2Q7IA

The wild type androgen receptor ligand binding domain bound with testosterone and an ar 20-30 peptide
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
249
structure length
241
Chain Sequence
PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIISCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Modulation of androgen receptor activation function 2 by testosterone and dihydrotestosterone.
pubmed doi rcsb
molecule keywords Androgen receptor
molecule tags Hormone
source organism Homo sapiens
total genus 99
structure length 241
sequence length 249
ec nomenclature
pdb deposition date 2007-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2q7iA00
1G2NA 5DKGA 2AA6A 3VT4A 1UOMA 3A40X 4G1YA 2GPUA 2OUZA 1M2ZA 3A2IA 5B5BA 1YOKA 3CWDA 1NQ1A 3L03A 3WT6A 3UP0A 4OKXA 1UHLB 2H77A 4MG7B 5E14A 2Q59B 4B7WA 3KDUA 5DXBB 1FCXA 3R5MA 2PITA 5AZVA 4OIVA 4A2JA 4K4JA 3AUQA 3ILZA 5G5WA 4ZN7A 5DUEA 2Q7IA 2PIVA 4OZTE 2LBDA 5FQVA 2GTKA 1XPCA 1YINA 3V3EA 3ZQTA 3KYTA 2AMBA 3R8DA 5DRMA 3VRVA 2QGTA 4JL4A 2Q7JA 2BJ4B 3ERDA 4RUOX 1T7RA 3TKCA 5G3JA 3ET3A 5DVSA 1X78A 3T03A 3UUDB 1VJBA 3BC5A 4DM8A 4PPSA 2R40D 5JI0D 3VSOA 1PQCA 2ZNOA 5EC9A 2HCDA 4ZO1X 1A52A 1E3KA 2ZY0A 4A4VA 4G2IA 5DVVA 3JZBA 3VRTA 2XYWA 5E15A 2P54A 5AVIA 5G46A 3RUUA 1FM9D 5DK9A 4DMAA 4ZN9A 3UU7B 3R29A 1GWRA 3E7CA 2G0HA 3X36A 3RLLA 2R6YA 1H9UA 4G20A 2YJAB 4IWCA 3B65A 4OKBA 2QXMA 3UVVB 3BQDA 1NQ7A 5CJ6A 2AYRA 3ET1A 1XNXA 3F5CB 1YJEA 2HWQA 2PINA 2YLQA 5DV3A 2O4JA 3WJ5A 4JGVA 5DKBA 4FGYA 1G50A 3B0WA 1R1KA 5KCUA 2Q7LA 4N1YA 4N73A 1I7IA 4TV1B 1OT7A 1XV9B 1MVCA 4OK1A 4OFRA 4E4QA 2HWRA 4MGAA 4RMDA 3ADWA 4MGCA 5HJSA 2Q5PA 1NUOA 2AXAA 4OEYA 4IV4A 3WTQA 4HEEX 1Y9RA 2QH6A 5L7HA 3FS1A 2GPPA 1PRGA 4G2HA 2QNVA 4OZRU 5DXMA 1QKMA 2AB2A 4FHHA 2ABIA 4QM0A 3KFCA 3W0IA 1GS4A 5I4VA 5M96A 