3WJ4A

Crystal structure of ppargamma ligand binding domain in complex with tributyltin
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
270
structure length
256
Chain Sequence
GSESADLRALAKHLYDSYIKSFPLTKAKARAILTGKKSPFVIYDMNSLMMGEDKISKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for PPARgamma transactivation by endocrine disrupting organotin compounds
rcsb
molecule keywords Peroxisome proliferator-activated receptor gamma
molecule tags Transcription
source organism Homo sapiens
total genus 99
structure length 256
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3wj4A00
4WHFA 2YLQA 1H9UA 4LNWA 1T65A 1A28A 3ADXA 5JJMA 4ZNSA 5DZIA 4OZRU 3AZ3A 3W0JA 4FN9A 1G5YA 1XJ7A 1XP6A 5DLRA 2R6WA 3OS8A 2Q5GA 1ZEOA 3W5RA 3E00A 4WVDA 2FSZA 1IE9A 4MGBB 1PQ9A 5DIGA 4BCRA 1YJEA 1U3QA 3KYTA 3PO9A 4NB6A 3KDTA 2Q7JA 4K7AA 4OKBA 3VT8A 2POBA 1NDEA 5FQRA 2GP7A 5DMFA 2Q59B 4OK1A 1XVPA 4REEA 5DIDA 5DI7A 5KCWA 1MV9A 1Y0SA 3ADWA 4OH6A 2HB7A 3O1DA 5DXBA 3D90A 3T03A 3HLVA 5KRAA 2H79A 4PLEA 3VT5A 2EWPA 3SP9A 3F5CB 2ZLCA 4N73A 1I37A 2BJ4B 5DWIA 5APHA 1XLSE 5C4UA 3GWSX 5DY8A 3UP0A 4G20A 4J24A 2HARA 5DV6A 5EC9A 1XV9A 3IMYA 4MGDB 2QR9A 4OJBA 4DM8A 3IPSA 2ZK3A 2QPYA 1XLSA 4OZRE 3L1BA 3B0QA 5L7HA 3KMGA 3R8IA 1N83A 2J7XA 2VV3A 5DXPA 2YLOA 2AWHA 2ACLA 4FHHA 4P6XA 2G5OA 1KNUA 3KMRA 2QA8B 3VN2A 1ZUCA 2P1UA 1Z5XU 2OUZA 5KCEA 5CJ6A 4N8RA 1XP1A 2YJAB 2ZNOA 4HLWA 3R5NA 3VT6A 3KMZA 3ADTA 5DUEA 2OVMA 3QT0A 3F7DA 5DXQA 3X36A 3D6DA 5FQPA 1ZDTA 3ZR7A 2PIRA 2P7GA 1P93A 4YPQA 2QGTA 5FQVA 5B5BA 5AAVA 3DZYA 1RKHA 3OLSA 3A40X 1SR7A 4RUPA 2AYRA 3PRGA 2B23A 3WT6A 1U3RA 2Q8SA 4RZGA 5KYJA 3FALA 4IVYA 3PBAA 2E2RA 4G1YA 2QABA 4MG9A 4PP6A 1GWRA 1MVCA 3A9EB 5APKA 4IWCA 1R20A 4LSJA 2HB8A 3W5PA 1OVLA 3OZJA 3B67A 1YA3A 1I38A 2Q7KA 2P1TA 5AK2A 4YNKA 1NQ0A 1XP9A 4QM0A 5E0XA 2NW4A 3HODA 2I0JA 5KRKA 2O4RA 5KYAA 4LTWA 2HWRA 4POHA 5ICKA 4IA2A 2JFAB 3D24A 4PXMA 1XDKB 1YMTA 4MDDA 4E4QA 2ZKCA 1T63A 4ZOMA 4R2UA 3R8DA 2VSTA 1UHLB 4TUZB 3VTCA 2GPOA 3DCUA 1FM9A 5KRLA 3W0AA 5KCDA 2H77A 2VV1B 3WT7A 4UDDA 4M8EA 1DKFA 3ZQTA 3TKMA 5DUHA 3VT3A 3KDUA 2VV4B 5EI1A 5FQTA 5L7EA 1FBYA 1T7FA 3NOAA 5GIDA 2PRGA 3JZBA 2AB2A 1RDTA 2PIPL 2GTKA 2XKWA 4J5XA 3VRTA 5KROA 4S0SA 3X1IA 3PEQA 4DOSA 4IV2A 2VV2A 4MG7A 2Q5SA 2FVJA 2HAMA 2ZASA 3FEJA 4PP5A 1T76A 4OFUA 3OOKA 4RMEA 3S9SA 1YY4A 2ZL9A 4XHDA 3UVVB 4J5WA 1N46A 3AUQA 1G50A 2PIVA 3OMQA 3OKIA 4PVUA 3AFRA 2B1ZA 4R6SA 3ZRAA 4YMQA 1R6GA 3B1MA 5FQSA 4MGAA 3DZUA 2ZMHA 3K23A 1MZNA 1TXIA 2AAXA 2P15A 3O1EA 2PKLA 2P1VA 4XLDA 4XTAA 5EGVA 4MG5A 5L7GA 2Q7LA 3ERTA 1E3KA 4P6WA 2AX9A 2AX6A 2PIWA 4MGCA 4IVWA 4IWFA 4S14A 2HVCA 2OM9A 5DL4A 5DZHA 3VT7A 4TV1B 5DX3A 1M7WA 1I7IA 2AXAA 3CJWA 2G44A 3TKCA 1LV2A 2AM9A 2AA6A 2J4AA 3KFCA 4ZNWA 5DZ1A 2I0GA 3Q95B 3E00D 1A52A 2REWA 1Q4XA 2J14A 1XZXX 1T7TA 1VJBA 3FC6B 5GT4A 4PPSA 2GPPA 4MG8A 1Y0XX 3P89A 2PIQA 5SYZA 2P4YA 4X1FA 4APUA 5KD9A 3UUDB 3AN3A 1XOWA 5DWJA 2NXXA 2ABIA 3A2JA 1PK5A 3X1HA 1YINA 2Q1HA 3V9TA 5HJPB 2AA2A 4WPFA 4K6IA 1S9PA 4MG6A 5GIEA 5IZ0A 5C4OA 1QKUA 2G0HA 1T7RA 3V3EA 2AX7A 3ET1A 2QA6A 4CI5A 1G2NA 3D57A 5DV3A 1P8DA 1FCXA 5A86A 1S0XA 1OSHA 4FNEA 3OOFA 4CSJA 3NSQA 2Q6RA 5E19A 3OSAA 5KCUA 1U3SA 3B5RA 3H52A 5JJMB 3OLFA 3CLDA 2Q3YA 1ZDUA 4X1GA 1T7MA 1ZKYA 4LBDA 4G21A 2B50A 4S0TA 3W5TA 4E2JA 3VTBA 3L03A 2YHDA 1K74D 3TX7B 5DTVA 3ADUA 3R2AA 5KRMA 2YFEA 2PIOA 4KZIA 4OKWA 5JI0D 4A4WA 5EJVA 4K4JA 4OEAA 3GN8A 4A2JA 2W8YA 1FM6A 3VJHA 4J26A 1QKMA 3OMKA 3DZYD 4JAZA 3VSPA 1XVPB 4WHGA 1NAXA 3CS4A 4L96A 3UU7A 4ITEA 3JZCA 4OLMA 2ZK4A 1SQNA 4PP3A 3DT3A 5DIEA 4ZJWA 5DXBB 4JYGA 1X76A 2YJDA 2QH6A 2ZNNA 2ZXNA 4OEDA 5DXGA 4N1YA 1RKGA 3GBKA 3CDPA 5HJSA 3V3QA 4PRGA 2ZMIA 4OHAA 1XV9B 3B0TA 4PWLA 4G2HA 3WFGA 5DKGA 5B41A 1NQ2A 4ITFA 3CDSA 1S0ZA 4PF3A 3L0JA 3UUAA 5HZCA 1R5KA 1ZGYA 2AMAA 2AO6A 3E7CA 2ACLB 3B68A 3G9EA 3OS8C 2BAWA 5DUGA 1FCZA 2ZNPA 3VJSA 4ZNHA 1FCYA 1T79A 1NUOA 1UPVA 3AZ2A 1X7EA 3GD2A 3KPZA 1XAPA 5DYBA 1YUCA 4OC7A 2Z4JA 1HJ1A 3CWDA 1PCGA 5DXEA 3ET2A 3RLLA 5DXRA 2HC4A 2Q5PA 3FEIA 5KCFA 4XUHA 1XIUA 2Q1VA 4Y29A 3CTBA 5E0WA 3OSIA 4NY9A 5AAVB 2JJ3A 2J7YA 3AX8A 3E94A 4XT9A 5APJA 3VT9A 5KRFA 3HZFA 4WQPA 5KRJA 3IPUA 5KRIA 3R8AA 3FUGA 4IA3A 5DVVA 3FALB 4OIUA 4G1ZA 3VTDA 2POGA 3WJ4A 4JYHA 3L0EA 1R1KD 3ET3A 1S19A 4MG9B 1X7BA 2ZLAA 2HASA 1PRGA 3K8SA 5K13A 1YP0A 2NV7A 3BEJA 2Q60A 1SKXA 1YOKA 1L2IA 3OMMA 1OVLB 2FAIA 3FURA 1XQCA 3OGTA 5G46A 4M8HA 1GWXA 1GS4A 3OAPA 3GWXA 4DORA 2Q6JA 2XYXA 4OJ4A 4QL8A 3X31A 1E3GA 3HVLA 3DZUD 2QZOA 2GIUA 5DRJA 5DK9A 3VSOA 3GZ9A 5DMCA 2ZK2A 4IW8A 3OMOA 5AZVA 2V0VA 3VRVA 4R06A 3A2HA 4FGYA 5AWJA 3VT4A 4ZJRA 3RVFA 3ZRBA 2ZBSA 5C4SA 3ADVA 3W0YA 1KV6A 5KRHA 5L11A 5ACCA 3H0AA 3VHUA 1DKFB 1NHZA 1QKTA 3D5FA 3L0LA 3VI8A 4IW6A 4O8FA 3IPQA 2QMVA 5DXMA 4DK7A 3KWYA 3B66A 3WJ5A 4IS8A 4RMCA 4OEZA 4RE8A 2PINA 5E14A 4QK4A 3WMHA 4F9MA 2QXSA 3HC5A 4ZO1X 1DB1A 1NYXA 4MGBA 3W0HA 1X78A 4IA7A 1Z95A 1PQ6A 2ZNQA 4MG7B 4DQMA 2O4JA 4RUOX 2R40A 2AA5A 5DXKA 4IU7A 3PCUA 1NQ7A 2NXXE 1HG4A 1M13A 5HCVA 2Q59A 2P7AA 3AN4A 2HCDA 4S15A 2Z4BA 2AX8A 3CQVA 1EREA 1IE8A 3CS8A 4MGAB 3WWRA 4HEEX 1U9EA 3CS6A 4REFA 4ZNTA 3M7RA 3F5CA 2BJ4A 3K6PA 4OKXA 4WLBA 3B65A 1LBDA 2GL8A 3G8OA 3GYUA 2VV0A 3IXPA 4MGDA 4NIEA 1XPCA 4RFWA 5DX3B 5F9BA 2F4BA 2OCFA 2PNUA 2P7ZA 3OZ0A 1ERRA 4RWVA 5DYDA 3TY0A 3FXVA 3A2IA 4A4VA 4YT1A 3BC5A 4ZNVA 4OH5A 5C4TA 4J5XC 5KR9A 2ZK1A 3OLLA 4LNXA 3LMPA 3P0UA 2QA8A 4B7WA 3EYBA 3AUNA 1T74A 3HO0A 3L3XA 4G2IA 5G44A 1EXXA 5DWEA 4QE8A 1GWQA 3SZ1A 4ZO1B 3ET0A 3IXPD 3MNEA 3W0GA 3OMPA 4CI4A 4MG8B 2VSRA 4Q13A 1FM6D 2IOGA 4IQRA 3P88A 5EHJA 1NRLA 1WM0X 3DR1A 4J5WC 5DKSA 4XI3A 5AVLA 4JYIA 4Q50A 5IAWA 2OVHA 2QW4A 2I4JA 2NPAA 4XAOA 5DU5A 2P54A 3BQDA 3AZ1A 3WTQA 4NUFA 3RY9A 4OARA 2AA7A 4ZNUA 2Q6SA 4QJRA 5E7VA 1G1UA 3NSPA 3VJIA 2ZK0A 5DVSA 2GPVA 4RZFA 3K22A 1K7LA 3RUUA 4QE6A 1YIMA 2IOKA 2HBHA 1NQ1A 3MNPA 3VHVA 5IXKA 3G0WA 1XNNA 3RLJA 3ADSA 3V49A 2ZY0A 3W5QA 5KCTA 3A9EA 4UDCA 4FHIA 1R20D 5AZTA 3WGPA 1N4HA 5ETHA 2QNVA 3RUTA 1ZAFA 3LBDA 3G8IA 3R5MA 1K74A 2PIUA 2QSEA 1PDUA 5DKEA 2JF9A 1PZLA 5DZ3A 5AYGA 5GICA 4NQAB 1SJ0A 3R29A 1NAVA 4ZN7A 2Q61A 2YLYA 1YYEA 1RK3A 2ZXZA 4PLDA 2ATHA 2YLPA 3B0RA 4OFRA 2V7CA 5E15A 2JFAA 3P8XA 3VRUA 3W0IA 4EMAA 1I7GA 1XDKA 3A3ZX 4ONIA 3UU7B 5H1EA 2O9IA 2YATA 2Q7IA 1UHLA 4TUZA 1S9QA 1FM9D 2XYJA 3WT5A 5LWPA 3U9QA 1UPWA 2PJLA 3VHWA 3FS1A 2VV1A 2GPUA 2R6YA 4E4KA 5JY3A 3V4AA 1M2ZA 2QTUA 4OEYA 3DY6A 5DWGA 5I4VA 2Q70A 2VV4A 2ZVTA 4RMDA 1XNXA 4OKTA 5AAUA 4DMAA 5DZ0A 4RZEA 1RDTD 1Z5XE 1UOMA 2OZ7A 4JL4A 3V9VA 3UUAB 5HYRA 4IV4A 2GWXA 4UDBA 3GYTA 1T73A 3N00A 2ZFXA 4KZMA 2XYWA 3UUCA 5G43A 2XHSA 4RUJA 2I4ZA 4OZTU 2QXMA 5G45A 3VRWA 4POJA 4JGVA 4OGHA 3AURA 1ZH7A 4UDAA 5DKBA 5LGAA 2ZK6A 2G0GA 3HM1A 5DWLA 2IHQA 1FD0A 2QE4A 3HC6A 3PLZA 4OIVA 1XQ3A 4KZJA 3UVVA 1L2JA 2I4PA 2ZK5A 5DSHA 5G3JA 5EITA 3OS9A 4ZN9A 5M96A 5DV8A 3OSWA 1XB7A 1Y9RA 2LBDA 5KCCA 4Q0AC 3IA6A 4IA1A 4RAKA 3MNOA 5KRCA 4XUMA 5HYKA 2HFPA 3ERDA 2PIXA 3H0AD 3UP3A 3SP6A 1BSXA 4TV1A 2QGWA 1ILGA 1KKQA 4DK8A 2A3IA 4IUIA 1QKNA 4N5GA 5E1CA 2ZMJA 3KBAA 2OAXA 1RJKA 3Q95A 2PITA 2B1VA 1R1KA 1TFCA 2AMBA 4ZI1A 1X7JA 3A78A 1X7RA 3FC6A 4OZTE 2ZXMA 2R40D 5G42A 4PPPA 4OJ9A 3V9YA 3VJTA 3OKHA 3W0CA 5DP0A 1OT7A 3L3ZA 5AWKA 3WFFA 1YOWA 3UUDA 1T5ZA 5G5WA 4G1DA 4L98A 4EM9A 2QZOB 3FLIA 3DCTA 3ILZA 3B3KA 5HJPA 1ILHA 5DRMA 5AVIA 1EXAA 1K4WA 3B0WA 3HQ5A 4OILA 5DVCA 2HWQA 1OSVA 1PQCA 4DM6A
