7A 1S19A 2PJLA 2NW4A 1K74D 1Z5XE 2AX7A 4P6XA 5DKEA 5HJPB 1FCZA 1M7WA 2HAMA 4S14A 3O1EA 5G42A 3E00D 4PXMA 1YP0A 2QA8A 1DKFB 2NPAA 2OVMA 5DXPA 2VV1B 4M8EA 4N1YA 4OK1A 5APKA 3RLLA 3UU7A 3FC6B 4OZRE 5KRJA 1XVPB 2P15A 1XNNA 5DU5A 5DXRA 3BQDA 1T7TA 2Z4JA 1Q4XA 4J5WC 5DVSA 5G45A 5LWPA 4OKTA 5KRCA 2ZASA 3P8XA 1PCGA 4OJBA 3W0GA 1OSHA 2Q7JA 2ZFXA 5JJMB 3FXVA 2Q8SA 2YJAB 3R8IA 4NQAB 5HCVA 1P8DA 2Q5SA 4ZO1B 4FNEA 1R1KD 3PBAA 5DWIA 5AZTA 2BJ4A 1OVLB 4OIUA 1XAPA 1NRLA 2XYJA 3E94A 5KYAA 4YT1A 1R6GA 3V9TA 2FAIA 4Q13A 1FCYA 5E15A 3ERTA 4EMAA 1YYEA 3ZRBA 4N73A 5DXQA 3RY9A 2PNUA 2POBA 5A86A 2ZNNA 1XDKB 4J5XC 4S0SA 1XJ7A 3HC5A 3Q95B 4IU7A 4XTAA 3MNEA 2YJDA 5KCDA 5ACCA 3UUAB 3W0YA 5B41A 2J7XA 4G1ZA 2I0JA 2ZK0A 2G0HA 5B5BA 5AWJA 2ZK3A 4R2UA 2P1VA 5DKGA 3W0IA 3DCTA 3IPQA 1T65A 1R20D 2HBHA 2ZBSA 3OMOA 3UP0A 5KCUA 3V3QA 4QJRA 1XLSE 3FURA 3KPZA 3H0AA 2AB2A 5GT4A 1PK5A 2OZ7A 4CSJA 5K13A 4OEAA 5AAVB 5AWKA 3D5FA 2YLPA 4MG9B 3OLFA 5DSHA 5DV6A 5HYKA 3A40X 4ZNWA 1ZAFA 2HB7A 2I4ZA 2AA5A 1QKNA 3AZ1A 4G1DA 4OFUA 2I0GA 5DX3A 5HJSA 4BCRA 4ITEA 3OS8A 3VJIA 4RAKA 5HJPA 3RUTA 5KR9A 2P1TA 1DKFA 1Y0SA 1YOKA 2AA2A 2VV1A 2XYXA 4HEEX 4QK4A 1XZXX 3FC6A 2XYWA 4DM8A 4G21A 1XVPA 2H79A 1ZDTA 3HQ5A 2PITA 4IWFA 3VRVA 4YMQA 5KRMA 3GZ9A 3VRWA 5KCEA 3HVLA 5DVVA 5CJ6A 3ILZA 2PINA 1ZUCA 1XP9A 3H52A 5HZCA 3MNPA 4RFWA 2P4YA 5AYGA 3W0JA 3R29A 5JJMA 5KCFA 3VT7A 2GPPA 4G20A 1SQNA 3ET3A 3ET2A 4MDDA 4PP5A 4IV2A 2FSZA 4KZIA 4DORA 5KCWA 4L98A 3VSPA 2JJ3A 2P7GA 1OVLA 5DL4A 2ZL9A 2AAXA 3A78A 5H1EA 3KWYA 4G2IA 4OIVA 5KYJA 1PRGA 2AX9A 3ERDA 2PIQA 4WQPA 2AX6A 3VRTA 4POHA 2ATHA 3VT3A 1XDKA 1U3SA 5L7HA 3W0CA 4OC7A 3Q95A 4IW6A 2Q7KA 4IUIA 1IE8A 4RZFA 5DXKA 3B67A 3UUAA 3GD2A 1T63A 4R06A 3B66A 3DT3A 1T73A 1UPVA 5IAWA 4A4WA 2Q59B 3UUCA 3VHUA 1A28A 1NAVA 4XI3A 5DRMA 3W5RA 1TFCA 1Z95A 3D6DA 5FQVA 3OSWA 5KROA 5AK2A 5DWLA 3V3EA 4QE8A 5DLRA 4REFA 3V9YA 1XOWA 3B0TA 3ADXA 4LNXA 4QM0A 2OCFA 1A52A 3OMPA 5DP0A 4MGCA 1NHZA 5AAVA 3VRUA 5L7EA 5HYRA 1NQ0A 3X1HA 3ET0A 4ONIA 4MG9A 5DXEA 5KRLA 2QW4A 4WLBA 5APHA 3A2IA 1VJBA 2QR9A 4HLWA 5DIGA 4NIEA 5DV3A 3GYUA 3SP9A 2A3IA 3EYBA 4QL8A 3AX8A 3VJHA 4EM9A 1BSXA 1ZGYA 4XT9A 3WFGA 3CQVA 5DZ1A 1SKXA 2HARA 4TV1B 1YUCA 4RE8A 2V0VA 2QMVA 2PIWA 5JI0D 3L03A 4OARA 1FCXA 1U9EA 1T5ZA 2GP7A 4PLEA 3V9VA 2ZNQA 1RJKA 1RK3A 2JFAB 5DTVA 4PPSA 5ETHA 3KMRA 2R6WA 3CTBA 4OKWA 3OZ0A 2Q6JA 2R40D 3HZFA 5I4VA 2AA7A 2OUZA 1YINA 3P89A 3F5CB 1G2NA 2B23A 3X36A 3G8IA 1GWQA 4QE6A 2YLYA 2P54A 2QABA 3WGPA 5IZ0A 2I4PA 4PLDA 2GL8A 3W5TA 2QE4A 5C4OA 5G46A 3VI8A 3WT6A 1PQ6A 2ZXNA 2O4RA 3HM1A 5E14A 3TX7B 1S0XA 5ICKA 3S9SA 4IQRA 2AMBA 2OAXA 2E2RA 3JZCA 3OS9A 1T79A 4IA2A 4ZNUA 4ITFA 2JF9A 3CLDA 2VV0A 1X7BA 1I7GA 1L2IA 2ZMIA 1ZEOA 2HC4A 5AAUA 2POGA 3KFCA 2QTUA 3OS8C 3CWDA 5C4SA 1N46A 4MG6A 3GYTA 1I38A 1T7RA 2NXXA 2Q59A 2XKWA 4JL4A 4B7WA 2VSTA 3VSOA 3R5MA 4RWVA 1NYXA 5AVIA 1FM9A 3B65A 3VHVA 4Q0AC 1R5KA 3PRGA 2PRGA 4N5GA 5DK9A 4MGDB 3K8SA 4IS8A 4OGHA 2AMAA 4XAOA 4OH5A 1NQ1A 1MVCA 1KV6A 3OZJA 4OJ9A 5DVCA 5LGAA 1XNXA 2GPUA 3KYTA 4J5WA 5G44A 3A3ZX 1FM6A 3HC6A 3K22A 2ZY0A 3BEJA 3ZQTA 2REWA 4TV1A 1QKMA 4MG8B 4OEDA 5KRFA 4ZNHA 1X7RA 2ZMHA 3T03A 1XQCA 2AXAA 3BC5A 3GWXA 5DWJA 1PDUA 3B5RA 5DMCA 5E7VA 3KDTA 2O4JA 4FHIA 4WHGA 4NB6A 2G5OA 2F4BA 1T7MA 2JFAA 3FS1A 1X76A 3GWSX 1XIUA 3K23A 4IWCA 2AYRA 4OJ4A 4JGVA 4K7AA 1RKGA 1QKUA 2Q60A 3R5NA 1I37A 4NUFA 1DB1A 5GIEA 1N4HA 5E19A 2ZK2A 3F5CA 5KRKA 4MGAB 1M13A 1YMTA 3NSPA 2Q7LA 4KZMA 2B1VA 5DZ0A 1G50A 1UHLB 4OZTU 3VN2A 3W0AA 4OILA 5KRIA 3CS8A 5DXGA 1RDTA 4K6IA 2ACLB 3LBDA 3F7DA 1GWRA 5E1CA 3E00A 3HODA 4UDBA 3OLLA 5E0XA 2EWPA 3B0WA 2ZXZA 3ADVA 4OZTE 3DCUA 5DYBA 3OLSA 4OKXA 1YY4A 2HCDA 2ZK6A 3A2JA 4OEYA 2QNVA 2FVJA 3W0HA 1NDEA 2V7CA 3IA6A 4K4JA 4MG7B 5SYZA 2IOKA 5EHJA 2AO6A 1T7FA 1TXIA 1ZDUA 4RMDA 5DUGA 5KRAA 5L7GA 2VV4B 3AFRA 1KNUA 4PP3A 2G0GA 2P1UA 2HASA 2Q5PA 4LBDA 3WMHA 4ZN9A 5KRHA 3DZYA 4OH6A 2GPVA 1FM9D 2ZLAA 1FBYA 3ADWA 4MGDA 4OEZA 4G1YA 3R8AA 2GIUA 1E3KA 1G5YA 3H0AD 5DIDA 2VSRA 3B0QA 3WJ5A 1N83A 3OOFA 4DMAA 3L0JA 1U3RA 4DQMA 1QKTA 2GPOA 3ZRAA 1XPCA 1EREA 1XV9B 1Y0XX 2O9IA 1U3QA 3WTQA 1ZKYA 3V4AA 1FM6D 3WJ4A 1NQ2A 4IVYA 4MG8A 4UDCA 1OSVA 3AN3A 4JAZA 2YLQA 3UVVB 2P7AA 3B3KA 3DZUA 4XHDA 1YJEA 2ZLCA 5DWGA 1UPWA 3OAPA 4IW8A 5EJVA 3VTCA 1XP6A 4WVDA 2HB8A 4Y29A 2HVCA 1MZNA 4LSJA 4ZOMA 4DK7A 2QSEA 1M2ZA 2PIPL 3D90A 1XQ3A 3ADTA 3L0LA 2AX8A 2ZKCA 4IA3A 4PPPA 2ZXMA 4MGAA 4ZJRA 2HWQA 3DZYD 4TUZB 1UHLA 2QZOB 3R2AA 1GS4A 5DIEA 3VT4A 2ACLA 3NOAA 2YHDA 1RDTD 1WM0X 4JYGA 3OKHA 1S0ZA 1X7JA 2PKLA 3PEQA 2QGWA 5DV8A 4E4KA 1PQ9A 2NXXE 1X7EA 2ZNPA 3NSQA 4MGBB 1PQCA 5APJA 4APUA 4CI4A 2ZNOA 5JY3A 4F9MA 4RZGA 3W5QA 3L3XA 3RLJA 4IV4A 3AUQA 3FEJA 5DUHA 1K4WA 3B0RA 1G1UA 2Q61A 5GICA 4RZEA 4X1FA 1Y9RA 3VT8A 3X31A 4RUPA 3WFFA 4MG7A 5E0WA 4R6SA 2B1ZA 3AN4A 4PVUA 4ZNSA 4X1GA 3ZR7A 5DWEA 2VV4A 3MNOA 5KD9A 2QGTA 2OVHA 2PIXA 3KMZA 4IA7A 2Q7IA 4REEA 3L1BA 4N8RA 5DRJA 2Q70A 3G9EA 4LNWA 4ZO1X 1P93A 3A2HA 5DZ3A 3VT9A 3D57A 5DYDA 1EXAA 4ZNTA 2NV7A 1YIMA 2Q6RA 3E7CA 3IPSA 3OMQA 5AZVA 4WPFA 1MV9A 3TKMA 3VJSA 4ZN7A 3WT7A 4NY9A 5AVLA 3AUNA 4OLMA 4IA1A 3DY6A 5C4TA 3B68A 3AZ2A 3B1MA 1KKQA 4YPQA 3CS4A 1IE9A 2YATA 3DR1A 3L0EA 4FN9A 1XV9A 2G44A 2GTKA 5EC9A 3K6PA 4DOSA 4J26A 3SP6A 3PO9A 3P0UA 5EITA 3UVVA 3KDUA 3IXPA 3O1DA 5IXKA 1XB7A 2IHQA 2ABIA 2LBDA 3OOKA 3FALB 3OSIA 3QT0A 5FQPA 1SR7A 2ZK1A 3KBAA 3L3ZA 4ZI1A 2YLOA 1LV2A 4L96A 3DZUD 3X1IA 1RKHA 4CI5A 1ERRA 4FHHA 4RMCA 3UUDB 3P88A 5DKSA 5G3JA 5DXBB 2Q6SA 5C4UA 3UP3A 3VTBA 2AM9A 2QXMA 4WHFA 5F9BA 4LTWA 