2VV4A 2ACLB 2NV7A 2P1UA 5DZ3A 1ZDTA 4OLMA 2VSRA 4JYHA 1X7EA 5G45A 3VHUA 5C4OA 2AA2A 4OJBA 3V9VA 5GT4A 1XP9A 1ZEOA 3D90A 5E0WA 4S0TA 2J4AA 2PNUA 4ZI1A 2PRGA 1U9EA 2JJ3A 4DK7A 4PF3A 3UUCA 2ZL9A 4IA2A 4LNWA 3R8AA 3VRWA 5DXGA 5HZCA 2O4RA 1YA3A 3FEJA 1T74A 2ZNPA 3B67A 3DZUA 3V4AA 1HG4A 1N4HA 5DX3A 3GWSX 3MNPA 3OMPA 4PWLA 3GWXA 3OS9A 4RUJA 5DLRA 2P4YA 4ZJWA 4NIEA 3A78A 3ZRBA 4IVYA 3OAPA 2REWA 2ZK0A 5E1CA 2I0JA 1R1KD 2AMAA 1L2JA 4OH6A 5E19A 3E94A 3G8OA 4XUMA 1ILHA 3O1DA 5DKSA 5L11A 3IPUA 5KYAA 2Z4BA 5DVCA 2NPAA 4MG6A 5FQRA 4MGDB 1K4WA 1X7RA 1Y0SA 2J7YA 3D57A 1T7MA 5A86A 1RDTD 3VI8A 5DZ1A 1XNNA 4QL8A 4RE8A 5DXEA 5EJVA 4Q13A 4NB6A 3P8XA 4FHIA 5IZ0A 1PDUA 1TFCA 2PIOA 3A2JA 1SKXA 3SP6A 2J14A 3VT8A 4LSJA 4CI5A 5AWKA 2P7ZA 3X31A 1XP1A 1LBDA 2I0GA 1XVPB 2AX8A 1G1UA 4RMEA 3PLZA 3FALB 2Q6JA 1BSXA 1T73A 3CDPA 2QA6A 1K74D 3AX8A 4IS8A 4OJ4A 4POHA 2E2RA 3WGPA 1T65A 1T7TA 3RVFA 5KD9A 1XDKA 2OM9A 4ONIA 4YNKA 4EMAA 5B41A 3AN3A 2XHSA 3ADVA 3W0GA 3OKHA 3ADXA 5DWLA 3OMQA 1S0ZA 3DZUD 4ZNVA 4OGHA 5GICA 4FNEA 3L0JA 4OJ9A 1S0XA 5APHA 4ZNSA 5DXKA 1NQ2A 2QSEA 5KRKA 4IUIA 2QE4A 4R06A 1NQ0A 5AK2A 4RZGA 2XYJA 3LBDA 4MG5A 1OVLA 2I4JA 2Q1HA 2VV2A 3P89A 2P7AA 2YFEA 3H52A 4IU7A 4P6WA 4TUZA 5EGVA 3ERTA 5DRJA 5DWEA 3H0AD 1FCZA 2GL8A 4QJRA 4Y29A 1FCYA 4XLDA 4POJA 5HJPA 1T63A 4APUA 3GN8A 2G0GA 3X1IA 5C4UA 2ZNNA 3NOAA 3ZR7A 2JF9A 4G1ZA 3HODA 5KRFA 1Q4XA 1U3QA 1XB7A 1N46A 5AWJA 2ZXNA 4E4KA 1A28A 1NYXA 3AZ1A 4G21A 5HYRA 3E00A 4E2JA 1I7GA 1RKHA 4NUFA 3VT7A 2OCFA 3FC6B 4RZEA 4RWVA 1FM6D 2B1ZA 1U3RA 4LNXA 1X7JA 3VSPA 4OH5A 3DCTA 1I37A 1R20A 2H79A 1QKUA 2ATHA 3HVLA 5EI1A 4NQAB 2FAIA 4KZIA 3OZJA 2QABA 3OZ0A 3U9QA 4YMQA 5LGAA 3G9EA 3HO0A 5DTVA 1YYEA 5G43A 3PRGA 4BCRA 1XP6A 2ZLCA 5DMFA 4JYIA 3HC6A 3VJHA 1U3SA 2R6WA 2POBA 5DKEA 5DZIA 5EHJA 2NXXA 2PJLA 2ZK6A 3OLSA 3RUTA 