chains in the Genus database with same CATH superfamily
4WHFA 2YLQA 1H9UA 4LNWA 1T65A 1A28A 3ADXA 5JJMA 4ZNSA 5DZIA 4OZRU 3AZ3A 3W0JA 4FN9A 1G5YA 1XJ7A 1XP6A 5DLRA 2R6WA 3OS8A 2Q5GA 1ZEOA 3W5RA 3E00A 4WVDA 2FSZA 1IE9A 4MGBB 1PQ9A 5DIGA 4BCRA 1YJEA 1U3QA 3KYTA 3PO9A 4NB6A 3KDTA 2Q7JA 4K7AA 4OKBA 3VT8A 2POBA 1NDEA 5FQRA 2GP7A 5DMFA 2Q59B 4OK1A 1XVPA 4REEA 5DIDA 5DI7A 5KCWA 1MV9A 1Y0SA 3ADWA 4OH6A 2HB7A 3O1DA 5DXBA 3D90A 3T03A 3HLVA 5KRAA 2H79A 4PLEA 3VT5A 2EWPA 3SP9A 3F5CB 2ZLCA 4N73A 1I37A 2BJ4B 5DWIA 5APHA 1XLSE 5C4UA 3GWSX 5DY8A 3UP0A 4G20A 4J24A 2HARA 5DV6A 5EC9A 1XV9A 3IMYA 4MGDB 2QR9A 4OJBA 4DM8A 3IPSA 2ZK3A 2QPYA 1XLSA 4OZRE 3L1BA 3B0QA 5L7HA 3KMGA 3R8IA 1N83A 2J7XA 2VV3A 5DXPA 2YLOA 2AWHA 2ACLA 4FHHA 4P6XA 2G5OA 1KNUA 3KMRA 2QA8B 3VN2A 1ZUCA 2P1UA 1Z5XU 2OUZA 5KCEA 5CJ6A 4N8RA 1XP1A 2YJAB 2ZNOA 4HLWA 3R5NA 3VT6A 3KMZA 3ADTA 5DUEA 2OVMA 3QT0A 3F7DA 5DXQA 3X36A 3D6DA 5FQPA 1ZDTA 3ZR7A 2PIRA 2P7GA 1P93A 4YPQA 2QGTA 5FQVA 5B5BA 5AAVA 3DZYA 1RKHA 3OLSA 3A40X 1SR7A 4RUPA 2AYRA 3PRGA 2B23A 3WT6A 1U3RA 2Q8SA 4RZGA 5KYJA 3FALA 4IVYA 3PBAA 2E2RA 4G1YA 2QABA 4MG9A 4PP6A 1GWRA 1MVCA 3A9EB 5APKA 4IWCA 1R20A 4LSJA 2HB8A 3W5PA 1OVLA 3OZJA 3B67A 1YA3A 1I38A 2Q7KA 2P1TA 5AK2A 4YNKA 1NQ0A 1XP9A 4QM0A 5E0XA 2NW4A 3HODA 2I0JA 5KRKA 2O4RA 5KYAA 4LTWA 2HWRA 4POHA 5ICKA 4IA2A 2JFAB 3D24A 4PXMA 1XDKB 1YMTA 4MDDA 4E4QA 2ZKCA 1T63A 4ZOMA 4R2UA 3R8DA 2VSTA 1UHLB 4TUZB 3VTCA 2GPOA 3DCUA 1FM9A 5KRLA 3W0AA 5KCDA 2H77A 2VV1B 3WT7A 4UDDA 4M8EA 1DKFA 3ZQTA 3TKMA 5DUHA 3VT3A 3KDUA 2VV4B 5EI1A 5FQTA 5L7EA 1FBYA 1T7FA 3NOAA 5GIDA 2PRGA 3JZBA 2AB2A 1RDTA 2PIPL 2GTKA 2XKWA 4J5XA 3VRTA 5KROA 4S0SA 3X1IA 3PEQA 4DOSA 4IV2A 2VV2A 4MG7A 2Q5SA 2FVJA 2HAMA 2ZASA 3FEJA 4PP5A 1T76A 4OFUA 3OOKA 4RMEA 3S9SA 1YY4A 2ZL9A 4XHDA 3UVVB 4J5WA 1N46A 3AUQA 1G50A 2PIVA 3OMQA 3OKIA 4PVUA 3AFRA 2B1ZA 4R6SA 3ZRAA 4YMQA 1R6GA 3B1MA 5FQSA 4MGAA 3DZUA 2ZMHA 3K23A 1MZNA 1TXIA 2AAXA 2P15A 3O1EA 2PKLA 2P1VA 4XLDA 4XTAA 5EGVA 4MG5A 5L7GA 2Q7LA 3ERTA 1E3KA 4P6WA 2AX9A 2AX6A 2PIWA 4MGCA 4IVWA 4IWFA 4S14A 2HVCA 2OM9A 5DL4A 5DZHA 3VT7A 4TV1B 5DX3A 1M7WA 1I7IA 2AXAA 3CJWA 2G44A 3TKCA 1LV2A 2AM9A 2AA6A 2J4AA 3KFCA 4ZNWA 5DZ1A 2I0GA 3Q95B 3E00D 1A52A 2REWA 1Q4XA 2J14A 1XZXX 1T7TA 1VJBA 3FC6B 5GT4A 4PPSA 2GPPA 4MG8A 1Y0XX 3P89A 2PIQA 5SYZA 2P4YA 4X1FA 4APUA 5KD9A 3UUDB 3AN3A 1XOWA 5DWJA 2NXXA 2ABIA 3A2JA 1PK5A 3X1HA 1YINA 2Q1HA 3V9TA 5HJPB 2AA2A 4WPFA 4K6IA 1S9PA 4MG6A 5GIEA 5IZ0A 5C4OA 1QKUA 2G0HA 1T7RA 3V3EA 2AX7A 3ET1A 2QA6A 4CI5A 1G2NA 3D57A 5DV3A 1P8DA 1FCXA 5A86A 1S0XA 1OSHA 4FNEA 3OOFA 4CSJA 3NSQA 2Q6RA 5E19A 3OSAA 5KCUA 1U3SA 3B5RA 3H52A 5JJMB 3OLFA 3CLDA 2Q3YA 1ZDUA 4X1GA 1T7MA 1ZKYA 4LBDA 4G21A 2B50A 4S0TA 3W5TA 4E2JA 3VTBA 3L03A 2YHDA 1K74D 3TX7B 5DTVA 3ADUA 3R2AA 5KRMA 2YFEA 2PIOA 4KZIA 4OKWA 5JI0D 4A4WA 5EJVA 4K4JA 4OEAA 3GN8A 4A2JA 2W8YA 1FM6A 3VJHA 4J26A 1QKMA 3OMKA 3DZYD 4JAZA 3VSPA 1XVPB 4WHGA 1NAXA 3CS4A 4L96A 3UU7A 4ITEA 3JZCA 4OLMA 2ZK4A 1SQNA 4PP3A 3DT3A 5DIEA 4ZJWA 5DXBB 4JYGA 1X76A 2YJDA 2QH6A 2ZNNA 2ZXNA 4OEDA 5DXGA 4N1YA 1RKGA 3GBKA 3CDPA 5HJSA 3V3QA 4PRGA 2ZMIA 4OHAA 1XV9B 3B0TA 4PWLA 4G2HA 3WFGA 5DKGA 5B41A 1NQ2A 4ITFA 3CDSA 1S0ZA 4PF3A 3L0JA 3UUAA 5HZCA 1R5KA 1ZGYA 2AMAA 2AO6A 3E7CA 2ACLB 3B68A 3G9EA 3OS8C 2BAWA 5DUGA 1FCZA 2ZNPA 3VJSA 4ZNHA 1FCYA 1T79A 1NUOA 1UPVA 3AZ2A 1X7EA 3GD2A 3KPZA 1XAPA 5DYBA 1YUCA 4OC7A 2Z4JA 1HJ1A 3CWDA 1PCGA 5DXEA 3ET2A 3RLLA 5DXRA 2HC4A 2Q5PA 3FEIA 5KCFA 4XUHA 1XIUA 2Q1VA 4Y29A 3CTBA 5E0WA 3OSIA 4NY9A 5AAVB 2JJ3A 2J7YA 3AX8A 3E94A 4XT9A 5APJA 3VT9A 5KRFA 3HZFA 4WQPA 5KRJA 3IPUA 5KRIA 3R8AA 3FUGA 4IA3A 5DVVA 3FALB 4OIUA 4G1ZA 3VTDA 2POGA 3WJ4A 4JYHA 3L0EA 1R1KD 3ET3A 1S19A 4MG9B 1X7BA 2ZLAA 2HASA 1PRGA 3K8SA 5K13A 1YP0A 2NV7A 3BEJA 2Q60A 1SKXA 1YOKA 1L2IA 3OMMA 1OVLB 2FAIA 3FURA 1XQCA 3OGTA 5G46A 4M8HA 1GWXA 1GS4A 3OAPA 3GWXA 4DORA 2Q6JA 2XYXA 4OJ4A 4QL8A 3X31A 1E3GA 3HVLA 3DZUD 2QZOA 2GIUA 5DRJA 5DK9A 3VSOA 3GZ9A 5DMCA 2ZK2A 4IW8A 3OMOA 5AZVA 2V0VA 3VRVA 4R06A 3A2HA 4FGYA 5AWJA 3VT4A 4ZJRA 3RVFA 3ZRBA 2ZBSA 5C4SA 3ADVA 3W0YA 1KV6A 5KRHA 5L11A 5ACCA 3H0AA 3VHUA 1DKFB 1NHZA 1QKTA 3D5FA 3L0LA 3VI8A 4IW6A 4O8FA 3IPQA 2QMVA 5DXMA 4DK7A 3KWYA 3B66A 3WJ5A 4IS8A 4RMCA 4OEZA 4RE8A 2PINA 5E14A 4QK4A 3WMHA 4F9MA 2QXSA 3HC5A 4ZO1X 1DB1A 1NYXA 4MGBA 3W0HA 1X78A 4IA7A 1Z95A 1PQ6A 2ZNQA 4MG7B 4DQMA 2O4JA 4RUOX 2R40A 2AA5A 5DXKA 4IU7A 3PCUA 1NQ7A 2NXXE 1HG4A 1M13A 5HCVA 2Q59A 2P7AA 3AN4A 2HCDA 4S15A 2Z4BA 2AX8A 3CQVA 1EREA 1IE8A 3CS8A 4MGAB 3WWRA 4HEEX 1U9EA 3CS6A 4REFA 4ZNTA 3M7RA 3F5CA 2BJ4A 3K6PA 4OKXA 4WLBA 3B65A 1LBDA 2GL8A 3G8OA 3GYUA 2VV0A 3IXPA 4MGDA 4NIEA 1XPCA 4RFWA 5DX3B 5F9BA 2F4BA 2OCFA 2PNUA 2P7ZA 3OZ0A 1ERRA 4RWVA 5DYDA 3TY0A 3FXVA 3A2IA 4A4VA 4YT1A 3BC5A 4ZNVA 4OH5A 5C4TA 4J5XC 5KR9A 2ZK1A 3OLLA 4LNXA 3LMPA 3P0UA 2QA8A 4B7WA 3EYBA 3AUNA 1T74A 3HO0A 3L3XA 4G2IA 5G44A 1EXXA 5DWEA 4QE8A 1GWQA 3SZ1A 4ZO1B 3ET0A 3IXPD 3MNEA 3W0GA 3OMPA 4CI4A 4MG8B 2VSRA 4Q13A 1FM6D 2IOGA 4IQRA 3P88A 5EHJA 1NRLA 1WM0X 3DR1A 4J5WC 5DKSA 4XI3A 5AVLA 4JYIA 4Q50A 5IAWA 2OVHA 2QW4A 2I4JA 2NPAA 4XAOA 5DU5A 2P54A 3BQDA 3AZ1A 3WTQA 4NUFA 3RY9A 4OARA 2AA7A 4ZNUA 2Q6SA 4QJRA 5E7VA 1G1UA 3NSPA 3VJIA 2ZK0A 5DVSA 2GPVA 4RZFA 3K22A 1K7LA 3RUUA 4QE6A 1YIMA 2IOKA 2HBHA 1NQ1A 3MNPA 3VHVA 5IXKA 3G0WA 1XNNA 3RLJA 3ADSA 3V49A 2ZY0A 3W5QA 5KCTA 3A9EA 4UDCA 4FHIA 1R20D 5AZTA 3WGPA 1N4HA 5ETHA 2QNVA 3RUTA 1ZAFA 3LBDA 3G8IA 3R5MA 1K74A 2PIUA 2QSEA 1PDUA 5DKEA 2JF9A 1PZLA 5DZ3A 5AYGA 5GICA 4NQAB 1SJ0A 3R29A 1NAVA 