2AA6A 1NAXA 3KMGA 4TUZA 2AWHA 3GBKA 1HG4A 2QXSA 2QZOA 3AURA 3N00A 3VJTA 3TY0A 2HFPA 1OT7A 3HLVA 1I7IA 4J24A 3V49A 1YA3A 4JYIA 3A9EB 1SJ0A 4J5XA 1XLSA 2W8YA 5M96A 2QH6A 1K74A 2B50A 4DM6A 2QA6A 2ZMJA 5L11A 4S0TA 2ZVTA 4MGBA 4PF3A 3WT5A 1S9QA 5DZHA 2HWRA 2IOGA 4A4VA 2QA8B 2VV3A 3UU7B 3CS6A 4ZJWA 1UOMA 3ADSA 4UDAA 1T74A 4RUOX 4S15A 5DY8A 4E4QA 3FEIA 4FGYA 2R40A 3JZBA 1ILGA 5EGVA 1PZLA 3AZ3A 2VV2A 2GWXA 4PP6A 4E2JA 5G5WA 3TKCA 4XUMA 5EI1A 3OMMA 1YOWA 4OHAA 5G43A 1LBDA 2PIVA 4A2JA 3LMPA 4OKBA 4RMEA 1R1KA 2Q1HA 2Q5GA 4Q50A 4UDDA 3HO0A 3IPUA 2PIOA 5DMFA 2BJ4B 5FQSA 3ADUA 4PRGA 3FUGA 3OGTA 4KZJA 3GN8A 2OM9A 2Z4BA 5FQRA 3VHWA 4DK8A 2Q3YA 3ET1A 2BAWA 3IMYA 1X78A 4XUHA 2R6YA 3VT5A 3U9QA 4PWLA 3CDPA 2YFEA 1HJ1A 5DXMA 3D24A 2PIRA 4RUJA 1T76A 3RVFA 2QPYA 2ZK5A 2ZK4A 3CDSA 1H9UA 1S9PA 1L2JA 4OFRA 1E3GA 5DKBA 3FALA 2H77A 3IXPD 3OMKA 3PLZA 3RUUA 2J14A 5DZIA 5FQTA 5KCTA 1ZH7A 2Q1VA 3CJWA 4M8HA 3M7RA 3OSAA 4POJA 2P7ZA 1R20A 4ZNVA 3PCUA 5GIDA 1K7LA 3UUDA 1GWXA 2J4AA 5DXBA 3OKIA 2J7YA 3VT6A 4P6WA 1NUOA 3FLIA 3W5PA 1FD0A 4JYHA 4YNKA 2PIUA 1EXXA 1Z5XU 4G2HA 4IVWA 4O8FA 4XLDA 5DI7A 3G0WA 3SZ1A 2I4JA 3G8OA 1ILHA 3VTDA 5KCCA 3A9EA 2XHSA 3R8DA 1XP1A 4MG5A 4OZRU 3WWRA
chains in the Genus database with same CATH topology
5DX3B 5DUEA 1NQ7A 1S19A 2PJLA 2NW4A 1K74D 1Z5XE 2AX7A 4P6XA 5DKEA 5HJPB 1FCZA 1M7WA 2HAMA 4S14A 3O1EA 5G42A 3E00D 4PXMA 1YP0A 2QA8A 1DKFB 2NPAA 2OVMA 5DXPA 2VV1B 4M8EA 4N1YA 4OK1A 5APKA 3RLLA 3UU7A 3FC6B 4OZRE 5KRJA 1XVPB 2P15A 1XNNA 5DU5A 5DXRA 3BQDA 1T7TA 2Z4JA 1Q4XA 4J5WC 5DVSA 5G45A 5LWPA 4OKTA 5KRCA 2ZASA 3P8XA 1PCGA 4OJBA 3W0GA 1OSHA 2Q7JA 2ZFXA 5JJMB 3FXVA 2Q8SA 2YJAB 3R8IA 4NQAB 5HCVA 1P8DA 2Q5SA 4ZO1B 4FNEA 1R1KD 3PBAA 5DWIA 5AZTA 2BJ4A 1OVLB 4OIUA 1XAPA 1NRLA 2XYJA 3E94A 5KYAA 4YT1A 1R6GA 3V9TA 2FAIA 4Q13A 1FCYA 5E15A 3ERTA 4EMAA 1YYEA 3ZRBA 4N73A 5DXQA 3RY9A 2PNUA 2POBA 5A86A 2ZNNA 1XDKB 4J5XC 4S0SA 1XJ7A 3HC5A 3Q95B 4IU7A 4XTAA 3MNEA 2YJDA 5KCDA 5ACCA 3UUAB 3W0YA 5B41A 2J7XA 4G1ZA 2I0JA 2ZK0A 2G0HA 5B5BA 5AWJA 2ZK3A 4R2UA 2P1VA 5DKGA 3W0IA 3DCTA 3IPQA 1T65A 1R20D 2HBHA 2ZBSA 3OMOA 3UP0A 5KCUA 3V3QA 4QJRA 1XLSE 3FURA 3KPZA 3H0AA 2AB2A 5GT4A 1PK5A 2OZ7A 4CSJA 5K13A 4OEAA 5AAVB 5AWKA 3D5FA 2YLPA 4MG9B 3OLFA 5DSHA 5DV6A 5HYKA 3A40X 4ZNWA 1ZAFA 2HB7A 2I4ZA 2AA5A 1QKNA 3AZ1A 4G1DA 4OFUA 2I0GA 5DX3A 5HJSA 4BCRA 4ITEA 3OS8A 3VJIA 4RAKA 5HJPA 3RUTA 5KR9A 2P1TA 1DKFA 1Y0SA 1YOKA 2AA2A 2VV1A 2XYXA 4HEEX 4QK4A 1XZXX 3FC6A 2XYWA 4DM8A 4G21A 1XVPA 2H79A 1ZDTA 3HQ5A 2PITA 4IWFA 3VRVA 4YMQA 5KRMA 3GZ9A 3VRWA 5KCEA 3HVLA 5DVVA 5CJ6A 3ILZA 2PINA 1ZUCA 1XP9A 3H52A 5HZCA 3MNPA 4RFWA 2P4YA 5AYGA 3W0JA 3R29A 5JJMA 5KCFA 3VT7A 2GPPA 4G20A 1SQNA 3ET3A 3ET2A 4MDDA 4PP5A 4IV2A 2FSZA 4KZIA 4DORA 5KCWA 4L98A 3VSPA 2JJ3A 2P7GA 1OVLA 5DL4A 2ZL9A 2AAXA 3A78A 5H1EA 3KWYA 4G2IA 4OIVA 5KYJA 1PRGA 2AX9A 3ERDA 2PIQA 4WQPA 2AX6A 3VRTA 4POHA 2ATHA 3VT3A 1XDKA 1U3SA 5L7HA 3W0CA 4OC7A 3Q95A 4IW6A 2Q7KA 4IUIA 1IE8A 4RZFA 5DXKA 3B67A 3UUAA 3GD2A 1T63A 4R06A 3B66A 3DT3A 1T73A 1UPVA 5IAWA 4A4WA 2Q59B 3UUCA 3VHUA 1A28A 1NAVA 4XI3A 5DRMA 3W5RA 1TFCA 1Z95A 3D6DA 5FQVA 3OSWA 5KROA 5AK2A 5DWLA 3V3EA 4QE8A 5DLRA 4REFA 3V9YA 1XOWA 3B0TA 3ADXA 4LNXA 4QM0A 2OCFA 1A52A 3OMPA 5DP0A 4MGCA 1NHZA 5AAVA 3VRUA 5L7EA 5HYRA 1NQ0A 3X1HA 3ET0A 4ONIA 4MG9A 5DXEA 5KRLA 2QW4A 4WLBA 5APHA 3A2IA 1VJBA 2QR9A 4HLWA 5DIGA 4NIEA 5DV3A 3GYUA 3SP9A 2A3IA 3EYBA 4QL8A 3AX8A 3VJHA 4EM9A 1BSXA 1ZGYA 4XT9A 3WFGA 3CQVA 5DZ1A 1SKXA 2HARA 4TV1B 1YUCA 4RE8A 2V0VA 2QMVA 2PIWA 5JI0D 3L03A 4OARA 1FCXA 1U9EA 1T5ZA 2GP7A 4PLEA 3V9VA 2ZNQA 1RJKA 1RK3A 2JFAB 5DTVA 4PPSA 5ETHA 3KMRA 2R6WA 3CTBA 4OKWA 3OZ0A 2Q6JA 2R40D 3HZFA 5I4VA 2AA7A 2OUZA 1YINA 3P89A 3F5CB 1G2NA 2B23A 3X36A 3G8IA 1GWQA 4QE6A 2YLYA 2P54A 2QABA 3WGPA 5IZ0A 2I4PA 4PLDA 2GL8A 3W5TA 2QE4A 5C4OA 5G46A 3VI8A 3WT6A 1PQ6A 2ZXNA 2O4RA 3HM1A 5E14A 3TX7B 1S0XA 5ICKA 3S9SA 4IQRA 2AMBA 2OAXA 2E2RA 3JZCA 3OS9A 1T79A 4IA2A 4ZNUA 4ITFA 2JF9A 3CLDA 2VV0A 1X7BA 1I7GA 1L2IA 2ZMIA 1ZEOA 2HC4A 5AAUA 2POGA 3KFCA 2QTUA 3OS8C 3CWDA 5C4SA 1N46A 4MG6A 3GYTA 1I38A 1T7RA 2NXXA 2Q59A 2XKWA 4JL4A 4B7WA 2VSTA 3VSOA 3R5MA 4RWVA 1NYXA 5AVIA 1FM9A 3B65A 3VHVA 4Q0AC 1R5KA 3PRGA 2PRGA 4N5GA 5DK9A 4MGDB 3K8SA 4IS8A 4OGHA 2AMAA 4XAOA 4OH5A 1NQ1A 1MVCA 1KV6A 3OZJA 4OJ9A 5DVCA 5LGAA 1XNXA 2GPUA 3KYTA 4J5WA 5G44A 3A3ZX 1FM6A 3HC6A 3K22A 2ZY0A 3BEJA 3ZQTA 2REWA 4TV1A 1QKMA 4MG8B 4OEDA 5KRFA 4ZNHA 1X7RA 2ZMHA 3T03A 1XQCA 2AXAA 3BC5A 3GWXA 5DWJA 1PDUA 3B5RA 5DMCA 5E7VA 3KDTA 2O4JA 4FHIA 4WHGA 4NB6A 2G5OA 2F4BA 1T7MA 2JFAA 3FS1A 1X76A 3GWSX 1XIUA 3K23A 4IWCA 2AYRA 4OJ4A 4JGVA 4K7AA 1RKGA 1QKUA 2Q60A 3R5NA 1I37A 4NUFA 1DB1A 5GIEA 1N4HA 5E19A 2ZK2A 3F5CA 5KRKA 4MGAB 1M13A 1YMTA 3NSPA 2Q7LA 4KZMA 2B1VA 5DZ0A 1G50A 1UHLB 4OZTU 3VN2A 3W0AA 4OILA 5KRIA 3CS8A 5DXGA 1RDTA 4K6IA 2ACLB 3LBDA 3F7DA 1GWRA 5E1CA 3E00A 3HODA 4UDBA 3OLLA 5E0XA 2EWPA 3B0WA 2ZXZA 3ADVA 4OZTE 3DCUA 5DYBA 3OLSA 4OKXA 1YY4A 2HCDA 2ZK6A 3A2JA 4OEYA 2QNVA 2FVJA 3W0HA 1NDEA 2V7CA 3IA6A 4K4JA 4MG7B 5SYZA 2IOKA 5EHJA 2AO6A 1T7FA 1TXIA 1ZDUA 4RMDA 5DUGA 5KRAA 5L7GA 2VV4B 3AFRA 1KNUA 4PP3A 2G0GA 2P1UA 2HASA 2Q5PA 4LBDA 3WMHA 4ZN9A 5KRHA 3DZYA 4OH6A 2GPVA 1FM9D 2ZLAA 1FBYA 3ADWA 4MGDA 4OEZA 4G1YA 3R8AA 2GIUA 1E3KA 1G5YA 3H0AD 5DIDA 2VSRA 3B0QA 3WJ5A 1N83A 3OOFA 4DMAA 3L0JA 1U3RA 4DQMA 1QKTA 2GPOA 3ZRAA 1XPCA 1EREA 1XV9B 1Y0XX 2O9IA 1U3QA 3WTQA 1ZKYA 3V4AA 1FM6D 3WJ4A 1NQ2A 4IVYA 4MG8A 4UDCA 1OSVA 3AN3A 4JAZA 2YLQA 3UVVB 2P7AA 3B3KA 3DZUA 4XHDA 1YJEA 2ZLCA 5DWGA 