3HC5A 4O8FA 4OKTA 2ZK5A 5DYBA 2Z4JA 1T79A 3ADSA 2JFAA 2O9IA 1NAVA 4ZNHA 1DKFA 1KNUA 3L3XA 3VTDA 4J26A 1XAPA 4OARA 2VV1A 3KDTA 2GWXA 3G8IA 2ZK2A 4K7AA 3GBKA 3FLIA 4XI3A 3ADTA 1ERRA 3IPQA 3V3QA 2VV0A 1IE8A 2HVCA 3VRUA 5HYKA 1YIMA 3DZYA 1PQ6A 2ZFXA 2ZMIA 3CS6A 3OS8A 4X1GA 5AAVA 1PCGA 5DIDA 2IOKA 3MNEA 1LV2A 4MG8A 2P1VA 2PIQA 3VT9A 3IPSA 1PQ9A 3OKIA 3CS4A 5HCVA 1MZNA 1KV6A 2YLYA 2IHQA 2ZMHA 2ZK3A 3B3KA 2P1TA 3BEJA 4OIUA 2Q60A 2Q6SA 5E7VA 3TX7B 3CDSA 3W0AA 1OSVA 3WT7A 5LWPA 3NSPA 3P0UA 1SJ0A 4QE8A 5KROA 3MNOA 1TXIA 4OZTU 3DCUA 4CI4A 3S9SA 3WMHA 1XLSA 3DY6A 4IW6A 2QA8A 5DYDA 2PKLA 3R8IA 5DZHA 1SR7A 5KRJA 2QZOA 2VV3A 3GD2A 5ACCA 4XAOA 1S19A 2ZXMA 4EM9A 1EREA 1XQCA 5DV6A 5APJA 5IXKA 3ET0A 3D5FA 2ZMJA 3W5QA 2ZKCA 4JYGA 4S15A 4XTAA 3K8SA 5DSHA 4RZFA 3IXPA 3HM1A 2F4BA 4IVWA 2Q3YA 4S0SA 3X1HA 3A2HA 5DZ0A 5KRCA 1YY4A 3L3ZA 4R2UA 4WHGA 4ZNWA 3OSAA 2VSTA 3G0WA 5FQSA 5DMCA 2B50A 2AX7A 4OKWA 4J5WA 5L7GA 2HC4A 1X7BA 3R2AA 1XZXX 4FN9A 4IA7A 4MGAB 3WJ4A 3KMGA 4HLWA 1KKQA 1UHLA 3PBAA 1R5KA 1S9QA 2Q59A 4MG7A 4DOSA 5IAWA 5KCDA 4PXMA 4UDBA 5DXBA 3DZYD 4KZMA 1PK5A 3RLJA 2B1VA 2PIXA 4A4WA 5DI7A 1X76A 4OEAA 3K23A 5JJMB 4WVDA 2Q1VA 1NDEA 3Q95A 2VV4B 4J5XC 1NRLA 2QW4A 1E3GA 3K22A 5DXQA 1ZDUA 3V9TA 3FURA 4M8EA 5EITA 4QE6A 1QKNA 2HASA 3IA6A 4RMCA 3W5RA 2ZVTA 2J7XA 4IV2A 2BJ4A 4WLBA 4XT9A 5DUGA 3OGTA 3AZ2A 3R5NA 1G5YA 3LMPA 4REFA 5ETHA 3UUDA 1GWXA 4ZNUA 2Q8SA 2ZNQA 3GZ9A 4WPFA 3EYBA 4F9MA 3AFRA 4ZOMA 2HB7A 2Q7KA 3W5TA 5DX3B 2BAWA 3OMOA 2HB8A 3CS8A 5DWIA 1RKGA 5KR9A 1XIUA 3OMKA 4PLEA 3HQ5A 3PCUA 4M8HA 4PVUA 5AVLA 1FM9A 3VTBA 1NHZA 2ZK1A 3UU7A 2ZBSA 4IQRA 5DP0A 3L1BA 1Y0XX 2QR9A 4IA1A 2OAXA 2Q5GA 3GYUA 4UDDA 3IMYA 3UVVA 3OMMA 3OSWA 4KZJA 4ITFA 3W0CA 4Q50A 2HARA 3F5CA 3K6PA 5DL4A 2I4PA 3B0RA 3WWRA 4MGBA 3CTBA 4OZRE 3AUNA 1Z5XU 3V9YA 1MV9A 3A3ZX 3ADUA 