4ZN7A 2Q61A 2YLYA 1YYEA 1RK3A 2ZXZA 4PLDA 2ATHA 2YLPA 3B0RA 4OFRA 2V7CA 5E15A 2JFAA 3P8XA 3VRUA 3W0IA 4EMAA 1I7GA 1XDKA 3A3ZX 4ONIA 3UU7B 5H1EA 2O9IA 2YATA 2Q7IA 1UHLA 4TUZA 1S9QA 1FM9D 2XYJA 3WT5A 5LWPA 3U9QA 1UPWA 2PJLA 3VHWA 3FS1A 2VV1A 2GPUA 2R6YA 4E4KA 5JY3A 3V4AA 1M2ZA 2QTUA 4OEYA 3DY6A 5DWGA 5I4VA 2Q70A 2VV4A 2ZVTA 4RMDA 1XNXA 4OKTA 5AAUA 4DMAA 5DZ0A 4RZEA 1RDTD 1Z5XE 1UOMA 2OZ7A 4JL4A 3V9VA 3UUAB 5HYRA 4IV4A 2GWXA 4UDBA 3GYTA 1T73A 3N00A 2ZFXA 4KZMA 2XYWA 3UUCA 5G43A 2XHSA 4RUJA 2I4ZA 4OZTU 2QXMA 5G45A 3VRWA 4POJA 4JGVA 4OGHA 3AURA 1ZH7A 4UDAA 5DKBA 5LGAA 2ZK6A 2G0GA 3HM1A 5DWLA 2IHQA 1FD0A 2QE4A 3HC6A 3PLZA 4OIVA 1XQ3A 4KZJA 3UVVA 1L2JA 2I4PA 2ZK5A 5DSHA 5G3JA 5EITA 3OS9A 4ZN9A 5M96A 5DV8A 3OSWA 1XB7A 1Y9RA 2LBDA 5KCCA 4Q0AC 3IA6A 4IA1A 4RAKA 3MNOA 5KRCA 4XUMA 5HYKA 2HFPA 3ERDA 2PIXA 3H0AD 3UP3A 3SP6A 1BSXA 4TV1A 2QGWA 1ILGA 1KKQA 4DK8A 2A3IA 4IUIA 1QKNA 4N5GA 5E1CA 2ZMJA 3KBAA 2OAXA 1RJKA 3Q95A 2PITA 2B1VA 1R1KA 1TFCA 2AMBA 4ZI1A 1X7JA 3A78A 1X7RA 3FC6A 4OZTE 2ZXMA 2R40D 5G42A 4PPPA 4OJ9A 3V9YA 3VJTA 3OKHA 3W0CA 5DP0A 1OT7A 3L3ZA 5AWKA 3WFFA 1YOWA 3UUDA 1T5ZA 5G5WA 4G1DA 4L98A 4EM9A 2QZOB 3FLIA 3DCTA 3ILZA 3B3KA 5HJPA 1ILHA 5DRMA 5AVIA 1EXAA 1K4WA 3B0WA 3HQ5A 4OILA 5DVCA 2HWQA 1OSVA 1PQCA 4DM6A
chains in the Genus database with same CATH topology
4WHFA 2YLQA 1H9UA 4LNWA 1T65A 1A28A 3ADXA 5JJMA 4ZNSA 5DZIA 4OZRU 3AZ3A 3W0JA 4FN9A 1G5YA 1XJ7A 1XP6A 5DLRA 2R6WA 3OS8A 2Q5GA 1ZEOA 3W5RA 3E00A 4WVDA 2FSZA 1IE9A 4MGBB 1PQ9A 5DIGA 4BCRA 1YJEA 1U3QA 3KYTA 3PO9A 4NB6A 3KDTA 2Q7JA 4K7AA 4OKBA 3VT8A 2POBA 1NDEA 5FQRA 2GP7A 5DMFA 2Q59B 4OK1A 1XVPA 4REEA 5DIDA 5DI7A 5KCWA 1MV9A 1Y0SA 3ADWA 4OH6A 2HB7A 3O1DA 5DXBA 3D90A 3T03A 3HLVA 5KRAA 2H79A 4PLEA 3VT5A 2EWPA 3SP9A 3F5CB 2ZLCA 4N73A 1I37A 2BJ4B 5DWIA 5APHA 1XLSE 5C4UA 3GWSX 5DY8A 3UP0A 4G20A 4J24A 2HARA 5DV6A 5EC9A 1XV9A 3IMYA 4MGDB 2QR9A 4OJBA 4DM8A 3IPSA 2ZK3A 2QPYA 1XLSA 4OZRE 3L1BA 3B0QA 5L7HA 3KMGA 3R8IA 1N83A 2J7XA 2VV3A 5DXPA 2YLOA 2AWHA 2ACLA 4FHHA 4P6XA 2G5OA 1KNUA 3KMRA 2QA8B 3VN2A 1ZUCA 2P1UA 1Z5XU 2OUZA 5KCEA 5CJ6A 4N8RA 1XP1A 2YJAB 2ZNOA 4HLWA 3R5NA 3VT6A 3KMZA 3ADTA 5DUEA 2OVMA 3QT0A 3F7DA 5DXQA 3X36A 3D6DA 5FQPA 1ZDTA 3ZR7A 2PIRA 2P7GA 1P93A 4YPQA 2QGTA 5FQVA 5B5BA 5AAVA 3DZYA 1RKHA 3OLSA 3A40X 1SR7A 4RUPA 2AYRA 3PRGA 2B23A 3WT6A 1U3RA 2Q8SA 4RZGA 5KYJA 3FALA 4IVYA 3PBAA 2E2RA 4G1YA 2QABA 4MG9A 4PP6A 1GWRA 1MVCA 3A9EB 5APKA 4IWCA 1R20A 4LSJA 2HB8A 3W5PA 1OVLA 3OZJA 3B67A 1YA3A 1I38A 2Q7KA 2P1TA 5AK2A 4YNKA 1NQ0A 1XP9A 4QM0A 5E0XA 2NW4A 3HODA 2I0JA 5KRKA 2O4RA 5KYAA 4LTWA 2HWRA 4POHA 5ICKA 4IA2A 2JFAB 3D24A 4PXMA 1XDKB 1YMTA 4MDDA 4E4QA 2ZKCA 1T63A 4ZOMA 4R2UA 3R8DA 2VSTA 1UHLB 4TUZB 3VTCA 2GPOA 3DCUA 1FM9A 5KRLA 3W0AA 5KCDA 2H77A 2VV1B 3WT7A 4UDDA 4M8EA 1DKFA 3ZQTA 3TKMA 5DUHA 3VT3A 3KDUA 2VV4B 5EI1A 5FQTA 5L7EA 1FBYA 1T7FA 3NOAA 5GIDA 2PRGA 3JZBA 2AB2A 1RDTA 2PIPL 2GTKA 2XKWA 4J5XA 3VRTA 5KROA 4S0SA 3X1IA 3PEQA 4DOSA 4IV2A 2VV2A 4MG7A 2Q5SA 2FVJA 2HAMA 2ZASA 3FEJA 4PP5A 1T76A 4OFUA 3OOKA 4RMEA 3S9SA 1YY4A 2ZL9A 4XHDA 3UVVB 4J5WA 1N46A 3AUQA 1G50A 2PIVA 3OMQA 3OKIA 4PVUA 3AFRA 2B1ZA 4R6SA 3ZRAA 4YMQA 1R6GA 3B1MA 5FQSA 4MGAA 3DZUA 2ZMHA 3K23A 1MZNA 1TXIA 2AAXA 2P15A 3O1EA 2PKLA 2P1VA 4XLDA 4XTAA 5EGVA 4MG5A 5L7GA 2Q7LA 3ERTA 1E3KA 4P6WA 2AX9A 2AX6A 2PIWA 4MGCA 4IVWA 4IWFA 4S14A 2HVCA 2OM9A 5DL4A 5DZHA 3VT7A 4TV1B 5DX3A 1M7WA 1I7IA 2AXAA 3CJWA 2G44A 3TKCA 1LV2A 2AM9A 2AA6A 2J4AA 3KFCA 4ZNWA 5DZ1A 2I0GA 3Q95B 3E00D 1A52A 2REWA 1Q4XA 2J14A 1XZXX 1T7TA 1VJBA 3FC6B 5GT4A 4PPSA 2GPPA 4MG8A 1Y0XX 3P89A 2PIQA 5SYZA 2P4YA 4X1FA 4APUA 5KD9A 3UUDB 3AN3A 1XOWA 5DWJA 2NXXA 2ABIA 3A2JA 1PK5A 3X1HA 1YINA 2Q1HA 3V9TA 5HJPB 2AA2A 4WPFA 4K6IA 1S9PA 4MG6A 5GIEA 5IZ0A 5C4OA 1QKUA 2G0HA 1T7RA 3V3EA 2AX7A 3ET1A 2QA6A 4CI5A 1G2NA 3D57A 5DV3A 1P8DA 1FCXA 5A86A 1S0XA 1OSHA 4FNEA 3OOFA 4CSJA 3NSQA 2Q6RA 5E19A 3OSAA 5KCUA 1U3SA 3B5RA 3H52A 5JJMB 3OLFA 3CLDA 2Q3YA 1ZDUA 4X1GA 1T7MA 1ZKYA 4LBDA 4G21A 2B50A 4S0TA 3W5TA 4E2JA 3VTBA 3L03A 2YHDA 1K74D 3TX7B 5DTVA 3ADUA 3R2AA 5KRMA 2YFEA 2PIOA 4KZIA 4OKWA 5JI0D 4A4WA 5EJVA 4K4JA 4OEAA 3GN8A 4A2JA 2W8YA 1FM6A 3VJHA 4J26A 1QKMA 3OMKA 3DZYD 4JAZA 3VSPA 1XVPB 4WHGA 1NAXA 3CS4A 4L96A 3UU7A 4ITEA 3JZCA 4OLMA 2ZK4A 1SQNA 4PP3A 3DT3A 5DIEA 4ZJWA 5DXBB 4JYGA 1X76A 2YJDA 2QH6A 2ZNNA 2ZXNA 4OEDA 5DXGA 4N1YA 1RKGA 3GBKA 3CDPA 5HJSA 3V3QA 4PRGA 2ZMIA 4OHAA 1XV9B 3B0TA 4PWLA 4G2HA 3WFGA 5DKGA 5B41A 1NQ2A 4ITFA 3CDSA 1S0ZA 4PF3A 3L0JA 3UUAA 5HZCA 1R5KA 1ZGYA 2AMAA 2AO6A 3E7CA 2ACLB 3B68A 3G9EA 3OS8C 2BAWA 5DUGA 1FCZA 2ZNPA 3VJSA 4ZNHA 1FCYA 1T79A 1NUOA 1UPVA 3AZ2A 1X7EA 3GD2A 3KPZA 1XAPA 5DYBA 1YUCA 4OC7A 2Z4JA 1HJ1A 3CWDA 1PCGA 5DXEA 3ET2A 3RLLA 5DXRA 2HC4A 2Q5PA 3FEIA 5KCFA 4XUHA 1XIUA 2Q1VA 4Y29A 3CTBA 5E0WA 3OSIA 4NY9A 5AAVB 2JJ3A 2J7YA 3AX8A 3E94A 4XT9A 5APJA 3VT9A 5KRFA 3HZFA 4WQPA 5KRJA 3IPUA 5KRIA 3R8AA 3FUGA 4IA3A 5DVVA 3FALB 4OIUA 4G1ZA 3VTDA 2POGA 3WJ4A 4JYHA 3L0EA 1R1KD 3ET3A 1S19A 4MG9B 1X7BA 2ZLAA 2HASA 1PRGA 3K8SA 5K13A 1YP0A 2NV7A 3BEJA 2Q60A 1SKXA 1YOKA 1L2IA 3OMMA 1OVLB 2FAIA 3FURA 1XQCA 3OGTA 5G46A 4M8HA 1GWXA 1GS4A 3OAPA 3GWXA 4DORA 2Q6JA 2XYXA 4OJ4A 4QL8A 3X31A 1E3GA 3HVLA 3DZUD 2QZOA 2GIUA 5DRJA 5DK9A 3VSOA 3GZ9A 5DMCA 2ZK2A 4IW8A 3OMOA 5AZVA 2V0VA 3VRVA 4R06A 3A2HA 4FGYA 5AWJA 3VT4A 4ZJRA 3RVFA 3ZRBA 2ZBSA 5C4SA 3ADVA 3W0YA 1KV6A 5KRHA 5L11A 5ACCA 3H0AA 3VHUA 1DKFB 1NHZA 1QKTA 3D5FA 3L0LA 3VI8A 4IW6A 4O8FA 3IPQA 2QMVA 5DXMA 4DK7A 3KWYA 3B66A 3WJ5A 4IS8A 4RMCA 4OEZA 4RE8A 2PINA 5E14A 4QK4A 3WMHA 4F9MA 2QXSA 3HC5A 4ZO1X 1DB1A 1NYXA 4MGBA 3W0HA 1X78A 4IA7A 1Z95A 1PQ6A 2ZNQA 4MG7B 4DQMA 2O4JA 4RUOX 2R40A 2AA5A 5DXKA 4IU7A 3PCUA 1NQ7A 2NXXE 1HG4A 1M13A 5HCVA 2Q59A 2P7AA 3AN4A 2HCDA 4S15A 2Z4BA 2AX8A 3CQVA 1EREA 1IE8A 3CS8A 4MGAB 3WWRA 4HEEX 1U9EA 3CS6A 4REFA 4ZNTA 3M7RA 3F5CA 2BJ4A 3K6PA 4OKXA 4WLBA 3B65A 1LBDA 2GL8A 3G8OA 3GYUA 2VV0A 3IXPA 4MGDA 4NIEA 1XPCA 4RFWA 5DX3B 5F9BA 2F4BA 2OCFA 2PNUA 2P7ZA 3OZ0A 1ERRA 4RWVA 5DYDA 3TY0A 3FXVA 3A2IA 4A4VA 4YT1A 3BC5A 4ZNVA 4OH5A 5C4TA 4J5XC 5KR9A 2ZK1A 3OLLA 4LNXA 3LMPA 3P0UA 2QA8A 4B7WA 3EYBA 3AUNA 1T74A 3HO0A 3L3XA 4G2IA 5G44A 1EXXA 5DWEA 4QE8A 1GWQA 3SZ1A 4ZO1B 3ET0A 3IXPD 3MNEA 3W0GA 3OMPA 4CI4A 4MG8B 2VSRA 4Q13A 1FM6D 2IOGA 4IQRA 3P88A 5EHJA 1NRLA 1WM0X 3DR1A 4J5WC 5DKSA 4XI3A 5AVLA 4JYIA 4Q50A 5IAWA 2OVHA 2QW4A 2I4JA 2NPAA 4XAOA 5DU5A 2P54A 3BQDA 3AZ1A 3WTQA 4NUFA 3RY9A 4OARA 2AA7A 4ZNUA 