1UPWA 3OAPA 4IW8A 5EJVA 3VTCA 1XP6A 4WVDA 2HB8A 4Y29A 2HVCA 1MZNA 4LSJA 4ZOMA 4DK7A 2QSEA 1M2ZA 2PIPL 3D90A 1XQ3A 3ADTA 3L0LA 2AX8A 2ZKCA 4IA3A 4PPPA 2ZXMA 4MGAA 4ZJRA 2HWQA 3DZYD 4TUZB 1UHLA 2QZOB 3R2AA 1GS4A 5DIEA 3VT4A 2ACLA 3NOAA 2YHDA 1RDTD 1WM0X 4JYGA 3OKHA 1S0ZA 1X7JA 2PKLA 3PEQA 2QGWA 5DV8A 4E4KA 1PQ9A 2NXXE 1X7EA 2ZNPA 3NSQA 4MGBB 1PQCA 5APJA 4APUA 4CI4A 2ZNOA 5JY3A 4F9MA 4RZGA 3W5QA 3L3XA 3RLJA 4IV4A 3AUQA 3FEJA 5DUHA 1K4WA 3B0RA 1G1UA 2Q61A 5GICA 4RZEA 4X1FA 1Y9RA 3VT8A 3X31A 4RUPA 3WFFA 4MG7A 5E0WA 4R6SA 2B1ZA 3AN4A 4PVUA 4ZNSA 4X1GA 3ZR7A 5DWEA 2VV4A 3MNOA 5KD9A 2QGTA 2OVHA 2PIXA 3KMZA 4IA7A 2Q7IA 4REEA 3L1BA 4N8RA 5DRJA 2Q70A 3G9EA 4LNWA 4ZO1X 1P93A 3A2HA 5DZ3A 3VT9A 3D57A 5DYDA 1EXAA 4ZNTA 2NV7A 1YIMA 2Q6RA 3E7CA 3IPSA 3OMQA 5AZVA 4WPFA 1MV9A 3TKMA 3VJSA 4ZN7A 3WT7A 4NY9A 5AVLA 3AUNA 4OLMA 4IA1A 3DY6A 5C4TA 3B68A 3AZ2A 3B1MA 1KKQA 4YPQA 3CS4A 1IE9A 2YATA 3DR1A 3L0EA 4FN9A 1XV9A 2G44A 2GTKA 5EC9A 3K6PA 4DOSA 4J26A 3SP6A 3PO9A 3P0UA 5EITA 3UVVA 3KDUA 3IXPA 3O1DA 5IXKA 1XB7A 2IHQA 2ABIA 2LBDA 3OOKA 3FALB 3OSIA 3QT0A 5FQPA 1SR7A 2ZK1A 3KBAA 3L3ZA 4ZI1A 2YLOA 1LV2A 4L96A 3DZUD 3X1IA 1RKHA 4CI5A 1ERRA 4FHHA 4RMCA 3UUDB 3P88A 5DKSA 5G3JA 5DXBB 2Q6SA 5C4UA 3UP3A 3VTBA 2AM9A 2QXMA 4WHFA 5F9BA 4LTWA 2AA6A 1NAXA 3KMGA 4TUZA 2AWHA 3GBKA 1HG4A 2QXSA 2QZOA 3AURA 3N00A 3VJTA 3TY0A 2HFPA 1OT7A 3HLVA 1I7IA 4J24A 3V49A 1YA3A 4JYIA 3A9EB 1SJ0A 4J5XA 1XLSA 2W8YA 5M96A 2QH6A 1K74A 2B50A 4DM6A 2QA6A 2ZMJA 5L11A 4S0TA 2ZVTA 4MGBA 4PF3A 3WT5A 1S9QA 5DZHA 2HWRA 2IOGA 4A4VA 2QA8B 2VV3A 3UU7B 3CS6A 4ZJWA 1UOMA 3ADSA 4UDAA 1T74A 4RUOX 4S15A 5DY8A 4E4QA 3FEIA 4FGYA 2R40A 3JZBA 1ILGA 5EGVA 1PZLA 3AZ3A 2VV2A 2GWXA 4PP6A 4E2JA 5G5WA 3TKCA 4XUMA 5EI1A 3OMMA 1YOWA 4OHAA 5G43A 1LBDA 2PIVA 4A2JA 3LMPA 4OKBA 4RMEA 1R1KA 2Q1HA 2Q5GA 4Q50A 4UDDA 3HO0A 3IPUA 2PIOA 5DMFA 2BJ4B 5FQSA 3ADUA 4PRGA 3FUGA 3OGTA 4KZJA 3GN8A 2OM9A 2Z4BA 5FQRA 3VHWA 4DK8A 2Q3YA 3ET1A 2BAWA 3IMYA 1X78A 4XUHA 2R6YA 3VT5A 3U9QA 4PWLA 3CDPA 2YFEA 1HJ1A 5DXMA 3D24A 2PIRA 4RUJA 1T76A 3RVFA 2QPYA 2ZK5A 2ZK4A 3CDSA 1H9UA 1S9PA 1L2JA 4OFRA 1E3GA 5DKBA 3FALA 2H77A 3IXPD 3OMKA 3PLZA 3RUUA 2J14A 5DZIA 5FQTA 5KCTA 1ZH7A 2Q1VA 3CJWA 4M8HA 3M7RA 3OSAA 4POJA 2P7ZA 1R20A 4ZNVA 3PCUA 5GIDA 1K7LA 3UUDA 1GWXA 2J4AA 5DXBA 3OKIA 2J7YA 3VT6A 4P6WA 1NUOA 3FLIA 3W5PA 1FD0A 4JYHA 4YNKA 2PIUA 1EXXA 1Z5XU 4G2HA 4IVWA 4O8FA 4XLDA 5DI7A 3G0WA 3SZ1A 2I4JA 3G8OA 1ILHA 3VTDA 5KCCA 3A9EA 2XHSA 3R8DA 1XP1A 4MG5A 4OZRU 3WWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DX3 B;  5DUE A;  1NQ7 A;  1S19 A;  2PJL A;  2NW4 A;  1K74 D;  1Z5X E;  2AX7 A;  4P6X A;  5DKE A;  5HJP B;  1FCZ A;  1M7W A;  2HAM A;  4S14 A;  3O1E A;  5G42 A;  3E00 D;  4PXM A;  1YP0 A;  2QA8 A;  1DKF B;  2NPA A;  2OVM A;  5DXP A;  2VV1 B;  4M8E A;  4N1Y A;  4OK1 A;  5APK A;  3RLL A;  3UU7 A;  3FC6 B;  4OZR E;  5KRJ A;  1XVP B;  2P15 A;  1XNN A;  5DU5 A;  5DXR A;  3BQD A;  1T7T A;  2Z4J A;  1Q4X A;  4J5W C;  5DVS A;  5G45 A;  5LWP A;  4OKT A;  5KRC A;  2ZAS A;  3P8X A;  1PCG A;  4OJB A;  3W0G A;  1OSH A;  2Q7J A;  2ZFX A;  5JJM B;  3FXV A;  2Q8S A;  2YJA B;  3R8I A;  4NQA B;  5HCV A;  1P8D A;  2Q5S A;  4ZO1 B;  4FNE A;  1R1K D;  3PBA A;  5DWI A;  5AZT A;  2BJ4 A;  1OVL B;  4OIU A;  1XAP A;  1NRL A;  2XYJ A;  3E94 A;  5KYA A;  4YT1 A;  1R6G A;  3V9T A;  2FAI A;  4Q13 A;  1FCY A;  5E15 A;  3ERT A;  4EMA A;  1YYE A;  3ZRB A;  4N73 A;  5DXQ A;  3RY9 A;  2PNU A;  2POB A;  5A86 A;  2ZNN A;  1XDK B;  4J5X C;  4S0S A;  1XJ7 A;  3HC5 A;  3Q95 B;  4IU7 A;  4XTA A;  3MNE A;  2YJD A;  5KCD A;  5ACC A;  3UUA B;  3W0Y A;  5B41 A;  2J7X A;  4G1Z A;  2I0J A;  2ZK0 A;  2G0H A;  5B5B A;  5AWJ A;  2ZK3 A;  4R2U A;  2P1V A;  5DKG A;  3W0I A;  3DCT A;  3IPQ A;  1T65 A;  1R20 D;  2HBH A;  2ZBS A;  3OMO A;  3UP0 A;  5KCU A;  3V3Q A;  4QJR A;  1XLS E;  3FUR A;  3KPZ A;  3H0A A;  2AB2 A;  5GT4 A;  1PK5 A;  2OZ7 A;  4CSJ A;  5K13 A;  4OEA A;  5AAV B;  5AWK A;  3D5F A;  2YLP A;  4MG9 B;  3OLF A;  5DSH A;  5DV6 A;  5HYK A;  3A40 X;  4ZNW A;  1ZAF A;  2HB7 A;  2I4Z A;  2AA5 A;  1QKN A;  3AZ1 A;  4G1D A;  4OFU A;  2I0G A;  5DX3 A;  5HJS A;  4BCR A;  4ITE A;  3OS8 A;  3VJI A;  4RAK A;  5HJP A;  3RUT A;  5KR9 A;  2P1T A;  1DKF A;  1Y0S A;  1YOK A;  2AA2 A;  2VV1 A;  2XYX A;  4HEE X;  4QK4 A;  1XZX X;  3FC6 A;  2XYW A;  4DM8 A;  4G21 A;  1XVP A;  2H79 A;  1ZDT A;  3HQ5 A;  2PIT A;  4IWF A;  3VRV A;  4YMQ A;  5KRM A;  3GZ9 A;  3VRW A;  5KCE A;  3HVL A;  5DVV A;  5CJ6 A;  3ILZ A;  2PIN A;  1ZUC A;  1XP9 A;  3H52 A;  5HZC A;  3MNP A;  4RFW A;  2P4Y A;  5AYG A;  3W0J A;  3R29 A;  5JJM A;  5KCF A;  3VT7 A;  2GPP A;  4G20 A;  1SQN A;  3ET3 A;  3ET2 A;  4MDD A;  4PP5 A;  4IV2 A;  2FSZ A;  4KZI A;  4DOR A;  5KCW A;  4L98 A;  3VSP A;  2JJ3 A;  2P7G A;  1OVL A;  5DL4 A;  2ZL9 A;  2AAX A;  3A78 A;  5H1E A;  3KWY A;  4G2I A;  4OIV A;  5KYJ A;  1PRG A;  2AX9 A;  3ERD A;  2PIQ A;  4WQP A;  2AX6 A;  3VRT A;  4POH A;  2ATH A;  3VT3 A;  1XDK A;  1U3S A;  5L7H A;  3W0C A;  4OC7 A;  3Q95 A;  4IW6 A;  2Q7K A;  4IUI A;  1IE8 A;  4RZF A;  5DXK A;  3B67 A;  3UUA A;  3GD2 A;  1T63 A;  4R06 A;  3B66 A;  3DT3 A;  1T73 A;  1UPV A;  5IAW A;  4A4W A;  2Q59 B;  3UUC A;  3VHU A;  1A28 A;  1NAV A;  4XI3 A;  5DRM A;  3W5R A;  1TFC A;  1Z95 A;  3D6D A;  5FQV A;  3OSW A;  5KRO A;  5AK2 A;  5DWL A;  3V3E A;  4QE8 A;  5DLR A;  4REF A;  3V9Y A;  1XOW A;  3B0T A;  3ADX A;  4LNX A;  4QM0 A;  2OCF A;  1A52 A;  3OMP A;  5DP0 A;  4MGC