4TV1A 3UUAA 1XV9A 1UPVA 1ZH7A 1UPWA 4REEA 1T5ZA 5DV8A 4CSJA 3B0QA 3B1MA 3Q95B 3OOFA 3SP9A 2P7GA 1YOWA 3W0YA 2AM9A 4ITEA 5C4SA 3TY0A 3L0EA 1M7WA 1DB1A 4PRGA 5DXRA 2GP7A 5G42A 2AWHA 3WFGA 1HJ1A 2GPVA 2ACLA 4OHAA 1EXAA 2QTUA 4L96A 4JAZA 4MDDA 1NAXA 3QT0A 3D24A 5E0XA 3OSIA 3DT3A 4UDAA 1XOWA 4PP6A 1XDKB 1YUCA 3VT3A 4ZJRA 3KWYA 5DY8A 2YJDA 4OFUA 4XUHA 5FQPA 2OZ7A 5KCWA 2PIUA 2W8YA 3B0TA 3B68A 4N8RA 5K13A 5DWJA 5FQTA 3CQVA 1RJKA 4QK4A 2QPYA 3RY9A 4OILA 2AA5A 1OVLB 2AAXA 2ZK4A 2B23A 4XHDA 4TUZB 2AX6A 1SQNA 3HZFA 3O1EA 5HJPB 1FD0A 2PIPL 4K6IA 2NXXE 1I38A 2AX9A 3CLDA 3FEIA 3NSQA 2ZLAA 3VN2A 3WFFA 3W5PA 4ZNTA 5KCEA 4R6SA 5DU5A 4MGBB 4P6XA 4MG9A 1T76A 2NW4A 2FVJA 3OLFA 3VHVA 3M7RA 5GIDA 5F9BA 3UUAB 3W0HA 2QMVA 4WHFA 3E00D 3D6DA 4UDCA 5G44A 1RK3A 4IW8A 2G5OA 4L98A 4MGDA 1GWQA 3FUGA 1T7FA 3VT5A 3ET2A 3SZ1A 3UP3A 5JJMA 1ILGA 2PIRA 1R20D 3A9EA 1RDTA 3W0JA 1S9PA 1IE9A 2XYXA 4RFWA 5AYGA 2HFPA 2Q61A 5DXPA 3TKMA 2OVMA 3KMZA 4PPPA 1K7LA 2G44A 4RAKA 2OVHA 4YPQA 2A3IA 1EXXA 4OEZA 4Q0AC 1QKTA 2Q6RA 2ZXZA 3B5RA 5GIEA 5H1EA 4G1DA 1XVPA 1FBYA 4J5XA 3VHWA 2YHDA 5L7EA 3FALA 1P93A 3HLVA 1P8DA 3L0LA 3VJTA 1WM0X 2ZASA 2GPOA 4PP5A 5DUHA 4YT1A 5KRAA 1K74A 4S14A 1XLSE 2EWPA 2YLPA 3V49A 3VT6A 2JFAB 3FXVA 1ZKYA 3B66A 1DKFB 1ZUCA 3VJIA 5KRIA 2PIWA 4NY9A 2VV1B 1XQ3A 3VTCA 3WT5A 4PLDA 3AN4A 2V7CA 3OS8C 3KBAA 5C4TA 3CJWA 4LTWA 4DQMA 3DR1A 5KCTA 1YP0A 1Z5XE 1PZLA 5AAVB 1XJ7A 2Q5SA 3KPZA 2AA7A 5KCCA 5ICKA 4J24A 5APKA 2XKWA 4MG8B 2QGWA 4DM6A 3PO9A 2P15A 3H0AA 5SYZA 4WQPA 3F7DA 5KCFA 4MG9B 4OC7A 1R6GA 4LBDA 3JZCA 4X1FA 2YATA 5KRHA 2V0VA 5KYJA 4DORA 4DK8A 5KRMA 2HBHA 3GYTA 4PP3A 1YMTA 5DIGA 4ZO1B 2POGA 4OEDA 3OOKA 2I4ZA 5AZTA 4IA3A 1ZAFA 3KMRA 5AAUA 1Z95A 3A9EB 3ZRAA 2QA8B 5JY3A 2YLOA 3AZ3A 2HAMA 2R40A 3PEQA 1M13A 3FC6A 2QZOB 1L2IA 2Q70A 3OLLA 5DIEA 3P88A 1FM6A 2AO6A 1ZGYA 4IWFA 3VJSA 2GIUA 4RUPA 2FSZA 3N00A 3IXPD 4N5GA 5DWGA 1OSHA 2IOGA 5KRLA 2QXSA 1N83A 4J5WC 3AURA