2Q6SA 4QJRA 5E7VA 1G1UA 3NSPA 3VJIA 2ZK0A 5DVSA 2GPVA 4RZFA 3K22A 1K7LA 3RUUA 4QE6A 1YIMA 2IOKA 2HBHA 1NQ1A 3MNPA 3VHVA 5IXKA 3G0WA 1XNNA 3RLJA 3ADSA 3V49A 2ZY0A 3W5QA 5KCTA 3A9EA 4UDCA 4FHIA 1R20D 5AZTA 3WGPA 1N4HA 5ETHA 2QNVA 3RUTA 1ZAFA 3LBDA 3G8IA 3R5MA 1K74A 2PIUA 2QSEA 1PDUA 5DKEA 2JF9A 1PZLA 5DZ3A 5AYGA 5GICA 4NQAB 1SJ0A 3R29A 1NAVA 4ZN7A 2Q61A 2YLYA 1YYEA 1RK3A 2ZXZA 4PLDA 2ATHA 2YLPA 3B0RA 4OFRA 2V7CA 5E15A 2JFAA 3P8XA 3VRUA 3W0IA 4EMAA 1I7GA 1XDKA 3A3ZX 4ONIA 3UU7B 5H1EA 2O9IA 2YATA 2Q7IA 1UHLA 4TUZA 1S9QA 1FM9D 2XYJA 3WT5A 5LWPA 3U9QA 1UPWA 2PJLA 3VHWA 3FS1A 2VV1A 2GPUA 2R6YA 4E4KA 5JY3A 3V4AA 1M2ZA 2QTUA 4OEYA 3DY6A 5DWGA 5I4VA 2Q70A 2VV4A 2ZVTA 4RMDA 1XNXA 4OKTA 5AAUA 4DMAA 5DZ0A 4RZEA 1RDTD 1Z5XE 1UOMA 2OZ7A 4JL4A 3V9VA 3UUAB 5HYRA 4IV4A 2GWXA 4UDBA 3GYTA 1T73A 3N00A 2ZFXA 4KZMA 2XYWA 3UUCA 5G43A 2XHSA 4RUJA 2I4ZA 4OZTU 2QXMA 5G45A 3VRWA 4POJA 4JGVA 4OGHA 3AURA 1ZH7A 4UDAA 5DKBA 5LGAA 2ZK6A 2G0GA 3HM1A 5DWLA 2IHQA 1FD0A 2QE4A 3HC6A 3PLZA 4OIVA 1XQ3A 4KZJA 3UVVA 1L2JA 2I4PA 2ZK5A 5DSHA 5G3JA 5EITA 3OS9A 4ZN9A 5M96A 5DV8A 3OSWA 1XB7A 1Y9RA 2LBDA 5KCCA 4Q0AC 3IA6A 4IA1A 4RAKA 3MNOA 5KRCA 4XUMA 5HYKA 2HFPA 3ERDA 2PIXA 3H0AD 3UP3A 3SP6A 1BSXA 4TV1A 2QGWA 1ILGA 1KKQA 4DK8A 2A3IA 4IUIA 1QKNA 4N5GA 5E1CA 2ZMJA 3KBAA 2OAXA 1RJKA 3Q95A 2PITA 2B1VA 1R1KA 1TFCA 2AMBA 4ZI1A 1X7JA 3A78A 1X7RA 3FC6A 4OZTE 2ZXMA 2R40D 5G42A 4PPPA 4OJ9A 3V9YA 3VJTA 3OKHA 3W0CA 5DP0A 1OT7A 3L3ZA 5AWKA 3WFFA 1YOWA 3UUDA 1T5ZA 5G5WA 4G1DA 4L98A 4EM9A 2QZOB 3FLIA 3DCTA 3ILZA 3B3KA 5HJPA 1ILHA 5DRMA 5AVIA 1EXAA 1K4WA 3B0WA 3HQ5A 4OILA 5DVCA 2HWQA 1OSVA 1PQCA 4DM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WHF A;  2YLQ A;  1H9U A;  4LNW A;  1T65 A;  1A28 A;  3ADX A;  5JJM A;  4ZNS A;  5DZI A;  4OZR U;  3AZ3 A;  3W0J A;  4FN9 A;  1G5Y A;  1XJ7 A;  1XP6 A;  5DLR A;  2R6W A;  3OS8 A;  2Q5G A;  1ZEO A;  3W5R A;  3E00 A;  4WVD A;  2FSZ A;  1IE9 A;  4MGB B;  1PQ9 A;  5DIG A;  4BCR A;  1YJE A;  1U3Q A;  3KYT A;  3PO9 A;  4NB6 A;  3KDT A;  2Q7J A;  4K7A A;  4OKB A;  3VT8 A;  2POB A;  1NDE A;  5FQR A;  2GP7 A;  5DMF A;  2Q59 B;  4OK1 A;  1XVP A;  4REE A;  5DID A;  5DI7 A;  5KCW A;  1MV9 A;  1Y0S A;  3ADW A;  4OH6 A;  2HB7 A;  3O1D A;  5DXB A;  3D90 A;  3T03 A;  3HLV A;  5KRA A;  2H79 A;  4PLE A;  3VT5 A;  2EWP A;  3SP9 A;  3F5C B;  2ZLC A;  4N73 A;  1I37 A;  2BJ4 B;  5DWI A;  5APH A;  1XLS E;  5C4U A;  3GWS X;  5DY8 A;  3UP0 A;  4G20 A;  4J24 A;  2HAR A;  5DV6 A;  5EC9 A;  1XV9 A;  3IMY A;  4MGD B;  2QR9 A;  4OJB A;  4DM8 A;  3IPS A;  2ZK3 A;  2QPY A;  1XLS A;  4OZR E;  3L1B A;  3B0Q A;  5L7H A;  3KMG A;  3R8I A;  1N83 A;  2J7X A;  2VV3 A;  5DXP A;  2YLO A;  2AWH A;  2ACL A;  4FHH A;  4P6X A;  2G5O A;  1KNU A;  3KMR A;  2QA8 B;  3VN2 A;  1ZUC A;  2P1U A;  1Z5X U;  2OUZ A;  5KCE A;  5CJ6 A;  4N8R A;  1XP1 A;  2YJA B;  2ZNO A;  4HLW A;  3R5N A;  3VT6 A;  3KMZ A;  3ADT A;  5DUE A;  2OVM A;  3QT0 A;  3F7D A;  5DXQ A;  3X36 A;  3D6D A;  5FQP A;  1ZDT A;  3ZR7 A;  2PIR A;  2P7G A;  1P93 A;  4YPQ A;  2QGT A;  5FQV A;  5B5B A;  5AAV A;  3DZY A;  1RKH A;  3OLS A;  3A40 X;  1SR7 A;  4RUP A;  2AYR A;  3PRG A;  2B23 A;  3WT6 A;  1U3R A;  2Q8S A;  4RZG A;  5KYJ A;  3FAL A;  4IVY A;  3PBA A;  2E2R A;  4G1Y A;  2QAB A;  4MG9 A;  4PP6 A;  1GWR A;  1MVC A;  3A9E B;  5APK A;  4IWC A;  1R20 A;  4LSJ A;  2HB8 A;  3W5P A;  1OVL A;  3OZJ A;  3B67 A;  1YA3 A;  1I38 A;  2Q7K A;  2P1T A;  5AK2 A;  4YNK A;  1NQ0 A;  1XP9 A;  4QM0 A;  5E0X A;  2NW4 A;  3HOD A;  2I0J A;  5KRK A;  2O4R A;  5KYA A;  4LTW A;  2HWR A;  4POH A;  5ICK A;  4IA2 A;  2JFA B;  3D24 A;  4PXM A;  1XDK B;  1YMT A;  4MDD A;  4E4Q A;  2ZKC A;  1T63 A;  4ZOM A;  4R2U A;  3R8D A;  2VST A;  1UHL B;  4TUZ B;  3VTC A;  2GPO A;  3DCU A;  1FM9 A;  5KRL A;  3W0A A;  5KCD A;  2H77 A;  2VV1 B;  3WT7 A;  4UDD A;  4M8E A;  1DKF A;  3ZQT A;  3TKM A;  5DUH A;  3VT3 A;  3KDU A;  2VV4 B;  5EI1 A;  5FQT A;  5L7E A;  1FBY A;  1T7F A;  3NOA A;  5GID A;  2PRG A;  3JZB A;  2AB2 A;  1RDT A;  2PIP L;  2GTK A;  2XKW A;  4J5X A;  3VRT A;  5KRO A;  4S0S A;  3X1I A;  3PEQ A;  4DOS A;  4IV2 A;  2VV2 A;  4MG7 A;  2Q5S A;  2FVJ A;  2HAM A;  2ZAS A;  3FEJ A;  4PP5 A;  1T76 A;  4OFU A;  3OOK A;  4RME A;  3S9S A;  1YY4 A;  2ZL9 A;  4XHD A;  3UVV B;  4J5W A;  1N46 A;  3AUQ A;  1G50 A;  2PIV A;  3OMQ A;  3OKI A;  4PVU A;  3AFR A;  2B1Z A;  4R6S A;  3ZRA A;  4YMQ A;  1R6G A;  3B1M A;  5FQS A;  4MGA A;  3DZU A;  2ZMH A;  3K23 A;  1MZN A;  1TXI A;  2AAX A;  2P15 A;  3O1E A;  2PKL A;  2P1V A;  4XLD A;  4XTA A;  5EGV A;  4MG5 A;  5L7G A;  2Q7L A;  3ERT A;  1E3K A;  4P6W A;  2AX9 A;  2AX6 A;  2PIW A;  4MGC A;  4IVW A;  4IWF A;  4S14 A;  2HVC A;  2OM9 A;  5DL4 A;  5DZH A;  3VT7 A;  4TV1 B;  5DX3 A;  1M7W A;  1I7I A;  2AXA A;  3CJW A;  2G44 A;  3TKC A;  1LV2 A;  2AM9 A;  2AA6 A;  2J4A A;  3KFC A;  4ZNW A;  5DZ1 A;  2I0G A;  3Q95 B;  3E00 D;  1A52 A;  2REW A;  1Q4X A;  2J14 A;  1XZX X;  1T7T A;  1VJB A;  3FC6 B;  5GT4 A;  4PPS A;  2GPP A;  4MG8 A;  1Y0X X;  3P89 A;  2PIQ A;  5SYZ A;  2P4Y A;  4X1F A;  4APU A;  5KD9 A;  3UUD B;  3AN3 A;  1XOW A;  5DWJ A;  2NXX A;  2ABI A;  3A2J A;  1PK5 A;  3X1H A;  1YIN A;  2Q1H A;  3V9T A;  5HJP B;  2AA2 A;  4WPF A;  4K6I A;  1S9P A;  4MG6 A;  5GIE A;  5IZ0 A;  5C4O A;  1QKU A;  2G0H A;  1T7R A;  3V3E A;  2AX7 A;  3ET1 A;  2QA6 A;  4CI5 A;  1G2N A;  3D57 A;  5DV3 A;  1P8D A;  1FCX A;  5A86 A;  1S0X A;  1OSH A;  4FNE A;  3OOF A;  4CSJ A;  3NSQ A;  2Q6R A;  5E19 A;  3OSA A;  5KCU A;  1U3S A;  3B5R A;  3H52 A;  5JJM B;  3OLF A;  3CLD A;  2Q3Y A;  1ZDU A;  4X1G A;  1T7M A;  1ZKY A;  4LBD A;  4G21 A;  2B50 A;  4S0T A;  3W5T A;  4E2J A;  3VTB A;  3L03 A;  2YHD A;  1K74 D;  3TX7 B;  5DTV A;  3ADU A;  3R2A A;  5KRM A;  2YFE A;  2PIO A;  4KZI A;  4OKW A;  5JI0 D;  4A4W A;  5EJV A;  4K4J A;  4OEA A;  3GN8 A;  4A2J A;  2W8Y A;  1FM6 A;  3VJH A;  4J26 A;  1QKM A;  3OMK A;  3DZY D;  4JAZ A;  3VSP A;  1XVP B;  4WHG A;  1NAX A;  3CS4 A;  4L96 A;  3UU7 A;  4ITE A;  3JZC A;  4OLM A;  2ZK4 A;  1SQN A;  4PP3 A;  3DT3 A;  5DIE A;  4ZJW A;  5DXB B;  4JYG A;  1X76 A;  2YJD A;  2QH6 A;  2ZNN A;  2ZXN A;  4OED A;  5DXG A;  4N1Y A;  1RKG A;  3GBK A;  3CDP A;  5HJS A;  3V3Q A;  4PRG A;  2ZMI A;  4OHA A;  1XV9 B;  3B0T A;  4PWL A;  4G2H A;  3WFG A;  5DKG A;  5B41 A;  1NQ2 A;  4ITF A;  3CDS A;  1S0Z A;  4PF3 A;  3L0J A;  3UUA A;  5HZC A;  