A;  1NHZ A;  5AAV A;  3VRU A;  5L7E A;  5HYR A;  1NQ0 A;  3X1H A;  3ET0 A;  4ONI A;  4MG9 A;  5DXE A;  5KRL A;  2QW4 A;  4WLB A;  5APH A;  3A2I A;  1VJB A;  2QR9 A;  4HLW A;  5DIG A;  4NIE A;  5DV3 A;  3GYU A;  3SP9 A;  2A3I A;  3EYB A;  4QL8 A;  3AX8 A;  3VJH A;  4EM9 A;  1BSX A;  1ZGY A;  4XT9 A;  3WFG A;  3CQV A;  5DZ1 A;  1SKX A;  2HAR A;  4TV1 B;  1YUC A;  4RE8 A;  2V0V A;  2QMV A;  2PIW A;  5JI0 D;  3L03 A;  4OAR A;  1FCX A;  1U9E A;  1T5Z A;  2GP7 A;  4PLE A;  3V9V A;  2ZNQ A;  1RJK A;  1RK3 A;  2JFA B;  5DTV A;  4PPS A;  5ETH A;  3KMR A;  2R6W A;  3CTB A;  4OKW A;  3OZ0 A;  2Q6J A;  2R40 D;  3HZF A;  5I4V A;  2AA7 A;  2OUZ A;  1YIN A;  3P89 A;  3F5C B;  1G2N A;  2B23 A;  3X36 A;  3G8I A;  1GWQ A;  4QE6 A;  2YLY A;  2P54 A;  2QAB A;  3WGP A;  5IZ0 A;  2I4P A;  4PLD A;  2GL8 A;  3W5T A;  2QE4 A;  5C4O A;  5G46 A;  3VI8 A;  3WT6 A;  1PQ6 A;  2ZXN A;  2O4R A;  3HM1 A;  5E14 A;  3TX7 B;  1S0X A;  5ICK A;  3S9S A;  4IQR A;  2AMB A;  2OAX A;  2E2R A;  3JZC A;  3OS9 A;  1T79 A;  4IA2 A;  4ZNU A;  4ITF A;  2JF9 A;  3CLD A;  2VV0 A;  1X7B A;  1I7G A;  1L2I A;  2ZMI A;  1ZEO A;  2HC4 A;  5AAU A;  2POG A;  3KFC A;  2QTU A;  3OS8 C;  3CWD A;  5C4S A;  1N46 A;  4MG6 A;  3GYT A;  1I38 A;  1T7R A;  2NXX A;  2Q59 A;  2XKW A;  4JL4 A;  4B7W A;  2VST A;  3VSO A;  3R5M A;  4RWV A;  1NYX A;  5AVI A;  1FM9 A;  3B65 A;  3VHV A;  4Q0A C;  1R5K A;  3PRG A;  2PRG A;  4N5G A;  5DK9 A;  4MGD B;  3K8S A;  4IS8 A;  4OGH A;  2AMA A;  4XAO A;  4OH5 A;  1NQ1 A;  1MVC A;  1KV6 A;  3OZJ A;  4OJ9 A;  5DVC A;  5LGA A;  1XNX A;  2GPU A;  3KYT A;  4J5W A;  5G44 A;  3A3Z X;  1FM6 A;  3HC6 A;  3K22 A;  2ZY0 A;  3BEJ A;  3ZQT A;  2REW A;  4TV1 A;  1QKM A;  4MG8 B;  4OED A;  5KRF A;  4ZNH A;  1X7R A;  2ZMH A;  3T03 A;  1XQC A;  2AXA A;  3BC5 A;  3GWX A;  5DWJ A;  1PDU A;  3B5R A;  5DMC A;  5E7V A;  3KDT A;  2O4J A;  4FHI A;  4WHG A;  4NB6 A;  2G5O A;  2F4B A;  1T7M A;  2JFA A;  3FS1 A;  1X76 A;  3GWS X;  1XIU A;  3K23 A;  4IWC A;  2AYR A;  4OJ4 A;  4JGV A;  4K7A A;  1RKG A;  1QKU A;  2Q60 A;  3R5N A;  1I37 A;  4NUF A;  1DB1 A;  5GIE A;  1N4H A;  5E19 A;  2ZK2 A;  3F5C A;  5KRK A;  4MGA B;  1M13 A;  1YMT A;  3NSP A;  2Q7L A;  4KZM A;  2B1V A;  5DZ0 A;  1G50 A;  1UHL B;  4OZT U;  3VN2 A;  3W0A A;  4OIL A;  5KRI A;  3CS8 A;  5DXG A;  1RDT A;  4K6I A;  2ACL B;  3LBD A;  3F7D A;  1GWR A;  5E1C A;  3E00 A;  3HOD A;  4UDB A;  3OLL A;  5E0X A;  2EWP A;  3B0W A;  2ZXZ A;  3ADV A;  4OZT E;  3DCU A;  5DYB A;  3OLS A;  4OKX A;  1YY4 A;  2HCD A;  2ZK6 A;  3A2J A;  4OEY A;  2QNV A;  2FVJ A;  3W0H A;  1NDE A;  2V7C A;  3IA6 A;  4K4J A;  4MG7 B;  5SYZ A;  2IOK A;  5EHJ A;  2AO6 A;  1T7F A;  1TXI A;  1ZDU A;  4RMD A;  5DUG A;  5KRA A;  5L7G A;  2VV4 B;  3AFR A;  1KNU A;  4PP3 A;  2G0G A;  2P1U A;  2HAS A;  2Q5P A;  4LBD A;  3WMH A;  4ZN9 A;  5KRH A;  3DZY A;  4OH6 A;  2GPV A;  1FM9 D;  2ZLA A;  1FBY A;  3ADW A;  4MGD A;  4OEZ A;  4G1Y A;  3R8A A;  2GIU A;  1E3K A;  1G5Y A;  3H0A D;  5DID A;  2VSR A;  3B0Q A;  3WJ5 A;  1N83 A;  3OOF A;  4DMA A;  3L0J A;  1U3R A;  4DQM A;  1QKT A;  2GPO A;  3ZRA A;  1XPC A;  1ERE A;  1XV9 B;  1Y0X X;  2O9I A;  1U3Q A;  3WTQ A;  1ZKY A;  3V4A A;  1FM6 D;  3WJ4 A;  1NQ2 A;  4IVY A;  4MG8 A;  4UDC A;  1OSV A;  3AN3 A;  4JAZ A;  2YLQ A;  3UVV B;  2P7A A;  3B3K A;  3DZU A;  4XHD A;  1YJE A;  2ZLC A;  5DWG A;  1UPW A;  3OAP A;  4IW8 A;  5EJV A;  3VTC A;  1XP6 A;  4WVD A;  2HB8 A;  4Y29 A;  2HVC A;  1MZN A;  4LSJ A;  4ZOM A;  4DK7 A;  2QSE A;  1M2Z A;  2PIP L;  3D90 A;  1XQ3 A;  3ADT A;  3L0L A;  2AX8 A;  2ZKC A;  4IA3 A;  4PPP A;  2ZXM A;  4MGA A;  4ZJR A;  2HWQ A;  3DZY D;  4TUZ B;  1UHL A;  2QZO B;  3R2A A;  1GS4 A;  5DIE A;  3VT4 A;  2ACL A;  3NOA A;  2YHD A;  1RDT D;  1WM0 X;  4JYG A;  3OKH A;  1S0Z A;  1X7J A;  2PKL A;  3PEQ A;  2QGW A;  5DV8 A;  4E4K A;  1PQ9 A;  2NXX E;  1X7E A;  2ZNP A;  3NSQ A;  4MGB B;  1PQC A;  5APJ A;  4APU A;  4CI4 A;  2ZNO A;  5JY3 A;  4F9M A;  4RZG A;  3W5Q A;  3L3X A;  3RLJ A;  4IV4 A;  3AUQ A;  3FEJ A;  5DUH A;  1K4W A;  3B0R A;  1G1U A;  2Q61 A;  5GIC A;  4RZE A;  4X1F A;  1Y9R A;  3VT8 A;  3X31 A;  4RUP A;  3WFF A;  4MG7 A;  5E0W A;  4R6S A;  2B1Z A;  3AN4 A;  4PVU A;  4ZNS A;  4X1G A;  3ZR7 A;  5DWE A;  2VV4 A;  3MNO A;  5KD9 A;  2QGT A;  2OVH A;  2PIX A;  3KMZ A;  4IA7 A;  2Q7I A;  4REE A;  3L1B A;  4N8R A;  5DRJ A;  2Q70 A;  3G9E A;  4LNW A;  4ZO1 X;  1P93 A;  3A2H A;  5DZ3 A;  3VT9 A;  3D57 A;  5DYD A;  1EXA A;  4ZNT A;  2NV7 A;  1YIM A;  2Q6R A;  3E7C A;  3IPS A;  3OMQ A;  5AZV A;  4WPF A;  1MV9 A;  3TKM A;  3VJS A;  4ZN7 A;  3WT7 A;  4NY9 A;  5AVL A;  3AUN A;  4OLM A;  4IA1 A;  3DY6 A;  5C4T A;  3B68 A;  3AZ2 A;  3B1M A;  1KKQ A;  4YPQ A;  3CS4 A;  1IE9 A;  2YAT A;  3DR1 A;  3L0E A;  4FN9 A;  1XV9 A;  2G44 A;  2GTK A;  5EC9 A;  3K6P A;  4DOS A;  4J26 A;  3SP6 A;  3PO9 A;  3P0U A;  5EIT A;  3UVV A;  3KDU A;  3IXP A;  3O1D A;  5IXK A;  1XB7 A;  2IHQ A;  2ABI A;  2LBD A;  3OOK A;  3FAL B;  3OSI A;  3QT0 A;  5FQP A;  1SR7 A;  2ZK1 A;  3KBA A;  3L3Z A;  4ZI1 A;  2YLO A;  1LV2 A;  4L96 A;  3DZU D;  3X1I A;  1RKH A;  4CI5 A;  1ERR A;  4FHH A;  4RMC A;  3UUD B;  3P88 A;  5DKS A;  5G3J A;  5DXB B;  2Q6S A;  5C4U A;  3UP3 A;  3VTB A;  2AM9 A;  2QXM A;  4WHF A;  5F9B A;  4LTW A;  2AA6 A;  1NAX A;  3KMG A;  4TUZ A;  2AWH A;  3GBK A;  1HG4 A;  2QXS A;  2QZO A;  3AUR A;  3N00 A;  3VJT A;  3TY0 A;  2HFP A;  1OT7 A;  3HLV A;  1I7I A;  4J24 A;  3V49 