chains in the Genus database with same CATH superfamily
1G2NA 5DKGA 2AA6A 3VT4A 1UOMA 3A40X 4G1YA 2GPUA 2OUZA 1M2ZA 3A2IA 5B5BA 1YOKA 3CWDA 1NQ1A 3L03A 3WT6A 3UP0A 4OKXA 1UHLB 2H77A 4MG7B 5E14A 2Q59B 4B7WA 3KDUA 5DXBB 1FCXA 3R5MA 2PITA 5AZVA 4OIVA 4A2JA 4K4JA 3AUQA 3ILZA 5G5WA 4ZN7A 5DUEA 2Q7IA 2PIVA 4OZTE 2LBDA 5FQVA 2GTKA 1XPCA 1YINA 3V3EA 3ZQTA 3KYTA 2AMBA 3R8DA 5DRMA 3VRVA 2QGTA 4JL4A 2Q7JA 2BJ4B 3ERDA 4RUOX 1T7RA 3TKCA 5G3JA 3ET3A 5DVSA 1X78A 3T03A 3UUDB 1VJBA 3BC5A 4DM8A 4PPSA 2R40D 5JI0D 3VSOA 1PQCA 2ZNOA 5EC9A 2HCDA 4ZO1X 1A52A 1E3KA 2ZY0A 4A4VA 4G2IA 5DVVA 3JZBA 3VRTA 2XYWA 5E15A 2P54A 5AVIA 5G46A 3RUUA 1FM9D 5DK9A 4DMAA 4ZN9A 3UU7B 3R29A 1GWRA 3E7CA 2G0HA 3X36A 3RLLA 2R6YA 1H9UA 4G20A 2YJAB 4IWCA 3B65A 4OKBA 2QXMA 3UVVB 3BQDA 1NQ7A 5CJ6A 2AYRA 3ET1A 1XNXA 3F5CB 1YJEA 2HWQA 2PINA 2YLQA 5DV3A 2O4JA 3WJ5A 4JGVA 5DKBA 4FGYA 1G50A 3B0WA 1R1KA 5KCUA 2Q7LA 4N1YA 4N73A 1I7IA 4TV1B 1OT7A 1XV9B 1MVCA 4OK1A 4OFRA 4E4QA 2HWRA 4MGAA 4RMDA 3ADWA 4MGCA 5HJSA 2Q5PA 1NUOA 2AXAA 4OEYA 4IV4A 3WTQA 4HEEX 1Y9RA 2QH6A 5L7HA 3FS1A 2GPPA 1PRGA 4G2HA 2QNVA 4OZRU 5DXMA 1QKMA 2AB2A 4FHHA 2ABIA 4QM0A 3KFCA 3W0IA 1GS4A 5I4VA 5M96A 2VV4A 2ACLB 2NV7A 2P1UA 5DZ3A 1ZDTA 4OLMA 2VSRA 4JYHA 1X7EA 5G45A 3VHUA 5C4OA 2AA2A 4OJBA 3V9VA 5GT4A 1XP9A 1ZEOA 3D90A 5E0WA 4S0TA 2J4AA 2PNUA 4ZI1A 2PRGA 1U9EA 2JJ3A 4DK7A 4PF3A 3UUCA 2ZL9A 4IA2A 4LNWA 3R8AA 3VRWA 5DXGA 5HZCA 2O4RA 1YA3A 3FEJA 1T74A 2ZNPA 3B67A 3DZUA 3V4AA 1HG4A 1N4HA 5DX3A 3GWSX 3MNPA 3OMPA 4PWLA 3GWXA 3OS9A 4RUJA 5DLRA 2P4YA 4ZJWA 4NIEA 3A78A 3ZRBA 4IVYA 3OAPA 2REWA 2ZK0A 5E1CA 2I0JA 1R1KD 2AMAA 1L2JA 4OH6A 5E19A 3E94A 3G8OA 4XUMA 1ILHA 3O1DA 5DKSA 5L11A 3IPUA 5KYAA 2Z4BA 5DVCA 