1R5K A;  1ZGY A;  2AMA A;  2AO6 A;  3E7C A;  2ACL B;  3B68 A;  3G9E A;  3OS8 C;  2BAW A;  5DUG A;  1FCZ A;  2ZNP A;  3VJS A;  4ZNH A;  1FCY A;  1T79 A;  1NUO A;  1UPV A;  3AZ2 A;  1X7E A;  3GD2 A;  3KPZ A;  1XAP A;  5DYB A;  1YUC A;  4OC7 A;  2Z4J A;  1HJ1 A;  3CWD A;  1PCG A;  5DXE A;  3ET2 A;  3RLL A;  5DXR A;  2HC4 A;  2Q5P A;  3FEI A;  5KCF A;  4XUH A;  1XIU A;  2Q1V A;  4Y29 A;  3CTB A;  5E0W A;  3OSI A;  4NY9 A;  5AAV B;  2JJ3 A;  2J7Y A;  3AX8 A;  3E94 A;  4XT9 A;  5APJ A;  3VT9 A;  5KRF A;  3HZF A;  4WQP A;  5KRJ A;  3IPU A;  5KRI A;  3R8A A;  3FUG A;  4IA3 A;  5DVV A;  3FAL B;  4OIU A;  4G1Z A;  3VTD A;  2POG A;  3WJ4 A;  4JYH A;  3L0E A;  1R1K D;  3ET3 A;  1S19 A;  4MG9 B;  1X7B A;  2ZLA A;  2HAS A;  1PRG A;  3K8S A;  5K13 A;  1YP0 A;  2NV7 A;  3BEJ A;  2Q60 A;  1SKX A;  1YOK A;  1L2I A;  3OMM A;  1OVL B;  2FAI A;  3FUR A;  1XQC A;  3OGT A;  5G46 A;  4M8H A;  1GWX A;  1GS4 A;  3OAP A;  3GWX A;  4DOR A;  2Q6J A;  2XYX A;  4OJ4 A;  4QL8 A;  3X31 A;  1E3G A;  3HVL A;  3DZU D;  2QZO A;  2GIU A;  5DRJ A;  5DK9 A;  3VSO A;  3GZ9 A;  5DMC A;  2ZK2 A;  4IW8 A;  3OMO A;  5AZV A;  2V0V A;  3VRV A;  4R06 A;  3A2H A;  4FGY A;  5AWJ A;  3VT4 A;  4ZJR A;  3RVF A;  3ZRB A;  2ZBS A;  5C4S A;  3ADV A;  3W0Y A;  1KV6 A;  5KRH A;  5L11 A;  5ACC A;  3H0A A;  3VHU A;  1DKF B;  1NHZ A;  1QKT A;  3D5F A;  3L0L A;  3VI8 A;  4IW6 A;  4O8F A;  3IPQ A;  2QMV A;  5DXM A;  4DK7 A;  3KWY A;  3B66 A;  3WJ5 A;  4IS8 A;  4RMC A;  4OEZ A;  4RE8 A;  2PIN A;  5E14 A;  4QK4 A;  3WMH A;  4F9M A;  2QXS A;  3HC5 A;  4ZO1 X;  1DB1 A;  1NYX A;  4MGB A;  3W0H A;  1X78 A;  4IA7 A;  1Z95 A;  1PQ6 A;  2ZNQ A;  4MG7 B;  4DQM A;  2O4J A;  4RUO X;  2R40 A;  2AA5 A;  5DXK A;  4IU7 A;  3PCU A;  1NQ7 A;  2NXX E;  1HG4 A;  1M13 A;  5HCV A;  2Q59 A;  2P7A A;  3AN4 A;  2HCD A;  4S15 A;  2Z4B A;  2AX8 A;  3CQV A;  1ERE A;  1IE8 A;  3CS8 A;  4MGA B;  3WWR A;  4HEE X;  1U9E A;  3CS6 A;  4REF A;  4ZNT A;  3M7R A;  3F5C A;  2BJ4 A;  3K6P A;  4OKX A;  4WLB A;  3B65 A;  1LBD A;  2GL8 A;  3G8O A;  3GYU A;  2VV0 A;  3IXP A;  4MGD A;  4NIE A;  1XPC A;  4RFW A;  5DX3 B;  5F9B A;  2F4B A;  2OCF A;  2PNU A;  2P7Z A;  3OZ0 A;  1ERR A;  4RWV A;  5DYD A;  3TY0 A;  3FXV A;  3A2I A;  4A4V A;  4YT1 A;  3BC5 A;  4ZNV A;  4OH5 A;  5C4T A;  4J5X C;  5KR9 A;  2ZK1 A;  3OLL A;  4LNX A;  3LMP A;  3P0U A;  2QA8 A;  4B7W A;  3EYB A;  3AUN A;  1T74 A;  3HO0 A;  3L3X A;  4G2I A;  5G44 A;  1EXX A;  5DWE A;  4QE8 A;  1GWQ A;  3SZ1 A;  4ZO1 B;  3ET0 A;  3IXP D;  3MNE A;  3W0G A;  3OMP A;  4CI4 A;  4MG8 B;  2VSR A;  4Q13 A;  1FM6 D;  2IOG A;  4IQR A;  3P88 A;  5EHJ A;  1NRL A;  1WM0 X;  3DR1 A;  4J5W C;  5DKS A;  4XI3 A;  5AVL A;  4JYI A;  4Q50 A;  5IAW A;  2OVH A;  2QW4 A;  2I4J A;  2NPA A;  4XAO A;  5DU5 A;  2P54 A;  3BQD A;  3AZ1 A;  3WTQ A;  4NUF A;  3RY9 A;  4OAR A;  2AA7 A;  4ZNU A;  2Q6S A;  4QJR A;  5E7V A;  1G1U A;  3NSP A;  3VJI A;  2ZK0 A;  5DVS A;  2GPV A;  4RZF A;  3K22 A;  1K7L A;  3RUU A;  4QE6 A;  1YIM A;  2IOK A;  2HBH A;  1NQ1 A;  3MNP A;  3VHV A;  5IXK A;  3G0W A;  1XNN A;  3RLJ A;  3ADS A;  3V49 A;  2ZY0 A;  3W5Q A;  5KCT A;  3A9E A;  4UDC A;  4FHI A;  1R20 D;  5AZT A;  3WGP A;  1N4H A;  5ETH A;  2QNV A;  3RUT A;  1ZAF A;  3LBD A;  3G8I A;  3R5M A;  1K74 A;  2PIU A;  2QSE A;  1PDU A;  5DKE A;  2JF9 A;  1PZL A;  5DZ3 A;  5AYG A;  5GIC A;  4NQA B;  1SJ0 A;  3R29 A;  1NAV A;  4ZN7 A;  2Q61 A;  2YLY A;  1YYE A;  1RK3 A;  2ZXZ A;  4PLD A;  2ATH A;  2YLP A;  3B0R A;  4OFR A;  2V7C A;  5E15 A;  2JFA A;  3P8X A;  3VRU A;  3W0I A;  4EMA A;  1I7G A;  1XDK A;  3A3Z X;  4ONI A;  3UU7 B;  5H1E A;  2O9I A;  2YAT A;  2Q7I A;  1UHL A;  4TUZ A;  1S9Q A;  1FM9 D;  2XYJ A;  3WT5 A;  5LWP A;  3U9Q A;  1UPW A;  2PJL A;  3VHW A;  3FS1 A;  2VV1 A;  2GPU A;  2R6Y A;  4E4K A;  5JY3 A;  3V4A A;  1M2Z A;  2QTU A;  4OEY A;  3DY6 A;  5DWG A;  5I4V A;  2Q70 A;  2VV4 A;  2ZVT A;  4RMD A;  1XNX A;  4OKT A;  5AAU A;  4DMA A;  5DZ0 A;  4RZE A;  1RDT D;  1Z5X E;  1UOM A;  2OZ7 A;  4JL4 A;  3V9V A;  3UUA B;  5HYR A;  4IV4 A;  2GWX A;  4UDB A;  3GYT A;  1T73 A;  3N00 A;  2ZFX A;  4KZM A;  2XYW A;  3UUC A;  5G43 A;  2XHS A;  4RUJ A;  2I4Z A;  4OZT U;  2QXM A;  5G45 A;  3VRW A;  4POJ A;  4JGV A;  4OGH A;  3AUR A;  1ZH7 A;  4UDA A;  5DKB A;  5LGA A;  2ZK6 A;  2G0G A;  3HM1 A;  5DWL A;  2IHQ A;  1FD0 A;  2QE4 A;  3HC6 A;  3PLZ A;  4OIV A;  1XQ3 A;  4KZJ A;  3UVV A;  1L2J A;  2I4P A;  2ZK5 A;  5DSH A;  5G3J A;  5EIT A;  3OS9 A;  4ZN9 A;  5M96 A;  5DV8 A;  3OSW A;  1XB7 A;  1Y9R A;  2LBD A;  5KCC A;  4Q0A C;  3IA6 A;  4IA1 A;  4RAK A;  3MNO A;  5KRC A;  4XUM A;  5HYK A;  2HFP A;  3ERD A;  2PIX A;  3H0A D;  3UP3 A;  3SP6 A;  1BSX A;  4TV1 A;  2QGW A;  1ILG A;  1KKQ A;  4DK8 A;  2A3I A;  4IUI A;  1QKN A;  4N5G A;  5E1C A;  2ZMJ A;  3KBA A;  2OAX A;  1RJK A;  3Q95 A;  2PIT A;  2B1V A;  1R1K A;  1TFC A;  2AMB A;  4ZI1 A;  1X7J A;  3A78 A;  1X7R A;  3FC6 A;  4OZT E;  2ZXM A;  2R40 D;  5G42 A;  4PPP A;  4OJ9 A;  3V9Y A;  3VJT A;  3OKH A;  3W0C A;  5DP0 A;  1OT7 A;  3L3Z A;  5AWK A;  3WFF A;  1YOW A;  3UUD A;  1T5Z A;  5G5W A;  4G1D A;  4L98 A;  4EM9 A;  2QZO B;  3FLI A;  3DCT A;  3ILZ A;  3B3K A;  5HJP A;  1ILH A;  5DRM A;  5AVI A;  1EXA A;  1K4W A;  3B0W A;  3HQ5 A;  4OIL A;  5DVC A;  2HWQ A;  1OSV A;  1PQC A;  4DM6 A; 
#chains in the Genus database with same CATH topology
 4WHF A;  2YLQ A;  1H9U A;  4LNW A;  1T65 A;  1A28 A;  3ADX A;  5JJM A;  4ZNS A;  5DZI A;  4OZR U;  3AZ3 A;  3W0J A;  4FN9 A;  1G5Y A;  1XJ7 A;  1XP6 A;  5DLR A;  2R6W A;  3OS8 A;  2Q5G A;  1ZEO A;  3W5R A;  3E00 A;  4WVD A;  2FSZ A;  1IE9 A;  4MGB B;  1PQ9 A;  5DIG A;  4BCR A;  1YJE A;  1U3Q A;  3KYT A;  3PO9 A;  4NB6 A;  3KDT A;  2Q7J A;  4K7A A;  4OKB A;  3VT8 A;  2POB A;  1NDE A;  5FQR A;  2GP7 A;  5DMF A;  2Q59 B;  4OK1 A;  1XVP A;  4REE A;  5DID A;  5DI7 A;  5KCW A;  1MV9 A;  1Y0S A;  3ADW A;  4OH6 A;  2HB7 A;  3O1D A;  5DXB A;  3D90 A;  3T03 A;  3HLV A;  5KRA A;  2H79 A;  4PLE A;  3VT5 A;  2EWP A;  3SP9 A;  3F5C B;  2ZLC A;  4N73 A;  1I37 A;  2BJ4 B;  5DWI A;  5APH A;  1XLS E;  5C4U A;  3GWS X;  5DY8 A;  3UP0 A;  4G20 A;  4J24 A;  2HAR A;  5DV6 A;  5EC9 A;  1XV9 A;  3IMY A;  4MGD B;  2QR9 A;  4OJB A;  4DM8 A;  3IPS A;  2ZK3 A;  2QPY A;  1XLS A;  4OZR E;  3L1B A;  3B0Q A;  5L7H A;  3KMG A;  3R8I A;  1N83 A;  2J7X A;  2VV3 A;  5DXP A;  2YLO A;  2AWH