A;  1YA3 A;  4JYI A;  3A9E B;  1SJ0 A;  4J5X A;  1XLS A;  2W8Y A;  5M96 A;  2QH6 A;  1K74 A;  2B50 A;  4DM6 A;  2QA6 A;  2ZMJ A;  5L11 A;  4S0T A;  2ZVT A;  4MGB A;  4PF3 A;  3WT5 A;  1S9Q A;  5DZH A;  2HWR A;  2IOG A;  4A4V A;  2QA8 B;  2VV3 A;  3UU7 B;  3CS6 A;  4ZJW A;  1UOM A;  3ADS A;  4UDA A;  1T74 A;  4RUO X;  4S15 A;  5DY8 A;  4E4Q A;  3FEI A;  4FGY A;  2R40 A;  3JZB A;  1ILG A;  5EGV A;  1PZL A;  3AZ3 A;  2VV2 A;  2GWX A;  4PP6 A;  4E2J A;  5G5W A;  3TKC A;  4XUM A;  5EI1 A;  3OMM A;  1YOW A;  4OHA A;  5G43 A;  1LBD A;  2PIV A;  4A2J A;  3LMP A;  4OKB A;  4RME A;  1R1K A;  2Q1H A;  2Q5G A;  4Q50 A;  4UDD A;  3HO0 A;  3IPU A;  2PIO A;  5DMF A;  2BJ4 B;  5FQS A;  3ADU A;  4PRG A;  3FUG A;  3OGT A;  4KZJ A;  3GN8 A;  2OM9 A;  2Z4B A;  5FQR A;  3VHW A;  4DK8 A;  2Q3Y A;  3ET1 A;  2BAW A;  3IMY A;  1X78 A;  4XUH A;  2R6Y A;  3VT5 A;  3U9Q A;  4PWL A;  3CDP A;  2YFE A;  1HJ1 A;  5DXM A;  3D24 A;  2PIR A;  4RUJ A;  1T76 A;  3RVF A;  2QPY A;  2ZK5 A;  2ZK4 A;  3CDS A;  1H9U A;  1S9P A;  1L2J A;  4OFR A;  1E3G A;  5DKB A;  3FAL A;  2H77 A;  3IXP D;  3OMK A;  3PLZ A;  3RUU A;  2J14 A;  5DZI A;  5FQT A;  5KCT A;  1ZH7 A;  2Q1V A;  3CJW A;  4M8H A;  3M7R A;  3OSA A;  4POJ A;  2P7Z A;  1R20 A;  4ZNV A;  3PCU A;  5GID A;  1K7L A;  3UUD A;  1GWX A;  2J4A A;  5DXB A;  3OKI A;  2J7Y A;  3VT6 A;  4P6W A;  1NUO A;  3FLI A;  3W5P A;  1FD0 A;  4JYH A;  4YNK A;  2PIU A;  1EXX A;  1Z5X U;  4G2H A;  4IVW A;  4O8F A;  4XLD A;  5DI7 A;  3G0W A;  3SZ1 A;  2I4J A;  3G8O A;  1ILH A;  3VTD A;  5KCC A;  3A9E A;  2XHS A;  3R8D A;  1XP1 A;  4MG5 A;  4OZR U;  3WWR A; 
#chains in the Genus database with same CATH topology
 5DX3 B;  5DUE A;  1NQ7 A;  1S19 A;  2PJL A;  2NW4 A;  1K74 D;  1Z5X E;  2AX7 A;  4P6X A;  5DKE A;  5HJP B;  1FCZ A;  1M7W A;  2HAM A;  4S14 A;  3O1E A;  5G42 A;  3E00 D;  4PXM A;  1YP0 A;  2QA8 A;  1DKF B;  2NPA A;  2OVM A;  5DXP A;  2VV1 B;  4M8E A;  4N1Y A;  4OK1 A;  5APK A;  3RLL A;  3UU7 A;  3FC6 B;  4OZR E;  5KRJ A;  1XVP B;  2P15 A;  1XNN A;  5DU5 A;  5DXR A;  3BQD A;  1T7T A;  2Z4J A;  1Q4X A;  4J5W C;  5DVS A;  5G45 A;  5LWP A;  4OKT A;  5KRC A;  2ZAS A;  3P8X A;  1PCG A;  4OJB A;  3W0G A;  1OSH A;  2Q7J A;  2ZFX A;  5JJM B;  3FXV A;  2Q8S A;  2YJA B;  3R8I A;  4NQA B;  5HCV A;  1P8D A;  2Q5S A;  4ZO1 B;  4FNE A;  1R1K D;  3PBA A;  5DWI A;  5AZT A;  2BJ4 A;  1OVL B;  4OIU A;  1XAP A;  1NRL A;  2XYJ A;  3E94 A;  5KYA A;  4YT1 A;  1R6G A;  3V9T A;  2FAI A;  4Q13 A;  1FCY A;  5E15 A;  3ERT A;  4EMA A;  1YYE A;  3ZRB A;  4N73 A;  5DXQ A;  3RY9 A;  2PNU A;  2POB A;  5A86 A;  2ZNN A;  1XDK B;  4J5X C;  4S0S A;  1XJ7 A;  3HC5 A;  3Q95 B;  4IU7 A;  4XTA A;  3MNE A;  2YJD A;  5KCD A;  5ACC A;  3UUA B;  3W0Y A;  5B41 A;  2J7X A;  4G1Z A;  2I0J A;  2ZK0 A;  2G0H A;  5B5B A;  5AWJ A;  2ZK3 A;  4R2U A;  2P1V A;  5DKG A;  3W0I A;  3DCT A;  3IPQ A;  1T65 A;  1R20 D;  2HBH A;  2ZBS A;  3OMO A;  3UP0 A;  5KCU A;  3V3Q A;  4QJR A;  1XLS E;  3FUR A;  3KPZ A;  3H0A A;  2AB2 A;  5GT4 A;  1PK5 A;  2OZ7 A;  4CSJ A;  5K13 A;  4OEA A;  5AAV B;  5AWK A;  3D5F A;  2YLP A;  4MG9 B;  3OLF A;  5DSH A;  5DV6 A;  5HYK A;  3A40 X;  4ZNW A;  1ZAF A;  2HB7 A;  2I4Z A;  2AA5 A;  1QKN A;  3AZ1 A;  4G1D A;  4OFU A;  2I0G A;  5DX3 A;  5HJS A;  4BCR A;  4ITE A;  3OS8 A;  3VJI A;  4RAK A;  5HJP A;  3RUT A;  5KR9 A;  2P1T A;  1DKF A;  1Y0S A;  1YOK A;  2AA2 A;  2VV1 A;  2XYX A;  4HEE X;  4QK4 A;  1XZX X;  3FC6 A;  2XYW A;  4DM8 A;  4G21 A;  1XVP A;  2H79 A;  1ZDT A;  3HQ5 A;  2PIT A;  4IWF A;  3VRV A;  4YMQ A;  5KRM A;  3GZ9 A;  3VRW A;  5KCE A;  3HVL A;  5DVV A;  5CJ6 A;  3ILZ A;  2PIN A;  1ZUC A;  1XP9 A;  3H52 A;  5HZC A;  3MNP A;  4RFW A;  2P4Y A;  5AYG A;  3W0J A;  3R29 A;  5JJM A;  5KCF A;  3VT7 A;  2GPP A;  4G20 A;  1SQN A;  3ET3 A;  3ET2 A;  4MDD A;  4PP5 A;  4IV2 A;  2FSZ A;  4KZI A;  4DOR A;  5KCW A;  4L98 A;  3VSP A;  2JJ3 A;  2P7G A;  1OVL A;  5DL4 A;  2ZL9 A;  2AAX A;  3A78 A;  5H1E A;  3KWY A;  4G2I A;  4OIV A;  5KYJ A;  1PRG A;  2AX9 A;  3ERD A;  2PIQ A;  4WQP A;  2AX6 A;  3VRT A;  4POH A;  2ATH A;  3VT3 A;  1XDK A;  1U3S A;  5L7H A;  3W0C A;  4OC7 A;  3Q95 A;  4IW6 A;  2Q7K A;  4IUI A;  1IE8 A;  4RZF A;  5DXK A;  3B67 A;  3UUA A;  3GD2 A;  1T63 A;  4R06 A;  3B66 A;  3DT3 A;  1T73 A;  1UPV A;  5IAW A;  4A4W A;  2Q59 B;  3UUC A;  3VHU A;  1A28 A;  1NAV A;  4XI3 A;  5DRM A;  3W5R A;  1TFC A;  1Z95 A;  3D6D A;  5FQV A;  3OSW A;  5KRO A;  5AK2 A;  5DWL A;  3V3E A;  4QE8 A;  5DLR A;  4REF A;  3V9Y A;  1XOW A;  3B0T A;  3ADX A;  4LNX A;  4QM0 A;  2OCF A;  1A52 A;  3OMP A;  5DP0 A;  4MGC A;  1NHZ A;  5AAV A;  3VRU A;  5L7E A;  5HYR A;  1NQ0 A;  3X1H A;  3ET0 A;  4ONI A;  4MG9 A;  5DXE A;  5KRL A;  2QW4 A;  4WLB A;  5APH A;  3A2I A;  1VJB A;  2QR9 A;  4HLW A;  5DIG A;  4NIE A;  5DV3 A;  3GYU A;  3SP9 A;  2A3I A;  3EYB A;  4QL8 A;  3AX8 A;  3VJH A;  4EM9 A;  1BSX A;  1ZGY A;  4XT9 A;  3WFG A;  3CQV A;  5DZ1 A;  1SKX A;  2HAR A;  4TV1 B;  1YUC A;  4RE8 A;  2V0V A;  2QMV A;  2PIW A;  5JI0 D;  3L03 A;  4OAR A;  1FCX A;  1U9E A;  1T5Z A;  2GP7 A;  4PLE A;  3V9V A;  2ZNQ A;  1RJK A;  1RK3 A;  2JFA B;  5DTV A;  4PPS A;  5ETH A;  3KMR A;  2R6W A;  3CTB A;  4OKW A;  3OZ0 A;  2Q6J A;  2R40 D;  3HZF A;  5I4V A;  2AA7 A;  2OUZ A;  1YIN A;  3P89 A;  3F5C B;  1G2N A;  2B23 A;  3X36 A;  3G8I A;  1GWQ A;  4QE6 A;  2YLY A;  2P54 A;  2QAB A;  3WGP A;  5IZ0 A;  2I4P A;  4PLD A;  2GL8 A;  3W5T A;  2QE4 