2NPAA 4MG6A 5FQRA 4MGDB 1K4WA 1X7RA 1Y0SA 2J7YA 3D57A 1T7MA 5A86A 1RDTD 3VI8A 5DZ1A 1XNNA 4QL8A 4RE8A 5DXEA 5EJVA 4Q13A 4NB6A 3P8XA 4FHIA 5IZ0A 1PDUA 1TFCA 2PIOA 3A2JA 1SKXA 3SP6A 2J14A 3VT8A 4LSJA 4CI5A 5AWKA 2P7ZA 3X31A 1XP1A 1LBDA 2I0GA 1XVPB 2AX8A 1G1UA 4RMEA 3PLZA 3FALB 2Q6JA 1BSXA 1T73A 3CDPA 2QA6A 1K74D 3AX8A 4IS8A 4OJ4A 4POHA 2E2RA 3WGPA 1T65A 1T7TA 3RVFA 5KD9A 1XDKA 2OM9A 4ONIA 4YNKA 4EMAA 5B41A 3AN3A 2XHSA 3ADVA 3W0GA 3OKHA 3ADXA 5DWLA 3OMQA 1S0ZA 3DZUD 4ZNVA 4OGHA 5GICA 4FNEA 3L0JA 4OJ9A 1S0XA 5APHA 4ZNSA 5DXKA 1NQ2A 2QSEA 5KRKA 4IUIA 2QE4A 4R06A 1NQ0A 5AK2A 4RZGA 2XYJA 3LBDA 4MG5A 1OVLA 2I4JA 2Q1HA 2VV2A 3P89A 2P7AA 2YFEA 3H52A 4IU7A 4P6WA 4TUZA 5EGVA 3ERTA 5DRJA 5DWEA 3H0AD 1FCZA 2GL8A 4QJRA 4Y29A 1FCYA 4XLDA 4POJA 5HJPA 1T63A 4APUA 3GN8A 2G0GA 3X1IA 5C4UA 2ZNNA 3NOAA 3ZR7A 2JF9A 4G1ZA 3HODA 5KRFA 1Q4XA 1U3QA 1XB7A 1N46A 5AWJA 2ZXNA 4E4KA 1A28A 1NYXA 3AZ1A 4G21A 5HYRA 3E00A 4E2JA 1I7GA 1RKHA 4NUFA 3VT7A 2OCFA 3FC6B 4RZEA 4RWVA 1FM6D 2B1ZA 1U3RA 4LNXA 1X7JA 3VSPA 4OH5A 3DCTA 1I37A 1R20A 2H79A 1QKUA 2ATHA 3HVLA 5EI1A 4NQAB 2FAIA 4KZIA 3OZJA 2QABA 3OZ0A 3U9QA 4YMQA 5LGAA 3G9EA 3HO0A 5DTVA 1YYEA 5G43A 3PRGA 4BCRA 1XP6A 2ZLCA 5DMFA 4JYIA 3HC6A 3VJHA 1U3SA 2R6WA 2POBA 5DKEA 5DZIA 5EHJA 2NXXA 2PJLA 2ZK6A 3OLSA 3RUTA 3HC5A 4O8FA 4OKTA 2ZK5A 5DYBA 2Z4JA 1T79A 3ADSA 2JFAA 2O9IA 1NAVA 4ZNHA 1DKFA 1KNUA 3L3XA 3VTDA 4J26A 1XAPA 4OARA 2VV1A 3KDTA 2GWXA 3G8IA 2ZK2A 4K7AA 3GBKA 3FLIA 4XI3A 3ADTA 1ERRA 3IPQA 3V3QA 2VV0A 1IE8A 2HVCA 3VRUA 5HYKA 1YIMA 3DZYA 1PQ6A 2ZFXA 2ZMIA 3CS6A 3OS8A 4X1GA 5AAVA 1PCGA 5DIDA 2IOKA 3MNEA 1LV2A 4MG8A 2P1VA 2PIQA 3VT9A 3IPSA 1PQ9A 3OKIA 3CS4A 5HCVA 1MZNA 1KV6A 2YLYA 2IHQA 2ZMHA 2ZK3A 3B3KA 2P1TA 3BEJA 4OIUA 2Q60A 2Q6SA 5E7VA 3TX7B 3CDSA 3W0AA 1OSVA 3WT7A 5LWPA 3NSPA 3P0UA 1SJ0A 4QE8A 5KROA 