A;  2ACL A;  4FHH A;  4P6X A;  2G5O A;  1KNU A;  3KMR A;  2QA8 B;  3VN2 A;  1ZUC A;  2P1U A;  1Z5X U;  2OUZ A;  5KCE A;  5CJ6 A;  4N8R A;  1XP1 A;  2YJA B;  2ZNO A;  4HLW A;  3R5N A;  3VT6 A;  3KMZ A;  3ADT A;  5DUE A;  2OVM A;  3QT0 A;  3F7D A;  5DXQ A;  3X36 A;  3D6D A;  5FQP A;  1ZDT A;  3ZR7 A;  2PIR A;  2P7G A;  1P93 A;  4YPQ A;  2QGT A;  5FQV A;  5B5B A;  5AAV A;  3DZY A;  1RKH A;  3OLS A;  3A40 X;  1SR7 A;  4RUP A;  2AYR A;  3PRG A;  2B23 A;  3WT6 A;  1U3R A;  2Q8S A;  4RZG A;  5KYJ A;  3FAL A;  4IVY A;  3PBA A;  2E2R A;  4G1Y A;  2QAB A;  4MG9 A;  4PP6 A;  1GWR A;  1MVC A;  3A9E B;  5APK A;  4IWC A;  1R20 A;  4LSJ A;  2HB8 A;  3W5P A;  1OVL A;  3OZJ A;  3B67 A;  1YA3 A;  1I38 A;  2Q7K A;  2P1T A;  5AK2 A;  4YNK A;  1NQ0 A;  1XP9 A;  4QM0 A;  5E0X A;  2NW4 A;  3HOD A;  2I0J A;  5KRK A;  2O4R A;  5KYA A;  4LTW A;  2HWR A;  4POH A;  5ICK A;  4IA2 A;  2JFA B;  3D24 A;  4PXM A;  1XDK B;  1YMT A;  4MDD A;  4E4Q A;  2ZKC A;  1T63 A;  4ZOM A;  4R2U A;  3R8D A;  2VST A;  1UHL B;  4TUZ B;  3VTC A;  2GPO A;  3DCU A;  1FM9 A;  5KRL A;  3W0A A;  5KCD A;  2H77 A;  2VV1 B;  3WT7 A;  4UDD A;  4M8E A;  1DKF A;  3ZQT A;  3TKM A;  5DUH A;  3VT3 A;  3KDU A;  2VV4 B;  5EI1 A;  5FQT A;  5L7E A;  1FBY A;  1T7F A;  3NOA A;  5GID A;  2PRG A;  3JZB A;  2AB2 A;  1RDT A;  2PIP L;  2GTK A;  2XKW A;  4J5X A;  3VRT A;  5KRO A;  4S0S A;  3X1I A;  3PEQ A;  4DOS A;  4IV2 A;  2VV2 A;  4MG7 A;  2Q5S A;  2FVJ A;  2HAM A;  2ZAS A;  3FEJ A;  4PP5 A;  1T76 A;  4OFU A;  3OOK A;  4RME A;  3S9S A;  1YY4 A;  2ZL9 A;  4XHD A;  3UVV B;  4J5W A;  1N46 A;  3AUQ A;  1G50 A;  2PIV A;  3OMQ A;  3OKI A;  4PVU A;  3AFR A;  2B1Z A;  4R6S A;  3ZRA A;  4YMQ A;  1R6G A;  3B1M A;  5FQS A;  4MGA A;  3DZU A;  2ZMH A;  3K23 A;  1MZN A;  1TXI A;  2AAX A;  2P15 A;  3O1E A;  2PKL A;  2P1V A;  4XLD A;  4XTA A;  5EGV A;  4MG5 A;  5L7G A;  2Q7L A;  3ERT A;  1E3K A;  4P6W A;  2AX9 A;  2AX6 A;  2PIW A;  4MGC A;  4IVW A;  4IWF A;  4S14 A;  2HVC A;  2OM9 A;  5DL4 A;  5DZH A;  3VT7 A;  4TV1 B;  5DX3 A;  1M7W A;  1I7I A;  2AXA A;  3CJW A;  2G44 A;  3TKC A;  1LV2 A;  2AM9 A;  2AA6 A;  2J4A A;  3KFC A;  4ZNW A;  5DZ1 A;  2I0G A;  3Q95 B;  3E00 D;  1A52 A;  2REW A;  1Q4X A;  2J14 A;  1XZX X;  1T7T A;  1VJB A;  3FC6 B;  5GT4 A;  4PPS A;  2GPP A;  4MG8 A;  1Y0X X;  3P89 A;  2PIQ A;  5SYZ A;  2P4Y A;  4X1F A;  4APU A;  5KD9 A;  3UUD B;  3AN3 A;  1XOW A;  5DWJ A;  2NXX A;  2ABI A;  3A2J A;  1PK5 A;  3X1H A;  1YIN A;  2Q1H A;  3V9T A;  5HJP B;  2AA2 A;  4WPF A;  4K6I A;  1S9P A;  4MG6 A;  5GIE A;  5IZ0 A;  5C4O A;  1QKU A;  2G0H A;  1T7R A;  3V3E A;  2AX7 A;  3ET1 A;  2QA6 A;  4CI5 A;  1G2N A;  3D57 A;  5DV3 A;  1P8D A;  1FCX A;  5A86 A;  1S0X A;  1OSH A;  4FNE A;  3OOF A;  4CSJ A;  3NSQ A;  2Q6R A;  5E19 A;  3OSA A;  5KCU A;  1U3S A;  3B5R A;  3H52 A;  5JJM B;  3OLF A;  3CLD A;  2Q3Y A;  1ZDU A;  4X1G A;  1T7M A;  1ZKY A;  4LBD A;  4G21 A;  2B50 A;  4S0T A;  3W5T A;  4E2J A;  3VTB A;  3L03 A;  2YHD A;  1K74 D;  3TX7 B;  5DTV A;  3ADU A;  3R2A A;  5KRM A;  2YFE A;  2PIO A;  4KZI A;  4OKW A;  5JI0 D;  4A4W A;  5EJV A;  4K4J A;  4OEA A;  3GN8 A;  4A2J A;  2W8Y A;  1FM6 A;  3VJH A;  4J26 A;  1QKM A;  3OMK A;  3DZY D;  4JAZ A;  3VSP A;  1XVP B;  4WHG A;  1NAX A;  3CS4 A;  4L96 A;  3UU7 A;  4ITE A;  3JZC A;  4OLM A;  2ZK4 A;  1SQN A;  4PP3 A;  3DT3 A;  5DIE A;  4ZJW A;  5DXB B;  4JYG A;  1X76 A;  2YJD A;  2QH6 A;  2ZNN A;  2ZXN A;  4OED A;  5DXG A;  4N1Y A;  1RKG A;  3GBK A;  3CDP A;  5HJS A;  3V3Q A;  4PRG A;  2ZMI A;  4OHA A;  1XV9 B;  3B0T A;  4PWL A;  4G2H A;  3WFG A;  5DKG A;  5B41 A;  1NQ2 A;  4ITF A;  3CDS A;  1S0Z A;  4PF3 A;  3L0J A;  3UUA A;  5HZC A;  1R5K A;  1ZGY A;  2AMA A;  2AO6 A;  3E7C A;  2ACL B;  3B68 A;  3G9E A;  3OS8 C;  2BAW A;  5DUG A;  1FCZ A;  2ZNP A;  3VJS A;  4ZNH A;  1FCY A;  1T79 A;  1NUO A;  1UPV A;  3AZ2 A;  1X7E A;  3GD2 A;  3KPZ A;  1XAP A;  5DYB A;  1YUC A;  4OC7 A;  2Z4J A;  1HJ1 A;  3CWD A;  1PCG A;  5DXE A;  3ET2 A;  3RLL A;  5DXR A;  2HC4 A;  2Q5P A;  3FEI A;  5KCF A;  4XUH A;  1XIU A;  2Q1V A;  4Y29 A;  3CTB A;  5E0W A;  3OSI A;  4NY9 A;  5AAV B;  2JJ3 A;  2J7Y A;  3AX8 A;  3E94 A;  4XT9 A;  5APJ A;  3VT9 A;  5KRF A;  3HZF A;  4WQP A;  5KRJ A;  3IPU A;  5KRI A;  3R8A A;  3FUG A;  4IA3 A;  5DVV A;  3FAL B;  4OIU A;  4G1Z A;  3VTD A;  2POG A;  3WJ4 A;  4JYH A;  3L0E A;  1R1K D;  3ET3 A;  1S19 A;  4MG9 B;  1X7B A;  2ZLA A;  2HAS A;  1PRG A;  3K8S A;  5K13 A;  1YP0 A;  2NV7 A;  3BEJ A;  2Q60 A;  1SKX A;  1YOK A;  1L2I A;  3OMM A;  1OVL B;  2FAI A;  3FUR A;  1XQC A;  3OGT A;  5G46 A;  4M8H A;  1GWX A;  1GS4 A;  3OAP A;  3GWX A;  4DOR A;  2Q6J A;  2XYX A;  4OJ4 A;  4QL8 A;  3X31 A;  1E3G A;  3HVL A;  3DZU D;  2QZO A;  2GIU A;  5DRJ A;  5DK9 A;  3VSO A;  3GZ9 A;  5DMC A;  2ZK2 A;  4IW8 A;  3OMO A;  5AZV A;  2V0V A;  3VRV A;  4R06 A;  3A2H A;  4FGY A;  5AWJ A;  3VT4 A;  4ZJR A;  3RVF A;  3ZRB A;  2ZBS A;  5C4S A;  3ADV A;  3W0Y A;  1KV6 A;  5KRH A;  5L11 A;  5ACC A;  3H0A A;  3VHU A;  1DKF B;  1NHZ A;  1QKT A;  3D5F A;  3L0L A;  3VI8 A;  4IW6 A;  4O8F A;  3IPQ A;  2QMV A;  5DXM A;  4DK7 A;  3KWY A;  3B66 A;  3WJ5 A;  4IS8 A;  4RMC A;  4OEZ A;  4RE8 A;  2PIN A;  5E14 A;  4QK4 A;  3WMH A;  4F9M A;  2QXS A;  3HC5 A;  4ZO1 X;  1DB1 A;  1NYX A;  4MGB A;  3W0H A;  1X78 A;  4IA7 A;  1Z95 A;  1PQ6 A;  2ZNQ A;  4MG7 B;  4DQM A;  2O4J A;  4RUO X;  2R40 A;  2AA5 A;  5DXK A;  4IU7 A;  3PCU A;  1NQ7 A;  2NXX E;  1HG4 A;  1M13 A;  5HCV A;  2Q59 A;  2P7A A;  3AN4 A;  2HCD A;  4S15 A;  2Z4B A;  2AX8 A;  3CQV A;  1ERE A;  1IE8 A;  3CS8 A;  4MGA B;  3WWR A;  4HEE X;  1U9E A;  3CS6 A;  4REF A;  4ZNT A;  3M7R A;  3F5C A;  2BJ4 A;  3K6P A;  4OKX A;  4WLB A;  3B65 A;  1LBD A;  2GL8 A;  3G8O A;  3GYU A;  2VV0 A;  3IXP A;  4MGD A;  4NIE A;  1XPC A;  4RFW A;  5DX3 B;  5F9B A;  2F4B A;  2OCF A;  2PNU A;  2P7Z A;  3OZ0 A;  1ERR A;  4RWV A;  5DYD A;  3TY0 A;  3FXV A;  3A2I A;  4A4V A;  4YT1 A;  3BC5 A;  4ZNV A;  4OH5 A;  5C4T A;  4J5X C;  5KR9 A;  2ZK1 A;  3OLL A;  4LNX A;  3LMP A;  3P0U A;  2QA8 A;  4B7W A;  3EYB A;  3AUN A;  1T74 A;  3HO0 A;  3L3X A;  4G2I A;  5G44 A;  1EXX A;  5DWE A;  4QE8 A;  1GWQ A;  3SZ1 A;  4ZO1 B;  3ET0 A;  3IXP D;  3MNE A;  3W0G A;  3OMP A;  4CI4 A;  4MG8 B;  2VSR A;  4Q13 A;  1FM6 D;  2IOG A;  4IQR A;  3P88 A;  5EHJ A;  1NRL A;  1WM0 X;  3DR1 A;  4J5W C;  5DKS A;  