A;  5C4O A;  5G46 A;  3VI8 A;  3WT6 A;  1PQ6 A;  2ZXN A;  2O4R A;  3HM1 A;  5E14 A;  3TX7 B;  1S0X A;  5ICK A;  3S9S A;  4IQR A;  2AMB A;  2OAX A;  2E2R A;  3JZC A;  3OS9 A;  1T79 A;  4IA2 A;  4ZNU A;  4ITF A;  2JF9 A;  3CLD A;  2VV0 A;  1X7B A;  1I7G A;  1L2I A;  2ZMI A;  1ZEO A;  2HC4 A;  5AAU A;  2POG A;  3KFC A;  2QTU A;  3OS8 C;  3CWD A;  5C4S A;  1N46 A;  4MG6 A;  3GYT A;  1I38 A;  1T7R A;  2NXX A;  2Q59 A;  2XKW A;  4JL4 A;  4B7W A;  2VST A;  3VSO A;  3R5M A;  4RWV A;  1NYX A;  5AVI A;  1FM9 A;  3B65 A;  3VHV A;  4Q0A C;  1R5K A;  3PRG A;  2PRG A;  4N5G A;  5DK9 A;  4MGD B;  3K8S A;  4IS8 A;  4OGH A;  2AMA A;  4XAO A;  4OH5 A;  1NQ1 A;  1MVC A;  1KV6 A;  3OZJ A;  4OJ9 A;  5DVC A;  5LGA A;  1XNX A;  2GPU A;  3KYT A;  4J5W A;  5G44 A;  3A3Z X;  1FM6 A;  3HC6 A;  3K22 A;  2ZY0 A;  3BEJ A;  3ZQT A;  2REW A;  4TV1 A;  1QKM A;  4MG8 B;  4OED A;  5KRF A;  4ZNH A;  1X7R A;  2ZMH A;  3T03 A;  1XQC A;  2AXA A;  3BC5 A;  3GWX A;  5DWJ A;  1PDU A;  3B5R A;  5DMC A;  5E7V A;  3KDT A;  2O4J A;  4FHI A;  4WHG A;  4NB6 A;  2G5O A;  2F4B A;  1T7M A;  2JFA A;  3FS1 A;  1X76 A;  3GWS X;  1XIU A;  3K23 A;  4IWC A;  2AYR A;  4OJ4 A;  4JGV A;  4K7A A;  1RKG A;  1QKU A;  2Q60 A;  3R5N A;  1I37 A;  4NUF A;  1DB1 A;  5GIE A;  1N4H A;  5E19 A;  2ZK2 A;  3F5C A;  5KRK A;  4MGA B;  1M13 A;  1YMT A;  3NSP A;  2Q7L A;  4KZM A;  2B1V A;  5DZ0 A;  1G50 A;  1UHL B;  4OZT U;  3VN2 A;  3W0A A;  4OIL A;  5KRI A;  3CS8 A;  5DXG A;  1RDT A;  4K6I A;  2ACL B;  3LBD A;  3F7D A;  1GWR A;  5E1C A;  3E00 A;  3HOD A;  4UDB A;  3OLL A;  5E0X A;  2EWP A;  3B0W A;  2ZXZ A;  3ADV A;  4OZT E;  3DCU A;  5DYB A;  3OLS A;  4OKX A;  1YY4 A;  2HCD A;  2ZK6 A;  3A2J A;  4OEY A;  2QNV A;  2FVJ A;  3W0H A;  1NDE A;  2V7C A;  3IA6 A;  4K4J A;  4MG7 B;  5SYZ A;  2IOK A;  5EHJ A;  2AO6 A;  1T7F A;  1TXI A;  1ZDU A;  4RMD A;  5DUG A;  5KRA A;  5L7G A;  2VV4 B;  3AFR A;  1KNU A;  4PP3 A;  2G0G A;  2P1U A;  2HAS A;  2Q5P A;  4LBD A;  3WMH A;  4ZN9 A;  5KRH A;  3DZY A;  4OH6 A;  2GPV A;  1FM9 D;  2ZLA A;  1FBY A;  3ADW A;  4MGD A;  4OEZ A;  4G1Y A;  3R8A A;  2GIU A;  1E3K A;  1G5Y A;  3H0A D;  5DID A;  2VSR A;  3B0Q A;  3WJ5 A;  1N83 A;  3OOF A;  4DMA A;  3L0J A;  1U3R A;  4DQM A;  1QKT A;  2GPO A;  3ZRA A;  1XPC A;  1ERE A;  1XV9 B;  1Y0X X;  2O9I A;  1U3Q A;  3WTQ A;  1ZKY A;  3V4A A;  1FM6 D;  3WJ4 A;  1NQ2 A;  4IVY A;  4MG8 A;  4UDC A;  1OSV A;  3AN3 A;  4JAZ A;  2YLQ A;  3UVV B;  2P7A A;  3B3K A;  3DZU A;  4XHD A;  1YJE A;  2ZLC A;  5DWG A;  1UPW A;  3OAP A;  4IW8 A;  5EJV A;  3VTC A;  1XP6 A;  4WVD A;  2HB8 A;  4Y29 A;  2HVC A;  1MZN A;  4LSJ A;  4ZOM A;  4DK7 A;  2QSE A;  1M2Z A;  2PIP L;  3D90 A;  1XQ3 A;  3ADT A;  3L0L A;  2AX8 A;  2ZKC A;  4IA3 A;  4PPP A;  2ZXM A;  4MGA A;  4ZJR A;  2HWQ A;  3DZY D;  4TUZ B;  1UHL A;  2QZO B;  3R2A A;  1GS4 A;  5DIE A;  3VT4 A;  2ACL A;  3NOA A;  2YHD A;  1RDT D;  1WM0 X;  4JYG A;  3OKH A;  1S0Z A;  1X7J A;  2PKL A;  3PEQ A;  2QGW A;  5DV8 A;  4E4K A;  1PQ9 A;  2NXX E;  1X7E A;  2ZNP A;  3NSQ A;  4MGB B;  1PQC A;  5APJ A;  4APU A;  4CI4 A;  2ZNO A;  5JY3 A;  4F9M A;  4RZG A;  3W5Q A;  3L3X A;  3RLJ A;  4IV4 A;  3AUQ A;  3FEJ A;  5DUH A;  1K4W A;  3B0R A;  1G1U A;  2Q61 A;  5GIC A;  4RZE A;  4X1F A;  1Y9R A;  3VT8 A;  3X31 A;  4RUP A;  3WFF A;  4MG7 A;  5E0W A;  4R6S A;  2B1Z A;  3AN4 A;  4PVU A;  4ZNS A;  4X1G A;  3ZR7 A;  5DWE A;  2VV4 A;  3MNO A;  5KD9 A;  2QGT A;  2OVH A;  2PIX A;  3KMZ A;  4IA7 A;  2Q7I A;  4REE A;  3L1B A;  4N8R A;  5DRJ A;  2Q70 A;  3G9E A;  4LNW A;  4ZO1 X;  1P93 A;  3A2H A;  5DZ3 A;  3VT9 A;  3D57 A;  5DYD A;  1EXA A;  4ZNT A;  2NV7 A;  1YIM A;  2Q6R A;  3E7C A;  3IPS A;  3OMQ A;  5AZV A;  4WPF A;  1MV9 A;  3TKM A;  3VJS A;  4ZN7 A;  3WT7 A;  4NY9 A;  5AVL A;  3AUN A;  4OLM A;  4IA1 A;  3DY6 A;  5C4T A;  3B68 A;  3AZ2 A;  3B1M A;  1KKQ A;  4YPQ A;  3CS4 A;  1IE9 A;  2YAT A;  3DR1 A;  3L0E A;  4FN9 A;  1XV9 A;  2G44 A;  2GTK A;  5EC9 A;  3K6P A;  4DOS A;  4J26 A;  3SP6 A;  3PO9 A;  3P0U A;  5EIT A;  3UVV A;  3KDU A;  3IXP A;  3O1D A;  5IXK A;  1XB7 A;  2IHQ A;  2ABI A;  2LBD A;  3OOK A;  3FAL B;  3OSI A;  3QT0 A;  5FQP A;  1SR7 A;  2ZK1 A;  3KBA A;  3L3Z A;  4ZI1 A;  2YLO A;  1LV2 A;  4L96 A;  3DZU D;  3X1I A;  1RKH A;  4CI5 A;  1ERR A;  4FHH A;  4RMC A;  3UUD B;  3P88 A;  5DKS A;  5G3J A;  5DXB B;  2Q6S A;  5C4U A;  3UP3 A;  3VTB A;  2AM9 A;  2QXM A;  4WHF A;  5F9B A;  4LTW A;  2AA6 A;  1NAX A;  3KMG A;  4TUZ A;  2AWH A;  3GBK A;  1HG4 A;  2QXS A;  2QZO A;  3AUR A;  3N00 A;  3VJT A;  3TY0 A;  2HFP A;  1OT7 A;  3HLV A;  1I7I A;  4J24 A;  3V49 A;  1YA3 A;  4JYI A;  3A9E B;  1SJ0 A;  4J5X A;  1XLS A;  2W8Y A;  5M96 A;  2QH6 A;  1K74 A;  2B50 A;  4DM6 A;  2QA6 A;  2ZMJ A;  5L11 A;  4S0T A;  2ZVT A;  4MGB A;  4PF3 A;  3WT5 A;  1S9Q A;  5DZH A;  2HWR A;  2IOG A;  4A4V A;  2QA8 B;  2VV3 A;  3UU7 B;  3CS6 A;  4ZJW A;  1UOM A;  3ADS A;  4UDA A;  1T74 A;  4RUO X;  4S15 A;  5DY8 A;  4E4Q A;  3FEI A;  4FGY A;  2R40 A;  3JZB A;  1ILG A;  5EGV A;  1PZL A;  3AZ3 A;  2VV2 A;  2GWX A;  4PP6 A;  4E2J A;  5G5W A;  3TKC A;  4XUM A;  5EI1 A;  3OMM A;  1YOW A;  4OHA A;  5G43 A;  1LBD A;  2PIV A;  4A2J A;  3LMP A;  4OKB A;  4RME A;  1R1K A;  2Q1H A;  2Q5G A;  4Q50 A;  4UDD A;  3HO0 A;  3IPU A;  2PIO A;  5DMF A;  2BJ4 B;  5FQS A;  3ADU A;  4PRG A;  3FUG A;  3OGT A;  4KZJ A;  3GN8 A;  2OM9 A;  2Z4B A;  5FQR A;  3VHW A;  4DK8 A;  2Q3Y A;  3ET1 A;  2BAW A;  3IMY A;  1X78 A;  4XUH A;  2R6Y A;  3VT5 A;  3U9Q A;  4PWL A;  3CDP A;  2YFE A;  1HJ1 A;  5DXM A;  3D24 A;  2PIR A;  4RUJ A;  1T76 A;  3RVF A;  2QPY A;  2ZK5 A;  2ZK4 A;  3CDS A;  1H9U A;  1S9P A;  1L2J A;  4OFR A;  1E3G A;  5DKB A;  3FAL A;  2H77 A;  3IXP D;  3OMK A;  3PLZ A;  3RUU A;  2J14 A;  5DZI A;  5FQT A;  5KCT A;  1ZH7 A;  2Q1V A;  3CJW A;  4M8H A;  3M7R A;  3OSA A;  4POJ A;  2P7Z A;  1R20 A;  4ZNV A;  3PCU A;  5GID A;  1K7L A;  3UUD A;  1GWX A;  2J4A A;  5DXB A;  3OKI A;  2J7Y A;  3VT6 A;  4P6W A;  1NUO A;  3FLI A;  3W5P A;  1FD0 A;  4JYH A;  4YNK A;  2PIU A;  1EXX A;  1Z5X U;  4G2H A;  4IVW A;  4O8F A;  4XLD A;  5DI7 A;  3G0W A;  3SZ1 A;  2I4J A;  3G8O A;  1ILH A;  3VTD A;  5KCC A;  3A9E A;  2XHS A;  3R8D A;  1XP1 A;  4MG5 A;  4OZR U;  3WWR A; 