3MNOA 1TXIA 4OZTU 3DCUA 4CI4A 3S9SA 3WMHA 1XLSA 3DY6A 4IW6A 2QA8A 5DYDA 2PKLA 3R8IA 5DZHA 1SR7A 5KRJA 2QZOA 2VV3A 3GD2A 5ACCA 4XAOA 1S19A 2ZXMA 4EM9A 1EREA 1XQCA 5DV6A 5APJA 5IXKA 3ET0A 3D5FA 2ZMJA 3W5QA 2ZKCA 4JYGA 4S15A 4XTAA 3K8SA 5DSHA 4RZFA 3IXPA 3HM1A 2F4BA 4IVWA 2Q3YA 4S0SA 3X1HA 3A2HA 5DZ0A 5KRCA 1YY4A 3L3ZA 4R2UA 4WHGA 4ZNWA 3OSAA 2VSTA 3G0WA 5FQSA 5DMCA 2B50A 2AX7A 4OKWA 4J5WA 5L7GA 2HC4A 1X7BA 3R2AA 1XZXX 4FN9A 4IA7A 4MGAB 3WJ4A 3KMGA 4HLWA 1KKQA 1UHLA 3PBAA 1R5KA 1S9QA 2Q59A 4MG7A 4DOSA 5IAWA 5KCDA 4PXMA 4UDBA 5DXBA 3DZYD 4KZMA 1PK5A 3RLJA 2B1VA 2PIXA 4A4WA 5DI7A 1X76A 4OEAA 3K23A 5JJMB 4WVDA 2Q1VA 1NDEA 3Q95A 2VV4B 4J5XC 1NRLA 2QW4A 1E3GA 3K22A 5DXQA 1ZDUA 3V9TA 3FURA 4M8EA 5EITA 4QE6A 1QKNA 2HASA 3IA6A 4RMCA 3W5RA 2ZVTA 2J7XA 4IV2A 2BJ4A 4WLBA 4XT9A 5DUGA 3OGTA 3AZ2A 3R5NA 1G5YA 3LMPA 4REFA 5ETHA 3UUDA 1GWXA 4ZNUA 2Q8SA 2ZNQA 3GZ9A 4WPFA 3EYBA 4F9MA 3AFRA 4ZOMA 2HB7A 2Q7KA 3W5TA 5DX3B 2BAWA 3OMOA 2HB8A 3CS8A 5DWIA 1RKGA 5KR9A 1XIUA 3OMKA 4PLEA 3HQ5A 3PCUA 4M8HA 4PVUA 5AVLA 1FM9A 3VTBA 1NHZA 2ZK1A 3UU7A 2ZBSA 4IQRA 5DP0A 3L1BA 1Y0XX 2QR9A 4IA1A 2OAXA 2Q5GA 3GYUA 4UDDA 3IMYA 3UVVA 3OMMA 3OSWA 4KZJA 4ITFA 3W0CA 4Q50A 2HARA 3F5CA 3K6PA 5DL4A 2I4PA 3B0RA 3WWRA 4MGBA 3CTBA 4OZRE 3AUNA 1Z5XU 3V9YA 1MV9A 3A3ZX 3ADUA 4TV1A 3UUAA 1XV9A 1UPVA 1ZH7A 1UPWA 4REEA 1T5ZA 5DV8A 4CSJA 3B0QA 3B1MA 3Q95B 3OOFA 3SP9A 2P7GA 1YOWA 3W0YA 2AM9A 4ITEA 5C4SA 3TY0A 3L0EA 1M7WA 1DB1A 4PRGA 5DXRA 2GP7A 5G42A 2AWHA 3WFGA 1HJ1A 2GPVA 2ACLA 4OHAA 1EXAA 2QTUA 4L96A 4JAZA 4MDDA 1NAXA 3QT0A 3D24A 5E0XA 3OSIA 3DT3A 4UDAA 1XOWA 4PP6A 1XDKB 1YUCA 3VT3A 4ZJRA 3KWYA 5DY8A 2YJDA 4OFUA 4XUHA 5FQPA 2OZ7A 5KCWA 2PIUA 2W8YA 3B0TA 3B68A 4N8RA 5K13A 5DWJA 5FQTA 3CQVA 1RJKA 4QK4A 2QPYA 3RY9A 4OILA 2AA5A 1OVLB 2AAXA 2ZK4A 2B23A 4XHDA 4TUZB 2AX6A 1SQNA 