4XI3 A;  5AVL A;  4JYI A;  4Q50 A;  5IAW A;  2OVH A;  2QW4 A;  2I4J A;  2NPA A;  4XAO A;  5DU5 A;  2P54 A;  3BQD A;  3AZ1 A;  3WTQ A;  4NUF A;  3RY9 A;  4OAR A;  2AA7 A;  4ZNU A;  2Q6S A;  4QJR A;  5E7V A;  1G1U A;  3NSP A;  3VJI A;  2ZK0 A;  5DVS A;  2GPV A;  4RZF A;  3K22 A;  1K7L A;  3RUU A;  4QE6 A;  1YIM A;  2IOK A;  2HBH A;  1NQ1 A;  3MNP A;  3VHV A;  5IXK A;  3G0W A;  1XNN A;  3RLJ A;  3ADS A;  3V49 A;  2ZY0 A;  3W5Q A;  5KCT A;  3A9E A;  4UDC A;  4FHI A;  1R20 D;  5AZT A;  3WGP A;  1N4H A;  5ETH A;  2QNV A;  3RUT A;  1ZAF A;  3LBD A;  3G8I A;  3R5M A;  1K74 A;  2PIU A;  2QSE A;  1PDU A;  5DKE A;  2JF9 A;  1PZL A;  5DZ3 A;  5AYG A;  5GIC A;  4NQA B;  1SJ0 A;  3R29 A;  1NAV A;  4ZN7 A;  2Q61 A;  2YLY A;  1YYE A;  1RK3 A;  2ZXZ A;  4PLD A;  2ATH A;  2YLP A;  3B0R A;  4OFR A;  2V7C A;  5E15 A;  2JFA A;  3P8X A;  3VRU A;  3W0I A;  4EMA A;  1I7G A;  1XDK A;  3A3Z X;  4ONI A;  3UU7 B;  5H1E A;  2O9I A;  2YAT A;  2Q7I A;  1UHL A;  4TUZ A;  1S9Q A;  1FM9 D;  2XYJ A;  3WT5 A;  5LWP A;  3U9Q A;  1UPW A;  2PJL A;  3VHW A;  3FS1 A;  2VV1 A;  2GPU A;  2R6Y A;  4E4K A;  5JY3 A;  3V4A A;  1M2Z A;  2QTU A;  4OEY A;  3DY6 A;  5DWG A;  5I4V A;  2Q70 A;  2VV4 A;  2ZVT A;  4RMD A;  1XNX A;  4OKT A;  5AAU A;  4DMA A;  5DZ0 A;  4RZE A;  1RDT D;  1Z5X E;  1UOM A;  2OZ7 A;  4JL4 A;  3V9V A;  3UUA B;  5HYR A;  4IV4 A;  2GWX A;  4UDB A;  3GYT A;  1T73 A;  3N00 A;  2ZFX A;  4KZM A;  2XYW A;  3UUC A;  5G43 A;  2XHS A;  4RUJ A;  2I4Z A;  4OZT U;  2QXM A;  5G45 A;  3VRW A;  4POJ A;  4JGV A;  4OGH A;  3AUR A;  1ZH7 A;  4UDA A;  5DKB A;  5LGA A;  2ZK6 A;  2G0G A;  3HM1 A;  5DWL A;  2IHQ A;  1FD0 A;  2QE4 A;  3HC6 A;  3PLZ A;  4OIV A;  1XQ3 A;  4KZJ A;  3UVV A;  1L2J A;  2I4P A;  2ZK5 A;  5DSH A;  5G3J A;  5EIT A;  3OS9 A;  4ZN9 A;  5M96 A;  5DV8 A;  3OSW A;  1XB7 A;  1Y9R A;  2LBD A;  5KCC A;  4Q0A C;  3IA6 A;  4IA1 A;  4RAK A;  3MNO A;  5KRC A;  4XUM A;  5HYK A;  2HFP A;  3ERD A;  2PIX A;  3H0A D;  3UP3 A;  3SP6 A;  1BSX A;  4TV1 A;  2QGW A;  1ILG A;  1KKQ A;  4DK8 A;  2A3I A;  4IUI A;  1QKN A;  4N5G A;  5E1C A;  2ZMJ A;  3KBA A;  2OAX A;  1RJK A;  3Q95 A;  2PIT A;  2B1V A;  1R1K A;  1TFC A;  2AMB A;  4ZI1 A;  1X7J A;  3A78 A;  1X7R A;  3FC6 A;  4OZT E;  2ZXM A;  2R40 D;  5G42 A;  4PPP A;  4OJ9 A;  3V9Y A;  3VJT A;  3OKH A;  3W0C A;  5DP0 A;  1OT7 A;  3L3Z A;  5AWK A;  3WFF A;  1YOW A;  3UUD A;  1T5Z A;  5G5W A;  4G1D A;  4L98 A;  4EM9 A;  2QZO B;  3FLI A;  3DCT A;  3ILZ A;  3B3K A;  5HJP A;  1ILH A;  5DRM A;  5AVI A;  1EXA A;  1K4W A;  3B0W A;  3HQ5 A;  4OIL A;  5DVC A;  2HWQ A;  1OSV A;  1PQC A;  4DM6 A; 
#chains in the Genus database with same CATH homology
 4WHF A;  2YLQ A;  1H9U A;  4LNW A;  1T65 A;  1A28 A;  3ADX A;  5JJM A;  4ZNS A;  5DZI A;  4OZR U;  3AZ3 A;  3W0J A;  4FN9 A;  1G5Y A;  1XJ7 A;  1XP6 A;  5DLR A;  2R6W A;  3OS8 A;  2Q5G A;  1ZEO A;  3W5R A;  3E00 A;  4WVD A;  2FSZ A;  1IE9 A;  4MGB B;  1PQ9 A;  5DIG A;  4BCR A;  1YJE A;  1U3Q A;  3KYT A;  3PO9 A;  4NB6 A;  3KDT A;  2Q7J A;  4K7A A;  4OKB A;  3VT8 A;  2POB A;  1NDE A;  5FQR A;  2GP7 A;  5DMF A;  2Q59 B;  4OK1 A;  1XVP A;  4REE A;  5DID A;  5DI7 A;  5KCW A;  1MV9 A;  1Y0S A;  3ADW A;  4OH6 A;  2HB7 A;  3O1D A;  5DXB A;  3D90 A;  3T03 A;  3HLV A;  5KRA A;  2H79 A;  4PLE A;  3VT5 A;  2EWP A;  3SP9 A;  3F5C B;  2ZLC A;  4N73 A;  1I37 A;  2BJ4 B;  5DWI A;  5APH A;  1XLS E;  5C4U A;  3GWS X;  5DY8 A;  3UP0 A;  4G20 A;  4J24 A;  2HAR A;  5DV6 A;  5EC9 A;  1XV9 A;  3IMY A;  4MGD B;  2QR9 A;  4OJB A;  4DM8 A;  3IPS A;  2ZK3 A;  2QPY A;  1XLS A;  4OZR E;  3L1B A;  3B0Q A;  5L7H A;  3KMG A;  3R8I A;  1N83 A;  2J7X A;  2VV3 A;  5DXP A;  2YLO A;  2AWH A;  2ACL A;  4FHH A;  4P6X A;  2G5O A;  1KNU A;  3KMR A;  2QA8 B;  3VN2 A;  1ZUC A;  2P1U A;  1Z5X U;  2OUZ A;  5KCE A;  5CJ6 A;  4N8R A;  1XP1 A;  2YJA B;  2ZNO A;  4HLW A;  3R5N A;  3VT6 A;  3KMZ A;  3ADT A;  5DUE A;  2OVM A;  3QT0 A;  3F7D A;  5DXQ A;  3X36 A;  3D6D A;  5FQP A;  1ZDT A;  3ZR7 A;  2PIR A;  2P7G A;  1P93 A;  4YPQ A;  2QGT A;  5FQV A;  5B5B A;  5AAV A;  3DZY A;  1RKH A;  3OLS A;  3A40 X;  1SR7 A;  4RUP A;  2AYR A;  3PRG A;  2B23 A;  3WT6 A;  1U3R A;  2Q8S A;  4RZG A;  5KYJ A;  3FAL A;  4IVY A;  3PBA A;  2E2R A;  4G1Y A;  2QAB A;  4MG9 A;  4PP6 A;  1GWR A;  1MVC A;  3A9E B;  5APK A;  4IWC A;  1R20 A;  4LSJ A;  2HB8 A;  3W5P A;  1OVL A;  3OZJ A;  3B67 A;  1YA3 A;  1I38 A;  2Q7K A;  2P1T A;  5AK2 A;  4YNK A;  1NQ0 A;  1XP9 A;  4QM0 A;  5E0X A;  2NW4 A;  3HOD A;  2I0J A;  5KRK A;  2O4R A;  5KYA A;  4LTW A;  2HWR A;  4POH A;  5ICK A;  4IA2 A;  2JFA B;  3D24 A;  4PXM A;  1XDK B;  1YMT A;  4MDD A;  4E4Q A;  2ZKC A;  1T63 A;  4ZOM A;  4R2U A;  3R8D A;  2VST A;  1UHL B;  4TUZ B;  3VTC A;  2GPO A;  3DCU A;  1FM9 A;  5KRL A;  3W0A A;  5KCD A;  2H77 A;  2VV1 B;  3WT7 A;  4UDD A;  4M8E A;  1DKF A;  3ZQT A;  3TKM A;  5DUH A;  3VT3 A;  3KDU A;  2VV4 B;  5EI1 A;  5FQT A;  5L7E A;  1FBY A;  1T7F A;  3NOA A;  5GID A;  2PRG A;  3JZB A;  2AB2 A;  1RDT A;  2PIP L;  2GTK A;  2XKW A;  4J5X A;  3VRT A;  5KRO A;  4S0S A;  3X1I A;  3PEQ A;  4DOS A;  4IV2 A;  2VV2 A;  4MG7 A;  2Q5S A;  2FVJ A;  2HAM A;  2ZAS A;  3FEJ A;  4PP5 A;  1T76 A;  4OFU A;  3OOK A;  4RME A;  3S9S A;  1YY4 A;  2ZL9 A;  4XHD A;  3UVV B;  4J5W A;  1N46 A;  3AUQ A;  1G50 A;  2PIV A;  3OMQ A;  3OKI A;  4PVU A;  3AFR A;  2B1Z A;  4R6S A;  3ZRA A;  4YMQ A;  1R6G A;  3B1M A;  5FQS A;  4MGA A;  3DZU A;  2ZMH A;  3K23 A;  1MZN A;  1TXI A;  2AAX A;  2P15 A;  3O1E A;  2PKL A;  2P1V A;  4XLD A;  4XTA A;  5EGV A;  4MG5 A;  5L7G A;  2Q7L A;  3ERT A;  1E3K A;  4P6W A;  2AX9 A;  2AX6 A;  2PIW A;  4MGC A;  4IVW A;  4IWF A;  4S14 A;  2HVC A;  2OM9 A;  5DL4 A;  5DZH A;  3VT7 A;  4TV1 B;  5DX3 A;  1M7W A;  1I7I A;  2AXA A;  3CJW A;  2G44 A;  3TKC A;  1LV2 A;  2AM9 A;  2AA6 A;  2J4A A;  3KFC A;  4ZNW A;  5DZ1 A;  2I0G A;  3Q95 B;  3E00 D;  1A52 A;  2REW A;  1Q4X A;  2J14 A;  1XZX X;  1T7T A;  1VJB A;  3FC6 B;  5GT4 A;  4PPS A;  2GPP A;  4MG8 A;  1Y0X X;  3P89 A;  2PIQ A;  5SYZ A;  2P4Y A;  4X1F A;  4APU A;  5KD9 A;  3UUD B;  3AN3 A;  1XOW A;  5DWJ A;  2NXX A;  2ABI A;  3A2J A;  1PK5 A;  3X1H A;  1YIN A;  2Q1H A;  3V9T A;  5HJP B;  2AA2 A;  4WPF A;  4K6I A;  1S9P A;  4MG6 A;  5GIE A;  5IZ0 A;  5C4O A;  1QKU A;  2G0H A;  1T7R A;  3V3E A;  2AX7 A;  3ET1 A;  2QA6 A;  4CI5 A;  1G2N A;  3D57 A;  