#chains in the Genus database with same CATH homology
 5DX3 B;  5DUE A;  1NQ7 A;  1S19 A;  2PJL A;  2NW4 A;  1K74 D;  1Z5X E;  2AX7 A;  4P6X A;  5DKE A;  5HJP B;  1FCZ A;  1M7W A;  2HAM A;  4S14 A;  3O1E A;  5G42 A;  3E00 D;  4PXM A;  1YP0 A;  2QA8 A;  1DKF B;  2NPA A;  2OVM A;  5DXP A;  2VV1 B;  4M8E A;  4N1Y A;  4OK1 A;  5APK A;  3RLL A;  3UU7 A;  3FC6 B;  4OZR E;  5KRJ A;  1XVP B;  2P15 A;  1XNN A;  5DU5 A;  5DXR A;  3BQD A;  1T7T A;  2Z4J A;  1Q4X A;  4J5W C;  5DVS A;  5G45 A;  5LWP A;  4OKT A;  5KRC A;  2ZAS A;  3P8X A;  1PCG A;  4OJB A;  3W0G A;  1OSH A;  2Q7J A;  2ZFX A;  5JJM B;  3FXV A;  2Q8S A;  2YJA B;  3R8I A;  4NQA B;  5HCV A;  1P8D A;  2Q5S A;  4ZO1 B;  4FNE A;  1R1K D;  3PBA A;  5DWI A;  5AZT A;  2BJ4 A;  1OVL B;  4OIU A;  1XAP A;  1NRL A;  2XYJ A;  3E94 A;  5KYA A;  4YT1 A;  1R6G A;  3V9T A;  2FAI A;  4Q13 A;  1FCY A;  5E15 A;  3ERT A;  4EMA A;  1YYE A;  3ZRB A;  4N73 A;  5DXQ A;  3RY9 A;  2PNU A;  2POB A;  5A86 A;  2ZNN A;  1XDK B;  4J5X C;  4S0S A;  1XJ7 A;  3HC5 A;  3Q95 B;  4IU7 A;  4XTA A;  3MNE A;  2YJD A;  5KCD A;  5ACC A;  3UUA B;  3W0Y A;  5B41 A;  2J7X A;  4G1Z A;  2I0J A;  2ZK0 A;  2G0H A;  5B5B A;  5AWJ A;  2ZK3 A;  4R2U A;  2P1V A;  5DKG A;  3W0I A;  3DCT A;  3IPQ A;  1T65 A;  1R20 D;  2HBH A;  2ZBS A;  3OMO A;  3UP0 A;  5KCU A;  3V3Q A;  4QJR A;  1XLS E;  3FUR A;  3KPZ A;  3H0A A;  2AB2 A;  5GT4 A;  1PK5 A;  2OZ7 A;  4CSJ A;  5K13 A;  4OEA A;  5AAV B;  5AWK A;  3D5F A;  2YLP A;  4MG9 B;  3OLF A;  5DSH A;  5DV6 A;  5HYK A;  3A40 X;  4ZNW A;  1ZAF A;  2HB7 A;  2I4Z A;  2AA5 A;  1QKN A;  3AZ1 A;  4G1D A;  4OFU A;  2I0G A;  5DX3 A;  5HJS A;  4BCR A;  4ITE A;  3OS8 A;  3VJI A;  4RAK A;  5HJP A;  3RUT A;  5KR9 A;  2P1T A;  1DKF A;  1Y0S A;  1YOK A;  2AA2 A;  2VV1 A;  2XYX A;  4HEE X;  4QK4 A;  1XZX X;  3FC6 A;  2XYW A;  4DM8 A;  4G21 A;  1XVP A;  2H79 A;  1ZDT A;  3HQ5 A;  2PIT A;  4IWF A;  3VRV A;  4YMQ A;  5KRM A;  3GZ9 A;  3VRW A;  5KCE A;  3HVL A;  5DVV A;  5CJ6 A;  3ILZ A;  2PIN A;  1ZUC A;  1XP9 A;  3H52 A;  5HZC A;  3MNP A;  4RFW A;  2P4Y A;  5AYG A;  3W0J A;  3R29 A;  5JJM A;  5KCF A;  3VT7 A;  2GPP A;  4G20 A;  1SQN A;  3ET3 A;  3ET2 A;  4MDD A;  4PP5 A;  4IV2 A;  2FSZ A;  4KZI A;  4DOR A;  5KCW A;  4L98 A;  3VSP A;  2JJ3 A;  2P7G A;  1OVL A;  5DL4 A;  2ZL9 A;  2AAX A;  3A78 A;  5H1E A;  3KWY A;  4G2I A;  4OIV A;  5KYJ A;  1PRG A;  2AX9 A;  3ERD A;  2PIQ A;  4WQP A;  2AX6 A;  3VRT A;  4POH A;  2ATH A;  3VT3 A;  1XDK A;  1U3S A;  5L7H A;  3W0C A;  4OC7 A;  3Q95 A;  4IW6 A;  2Q7K A;  4IUI A;  1IE8 A;  4RZF A;  5DXK A;  3B67 A;  3UUA A;  3GD2 A;  1T63 A;  4R06 A;  3B66 A;  3DT3 A;  1T73 A;  1UPV A;  5IAW A;  4A4W A;  2Q59 B;  3UUC A;  3VHU A;  1A28 A;  1NAV A;  4XI3 A;  5DRM A;  3W5R A;  1TFC A;  1Z95 A;  3D6D A;  5FQV A;  3OSW A;  5KRO A;  5AK2 A;  5DWL A;  3V3E A;  4QE8 A;  5DLR A;  4REF A;  3V9Y A;  1XOW A;  3B0T A;  3ADX A;  4LNX A;  4QM0 A;  2OCF A;  1A52 A;  3OMP A;  5DP0 A;  4MGC A;  1NHZ A;  5AAV A;  3VRU A;  5L7E A;  5HYR A;  1NQ0 A;  3X1H A;  3ET0 A;  4ONI A;  4MG9 A;  5DXE A;  5KRL A;  2QW4 A;  4WLB A;  5APH A;  3A2I A;  1VJB A;  2QR9 A;  4HLW A;  5DIG A;  4NIE A;  5DV3 A;  3GYU A;  3SP9 A;  2A3I A;  3EYB A;  4QL8 A;  3AX8 A;  3VJH A;  4EM9 A;  1BSX A;  1ZGY A;  4XT9 A;  3WFG A;  3CQV A;  5DZ1 A;  1SKX A;  2HAR A;  4TV1 B;  1YUC A;  4RE8 A;  2V0V A;  2QMV A;  2PIW A;  5JI0 D;  3L03 A;  4OAR A;  1FCX A;  1U9E A;  1T5Z A;  2GP7 A;  4PLE A;  3V9V A;  2ZNQ A;  1RJK A;  1RK3 A;  2JFA B;  5DTV A;  4PPS A;  5ETH A;  3KMR A;  2R6W A;  3CTB A;  4OKW A;  3OZ0 A;  2Q6J A;  2R40 D;  3HZF A;  5I4V A;  2AA7 A;  2OUZ A;  1YIN A;  3P89 A;  3F5C B;  1G2N A;  2B23 A;  3X36 A;  3G8I A;  1GWQ A;  4QE6 A;  2YLY A;  2P54 A;  2QAB A;  3WGP A;  5IZ0 A;  2I4P A;  4PLD A;  2GL8 A;  3W5T A;  2QE4 A;  5C4O A;  5G46 A;  3VI8 A;  3WT6 A;  1PQ6 A;  2ZXN A;  2O4R A;  3HM1 A;  5E14 A;  3TX7 B;  1S0X A;  5ICK A;  3S9S A;  4IQR A;  2AMB A;  2OAX A;  2E2R A;  3JZC A;  3OS9 A;  1T79 A;  4IA2 A;  4ZNU A;  4ITF A;  2JF9 A;  3CLD A;  2VV0 A;  1X7B A;  1I7G A;  1L2I A;  2ZMI A;  1ZEO A;  2HC4 A;  5AAU A;  2POG A;  3KFC A;  2QTU A;  3OS8 C;  3CWD A;  5C4S A;  1N46 A;  4MG6 A;  3GYT A;  1I38 A;  1T7R A;  2NXX A;  2Q59 A;  2XKW A;  4JL4 A;  4B7W A;  2VST A;  3VSO A;  3R5M A;  4RWV A;  1NYX A;  5AVI A;  1FM9 A;  3B65 A;  3VHV A;  4Q0A C;  1R5K A;  3PRG A;  2PRG A;  4N5G A;  5DK9 A;  4MGD B;  3K8S A;  4IS8 A;  4OGH A;  2AMA A;  4XAO A;  4OH5 A;  1NQ1 A;  1MVC A;  1KV6 A;  3OZJ A;  4OJ9 A;  5DVC A;  5LGA A;  1XNX A;  2GPU A;  3KYT A;  4J5W A;  5G44 A;  3A3Z X;  1FM6 A;  3HC6 A;  3K22 A;  2ZY0 A;  3BEJ A;  3ZQT