5DV3 A;  1P8D A;  1FCX A;  5A86 A;  1S0X A;  1OSH A;  4FNE A;  3OOF A;  4CSJ A;  3NSQ A;  2Q6R A;  5E19 A;  3OSA A;  5KCU A;  1U3S A;  3B5R A;  3H52 A;  5JJM B;  3OLF A;  3CLD A;  2Q3Y A;  1ZDU A;  4X1G A;  1T7M A;  1ZKY A;  4LBD A;  4G21 A;  2B50 A;  4S0T A;  3W5T A;  4E2J A;  3VTB A;  3L03 A;  2YHD A;  1K74 D;  3TX7 B;  5DTV A;  3ADU A;  3R2A A;  5KRM A;  2YFE A;  2PIO A;  4KZI A;  4OKW A;  5JI0 D;  4A4W A;  5EJV A;  4K4J A;  4OEA A;  3GN8 A;  4A2J A;  2W8Y A;  1FM6 A;  3VJH A;  4J26 A;  1QKM A;  3OMK A;  3DZY D;  4JAZ A;  3VSP A;  1XVP B;  4WHG A;  1NAX A;  3CS4 A;  4L96 A;  3UU7 A;  4ITE A;  3JZC A;  4OLM A;  2ZK4 A;  1SQN A;  4PP3 A;  3DT3 A;  5DIE A;  4ZJW A;  5DXB B;  4JYG A;  1X76 A;  2YJD A;  2QH6 A;  2ZNN A;  2ZXN A;  4OED A;  5DXG A;  4N1Y A;  1RKG A;  3GBK A;  3CDP A;  5HJS A;  3V3Q A;  4PRG A;  2ZMI A;  4OHA A;  1XV9 B;  3B0T A;  4PWL A;  4G2H A;  3WFG A;  5DKG A;  5B41 A;  1NQ2 A;  4ITF A;  3CDS A;  1S0Z A;  4PF3 A;  3L0J A;  3UUA A;  5HZC A;  1R5K A;  1ZGY A;  2AMA A;  2AO6 A;  3E7C A;  2ACL B;  3B68 A;  3G9E A;  3OS8 C;  2BAW A;  5DUG A;  1FCZ A;  2ZNP A;  3VJS A;  4ZNH A;  1FCY A;  1T79 A;  1NUO A;  1UPV A;  3AZ2 A;  1X7E A;  3GD2 A;  3KPZ A;  1XAP A;  5DYB A;  1YUC A;  4OC7 A;  2Z4J A;  1HJ1 A;  3CWD A;  1PCG A;  5DXE A;  3ET2 A;  3RLL A;  5DXR A;  2HC4 A;  2Q5P A;  3FEI A;  5KCF A;  4XUH A;  1XIU A;  2Q1V A;  4Y29 A;  3CTB A;  5E0W A;  3OSI A;  4NY9 A;  5AAV B;  2JJ3 A;  2J7Y A;  3AX8 A;  3E94 A;  4XT9 A;  5APJ A;  3VT9 A;  5KRF A;  3HZF A;  4WQP A;  5KRJ A;  3IPU A;  5KRI A;  3R8A A;  3FUG A;  4IA3 A;  5DVV A;  3FAL B;  4OIU A;  4G1Z A;  3VTD A;  2POG A;  3WJ4 A;  4JYH A;  3L0E A;  1R1K D;  3ET3 A;  1S19 A;  4MG9 B;  1X7B A;  2ZLA A;  2HAS A;  1PRG A;  3K8S A;  5K13 A;  1YP0 A;  2NV7 A;  3BEJ A;  2Q60 A;  1SKX A;  1YOK A;  1L2I A;  3OMM A;  1OVL B;  2FAI A;  3FUR A;  1XQC A;  3OGT A;  5G46 A;  4M8H A;  1GWX A;  1GS4 A;  3OAP A;  3GWX A;  4DOR A;  2Q6J A;  2XYX A;  4OJ4 A;  4QL8 A;  3X31 A;  1E3G A;  3HVL A;  3DZU D;  2QZO A;  2GIU A;  5DRJ A;  5DK9 A;  3VSO A;  3GZ9 A;  5DMC A;  2ZK2 A;  4IW8 A;  3OMO A;  5AZV A;  2V0V A;  3VRV A;  4R06 A;  3A2H A;  4FGY A;  5AWJ A;  3VT4 A;  4ZJR A;  3RVF A;  3ZRB A;  2ZBS A;  5C4S A;  3ADV A;  3W0Y A;  1KV6 A;  5KRH A;  5L11 A;  5ACC A;  3H0A A;  3VHU A;  1DKF B;  1NHZ A;  1QKT A;  3D5F A;  3L0L A;  3VI8 A;  4IW6 A;  4O8F A;  3IPQ A;  2QMV A;  5DXM A;  4DK7 A;  3KWY A;  3B66 A;  3WJ5 A;  4IS8 A;  4RMC A;  4OEZ A;  4RE8 A;  2PIN A;  5E14 A;  4QK4 A;  3WMH A;  4F9M A;  2QXS A;  3HC5 A;  4ZO1 X;  1DB1 A;  1NYX A;  4MGB A;  3W0H A;  1X78 A;  4IA7 A;  1Z95 A;  1PQ6 A;  2ZNQ A;  4MG7 B;  4DQM A;  2O4J A;  4RUO X;  2R40 A;  2AA5 A;  5DXK A;  4IU7 A;  3PCU A;  1NQ7 A;  2NXX E;  1HG4 A;  1M13 A;  5HCV A;  2Q59 A;  2P7A A;  3AN4 A;  2HCD A;  4S15 A;  2Z4B A;  2AX8 A;  3CQV A;  1ERE A;  1IE8 A;  3CS8 A;  4MGA B;  3WWR A;  4HEE X;  1U9E A;  3CS6 A;  4REF A;  4ZNT A;  3M7R A;  3F5C A;  2BJ4 A;  3K6P A;  4OKX A;  4WLB A;  3B65 A;  1LBD A;  2GL8 A;  3G8O A;  3GYU A;  2VV0 A;  3IXP A;  4MGD A;  4NIE A;  1XPC A;  4RFW A;  5DX3 B;  5F9B A;  2F4B A;  2OCF A;  2PNU A;  2P7Z A;  3OZ0 A;  1ERR A;  4RWV A;  5DYD A;  3TY0 A;  3FXV A;  3A2I A;  4A4V A;  4YT1 A;  3BC5 A;  4ZNV A;  4OH5 A;  5C4T A;  4J5X C;  5KR9 A;  2ZK1 A;  3OLL A;  4LNX A;  3LMP A;  3P0U A;  2QA8 A;  4B7W A;  3EYB A;  3AUN A;  1T74 A;  3HO0 A;  3L3X A;  4G2I A;  5G44 A;  1EXX A;  5DWE A;  4QE8 A;  1GWQ A;  3SZ1 A;  4ZO1 B;  3ET0 A;  3IXP D;  3MNE A;  3W0G A;  3OMP A;  4CI4 A;  4MG8 B;  2VSR A;  4Q13 A;  1FM6 D;  2IOG A;  4IQR A;  3P88 A;  5EHJ A;  1NRL A;  1WM0 X;  3DR1 A;  4J5W C;  5DKS A;  4XI3 A;  5AVL A;  4JYI A;  4Q50 A;  5IAW A;  2OVH A;  2QW4 A;  2I4J A;  2NPA A;  4XAO A;  5DU5 A;  2P54 A;  3BQD A;  3AZ1 A;  3WTQ A;  4NUF A;  3RY9 A;  4OAR A;  2AA7 A;  4ZNU A;  2Q6S A;  4QJR A;  5E7V A;  1G1U A;  3NSP A;  3VJI A;  2ZK0 A;  5DVS A;  2GPV A;  4RZF A;  3K22 A;  1K7L A;  3RUU A;  4QE6 A;  1YIM A;  2IOK A;  2HBH A;  1NQ1 A;  3MNP A;  3VHV A;  5IXK A;  3G0W A;  1XNN A;  3RLJ A;  3ADS A;  3V49 A;  2ZY0 A;  3W5Q A;  5KCT A;  3A9E A;  4UDC A;  4FHI A;  1R20 D;  5AZT A;  3WGP A;  1N4H A;  5ETH A;  2QNV A;  3RUT A;  1ZAF A;  3LBD A;  3G8I A;  3R5M A;  1K74 A;  2PIU A;  2QSE A;  1PDU A;  5DKE A;  2JF9 A;  1PZL A;  5DZ3 A;  5AYG A;  5GIC A;  4NQA B;  1SJ0 A;  3R29 A;  1NAV A;  4ZN7 A;  2Q61 A;  2YLY A;  1YYE A;  1RK3 A;  2ZXZ A;  4PLD A;  2ATH A;  2YLP A;  3B0R A;  4OFR A;  2V7C A;  5E15 A;  2JFA A;  3P8X A;  3VRU A;  3W0I A;  4EMA A;  1I7G A;  1XDK A;  3A3Z X;  4ONI A;  3UU7 B;  5H1E A;  2O9I A;  2YAT A;  2Q7I A;  1UHL A;  4TUZ A;  1S9Q A;  1FM9 D;  2XYJ A;  3WT5 A;  5LWP A;  3U9Q A;  1UPW A;  2PJL A;  3VHW A;  3FS1 A;  2VV1 A;  2GPU A;  2R6Y A;  4E4K A;  5JY3 A;  3V4A A;  1M2Z A;  2QTU A;  4OEY A;  3DY6 A;  5DWG A;  5I4V A;  2Q70 A;  2VV4 A;  2ZVT A;  4RMD A;  1XNX A;  4OKT A;  5AAU A;  4DMA A;  5DZ0 A;  4RZE A;  1RDT D;  1Z5X E;  1UOM A;  2OZ7 A;  4JL4 A;  3V9V A;  3UUA B;  5HYR A;  4IV4 A;  2GWX A;  4UDB A;  3GYT A;  1T73 A;  3N00 A;  2ZFX A;  4KZM A;  2XYW A;  3UUC A;  5G43 A;  2XHS A;  4RUJ A;  2I4Z A;  4OZT U;  2QXM A;  5G45 A;  3VRW A;  4POJ A;  4JGV A;  4OGH A;  3AUR A;  1ZH7 A;  4UDA A;  5DKB A;  5LGA A;  2ZK6 A;  2G0G A;  3HM1 A;  5DWL A;  2IHQ A;  1FD0 A;  2QE4 A;  3HC6 A;  3PLZ A;  4OIV A;  1XQ3 A;  4KZJ A;  3UVV A;  1L2J A;  2I4P A;  2ZK5 A;  5DSH A;  5G3J A;  5EIT A;  3OS9 A;  4ZN9 A;  5M96 A;  5DV8 A;  3OSW A;  1XB7 A;  1Y9R A;  2LBD A;  5KCC A;  4Q0A C;  3IA6 A;  4IA1 A;  4RAK A;  3MNO A;  5KRC A;  4XUM A;  5HYK A;  2HFP A;  3ERD A;  2PIX A;  3H0A D;  3UP3 A;  3SP6 A;  1BSX A;  4TV1 A;  2QGW A;  1ILG A;  1KKQ A;  4DK8 A;  2A3I A;  4IUI A;  1QKN A;  4N5G A;  5E1C A;  2ZMJ A;  3KBA A;  2OAX A;  1RJK A;  3Q95 A;  2PIT A;  2B1V A;  1R1K A;  1TFC A;  2AMB A;  4ZI1 A;  1X7J A;  3A78 A;  1X7R A;  3FC6 A;  4OZT E;  2ZXM A;  2R40 D;  5G42 A;  4PPP A;  4OJ9 A;  3V9Y A;  3VJT A;  3OKH A;  3W0C A;  5DP0 A;  1OT7 A;  3L3Z A;  5AWK A;  3WFF A;  1YOW A;  3UUD A;  1T5Z A;  5G5W A;  4G1D A;  4L98 A;  4EM9 A;  2QZO B;  3FLI A;  3DCT A;  3ILZ A;  3B3K A;  5HJP A;  1ILH A;  5DRM A;  5AVI A;  1EXA A;  1K4W A;  3B0W A;  3HQ5 A;  4OIL A;  5DVC A;  2HWQ A;  1OSV A;  1PQC A;  4DM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...