A;  2REW A;  4TV1 A;  1QKM A;  4MG8 B;  4OED A;  5KRF A;  4ZNH A;  1X7R A;  2ZMH A;  3T03 A;  1XQC A;  2AXA A;  3BC5 A;  3GWX A;  5DWJ A;  1PDU A;  3B5R A;  5DMC A;  5E7V A;  3KDT A;  2O4J A;  4FHI A;  4WHG A;  4NB6 A;  2G5O A;  2F4B A;  1T7M A;  2JFA A;  3FS1 A;  1X76 A;  3GWS X;  1XIU A;  3K23 A;  4IWC A;  2AYR A;  4OJ4 A;  4JGV A;  4K7A A;  1RKG A;  1QKU A;  2Q60 A;  3R5N A;  1I37 A;  4NUF A;  1DB1 A;  5GIE A;  1N4H A;  5E19 A;  2ZK2 A;  3F5C A;  5KRK A;  4MGA B;  1M13 A;  1YMT A;  3NSP A;  2Q7L A;  4KZM A;  2B1V A;  5DZ0 A;  1G50 A;  1UHL B;  4OZT U;  3VN2 A;  3W0A A;  4OIL A;  5KRI A;  3CS8 A;  5DXG A;  1RDT A;  4K6I A;  2ACL B;  3LBD A;  3F7D A;  1GWR A;  5E1C A;  3E00 A;  3HOD A;  4UDB A;  3OLL A;  5E0X A;  2EWP A;  3B0W A;  2ZXZ A;  3ADV A;  4OZT E;  3DCU A;  5DYB A;  3OLS A;  4OKX A;  1YY4 A;  2HCD A;  2ZK6 A;  3A2J A;  4OEY A;  2QNV A;  2FVJ A;  3W0H A;  1NDE A;  2V7C A;  3IA6 A;  4K4J A;  4MG7 B;  5SYZ A;  2IOK A;  5EHJ A;  2AO6 A;  1T7F A;  1TXI A;  1ZDU A;  4RMD A;  5DUG A;  5KRA A;  5L7G A;  2VV4 B;  3AFR A;  1KNU A;  4PP3 A;  2G0G A;  2P1U A;  2HAS A;  2Q5P A;  4LBD A;  3WMH A;  4ZN9 A;  5KRH A;  3DZY A;  4OH6 A;  2GPV A;  1FM9 D;  2ZLA A;  1FBY A;  3ADW A;  4MGD A;  4OEZ A;  4G1Y A;  3R8A A;  2GIU A;  1E3K A;  1G5Y A;  3H0A D;  5DID A;  2VSR A;  3B0Q A;  3WJ5 A;  1N83 A;  3OOF A;  4DMA A;  3L0J A;  1U3R A;  4DQM A;  1QKT A;  2GPO A;  3ZRA A;  1XPC A;  1ERE A;  1XV9 B;  1Y0X X;  2O9I A;  1U3Q A;  3WTQ A;  1ZKY A;  3V4A A;  1FM6 D;  3WJ4 A;  1NQ2 A;  4IVY A;  4MG8 A;  4UDC A;  1OSV A;  3AN3 A;  4JAZ A;  2YLQ A;  3UVV B;  2P7A A;  3B3K A;  3DZU A;  4XHD A;  1YJE A;  2ZLC A;  5DWG A;  1UPW A;  3OAP A;  4IW8 A;  5EJV A;  3VTC A;  1XP6 A;  4WVD A;  2HB8 A;  4Y29 A;  2HVC A;  1MZN A;  4LSJ A;  4ZOM A;  4DK7 A;  2QSE A;  1M2Z A;  2PIP L;  3D90 A;  1XQ3 A;  3ADT A;  3L0L A;  2AX8 A;  2ZKC A;  4IA3 A;  4PPP A;  2ZXM A;  4MGA A;  4ZJR A;  2HWQ A;  3DZY D;  4TUZ B;  1UHL A;  2QZO B;  3R2A A;  1GS4 A;  5DIE A;  3VT4 A;  2ACL A;  3NOA A;  2YHD A;  1RDT D;  1WM0 X;  4JYG A;  3OKH A;  1S0Z A;  1X7J A;  2PKL A;  3PEQ A;  2QGW A;  5DV8 A;  4E4K A;  1PQ9 A;  2NXX E;  1X7E A;  2ZNP A;  3NSQ A;  4MGB B;  1PQC A;  5APJ A;  4APU A;  4CI4 A;  2ZNO A;  5JY3 A;  4F9M A;  4RZG A;  3W5Q A;  3L3X A;  3RLJ A;  4IV4 A;  3AUQ A;  3FEJ A;  5DUH A;  1K4W A;  3B0R A;  1G1U A;  2Q61 A;  5GIC A;  4RZE A;  4X1F A;  1Y9R A;  3VT8 A;  3X31 A;  4RUP A;  3WFF A;  4MG7 A;  5E0W A;  4R6S A;  2B1Z A;  3AN4 A;  4PVU A;  4ZNS A;  4X1G A;  3ZR7 A;  5DWE A;  2VV4 A;  3MNO A;  5KD9 A;  2QGT A;  2OVH A;  2PIX A;  3KMZ A;  4IA7 A;  2Q7I A;  4REE A;  3L1B A;  4N8R A;  5DRJ A;  2Q70 A;  3G9E A;  4LNW A;  4ZO1 X;  1P93 A;  3A2H A;  5DZ3 A;  3VT9 A;  3D57 A;  5DYD A;  1EXA A;  4ZNT A;  2NV7 A;  1YIM A;  2Q6R A;  3E7C A;  3IPS A;  3OMQ A;  5AZV A;  4WPF A;  1MV9 A;  3TKM A;  3VJS A;  4ZN7 A;  3WT7 A;  4NY9 A;  5AVL A;  3AUN A;  4OLM A;  4IA1 A;  3DY6 A;  5C4T A;  3B68 A;  3AZ2 A;  3B1M A;  1KKQ A;  4YPQ A;  3CS4 A;  1IE9 A;  2YAT A;  3DR1 A;  3L0E A;  4FN9 A;  1XV9 A;  2G44 A;  2GTK A;  5EC9 A;  3K6P A;  4DOS A;  4J26 A;  3SP6 A;  3PO9 A;  3P0U A;  5EIT A;  3UVV A;  3KDU A;  3IXP A;  3O1D A;  5IXK A;  1XB7 A;  2IHQ A;  2ABI A;  2LBD A;  3OOK A;  3FAL B;  3OSI A;  3QT0 A;  5FQP A;  1SR7 A;  2ZK1 A;  3KBA A;  3L3Z A;  4ZI1 A;  2YLO A;  1LV2 A;  4L96 A;  3DZU D;  3X1I A;  1RKH A;  4CI5 A;  1ERR A;  4FHH A;  4RMC A;  3UUD B;  3P88 A;  5DKS A;  5G3J A;  5DXB B;  2Q6S A;  5C4U A;  3UP3 A;  3VTB A;  2AM9 A;  2QXM A;  4WHF A;  5F9B A;  4LTW A;  2AA6 A;  1NAX A;  3KMG A;  4TUZ A;  2AWH A;  3GBK A;  1HG4 A;  2QXS A;  2QZO A;  3AUR A;  3N00 A;  3VJT A;  3TY0 A;  2HFP A;  1OT7 A;  3HLV A;  1I7I A;  4J24 A;  3V49 A;  1YA3 A;  4JYI A;  3A9E B;  1SJ0 A;  4J5X A;  1XLS A;  2W8Y A;  5M96 A;  2QH6 A;  1K74 A;  2B50 A;  4DM6 A;  2QA6 A;  2ZMJ A;  5L11 A;  4S0T A;  2ZVT A;  4MGB A;  4PF3 A;  3WT5 A;  1S9Q A;  5DZH A;  2HWR A;  2IOG A;  4A4V A;  2QA8 B;  2VV3 A;  3UU7 B;  3CS6 A;  4ZJW A;  1UOM A;  3ADS A;  4UDA A;  1T74 A;  4RUO X;  4S15 A;  5DY8 A;  4E4Q A;  3FEI A;  4FGY A;  2R40 A;  3JZB A;  1ILG A;  5EGV A;  1PZL A;  3AZ3 A;  2VV2 A;  2GWX A;  4PP6 A;  4E2J A;  5G5W A;  3TKC A;  4XUM A;  5EI1 A;  3OMM A;  1YOW A;  4OHA A;  5G43 A;  1LBD A;  2PIV A;  4A2J A;  3LMP A;  4OKB A;  4RME A;  1R1K A;  2Q1H A;  2Q5G A;  4Q50 A;  4UDD A;  3HO0 A;  3IPU A;  2PIO A;  5DMF A;  2BJ4 B;  5FQS A;  3ADU A;  4PRG A;  3FUG A;  3OGT A;  4KZJ A;  3GN8 A;  2OM9 A;  2Z4B A;  5FQR A;  3VHW A;  4DK8 A;  2Q3Y A;  3ET1 A;  2BAW A;  3IMY A;  1X78 A;  4XUH A;  2R6Y A;  3VT5 A;  3U9Q A;  4PWL A;  3CDP A;  2YFE A;  1HJ1 A;  5DXM A;  3D24 A;  2PIR A;  4RUJ A;  1T76 A;  3RVF A;  2QPY A;  2ZK5 A;  2ZK4 A;  3CDS A;  1H9U A;  1S9P A;  1L2J A;  4OFR A;  1E3G A;  5DKB A;  3FAL A;  2H77 A;  3IXP D;  3OMK A;  3PLZ A;  3RUU A;  2J14 A;  5DZI A;  5FQT A;  5KCT A;  1ZH7 A;  2Q1V A;  3CJW A;  4M8H A;  3M7R A;  3OSA A;  4POJ A;  2P7Z A;  1R20 A;  4ZNV A;  3PCU A;  5GID A;  1K7L A;  3UUD A;  1GWX A;  2J4A A;  5DXB A;  3OKI A;  2J7Y A;  3VT6 A;  4P6W A;  1NUO A;  3FLI A;  3W5P A;  1FD0 A;  4JYH A;  4YNK A;  2PIU A;  1EXX A;  1Z5X U;  4G2H A;  4IVW A;  4O8F A;  4XLD A;  5DI7 A;  3G0W A;  3SZ1 A;  2I4J A;  3G8O A;  1ILH A;  3VTD A;  5KCC A;  3A9E A;  2XHS A;  3R8D A;  1XP1 A;  4MG5 A;  4OZR U;  3WWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...