3HZFA 3O1EA 5HJPB 1FD0A 2PIPL 4K6IA 2NXXE 1I38A 2AX9A 3CLDA 3FEIA 3NSQA 2ZLAA 3VN2A 3WFFA 3W5PA 4ZNTA 5KCEA 4R6SA 5DU5A 4MGBB 4P6XA 4MG9A 1T76A 2NW4A 2FVJA 3OLFA 3VHVA 3M7RA 5GIDA 5F9BA 3UUAB 3W0HA 2QMVA 4WHFA 3E00D 3D6DA 4UDCA 5G44A 1RK3A 4IW8A 2G5OA 4L98A 4MGDA 1GWQA 3FUGA 1T7FA 3VT5A 3ET2A 3SZ1A 3UP3A 5JJMA 1ILGA 2PIRA 1R20D 3A9EA 1RDTA 3W0JA 1S9PA 1IE9A 2XYXA 4RFWA 5AYGA 2HFPA 2Q61A 5DXPA 3TKMA 2OVMA 3KMZA 4PPPA 1K7LA 2G44A 4RAKA 2OVHA 4YPQA 2A3IA 1EXXA 4OEZA 4Q0AC 1QKTA 2Q6RA 2ZXZA 3B5RA 5GIEA 5H1EA 4G1DA 1XVPA 1FBYA 4J5XA 3VHWA 2YHDA 5L7EA 3FALA 1P93A 3HLVA 1P8DA 3L0LA 3VJTA 1WM0X 2ZASA 2GPOA 4PP5A 5DUHA 4YT1A 5KRAA 1K74A 4S14A 1XLSE 2EWPA 2YLPA 3V49A 3VT6A 2JFAB 3FXVA 1ZKYA 3B66A 1DKFB 1ZUCA 3VJIA 5KRIA 2PIWA 4NY9A 2VV1B 1XQ3A 3VTCA 3WT5A 4PLDA 3AN4A 2V7CA 3OS8C 3KBAA 5C4TA 3CJWA 4LTWA 4DQMA 3DR1A 5KCTA 1YP0A 1Z5XE 1PZLA 5AAVB 1XJ7A 2Q5SA 3KPZA 2AA7A 5KCCA 5ICKA 4J24A 5APKA 2XKWA 4MG8B 2QGWA 4DM6A 3PO9A 2P15A 3H0AA 5SYZA 4WQPA 3F7DA 5KCFA 4MG9B 4OC7A 1R6GA 4LBDA 3JZCA 4X1FA 2YATA 5KRHA 2V0VA 5KYJA 4DORA 4DK8A 5KRMA 2HBHA 3GYTA 4PP3A 1YMTA 5DIGA 4ZO1B 2POGA 4OEDA 3OOKA 2I4ZA 5AZTA 4IA3A 1ZAFA 3KMRA 5AAUA 1Z95A 3A9EB 3ZRAA 2QA8B 5JY3A 2YLOA 3AZ3A 2HAMA 2R40A 3PEQA 1M13A 3FC6A 2QZOB 1L2IA 2Q70A 3OLLA 5DIEA 3P88A 1FM6A 2AO6A 1ZGYA 4IWFA 3VJSA 2GIUA 4RUPA 2FSZA 3N00A 3IXPD 4N5GA 5DWGA 1OSHA 2IOGA 5KRLA 2QXSA 1N83A 4J5WC 3AURA
chains in the Genus database with same CATH topology
1G2NA 5DKGA 2AA6A 3VT4A 1UOMA 3A40X 4G1YA 2GPUA 2OUZA 1M2ZA 3A2IA 5B5BA 1YOKA 3CWDA 1NQ1A 3L03A 3WT6A 3UP0A 4OKXA 1UHLB 2H77A 4MG7B 5E14A 2Q59B 4B7WA 3KDUA 5DXBB 1FCXA 3R5MA 2PITA 5AZVA 4OIVA 4A2JA 4K4JA 3AUQA 3ILZA 5G5WA 4ZN7A 5DUEA 2Q7IA 2PIVA 4OZTE 2LBDA 5FQVA 2GTKA 1XPCA 1YINA 3V3EA 3ZQTA 3KYTA 2AMBA 3R8DA 5DRMA 3VRVA 2QGTA 4JL4A 2Q7JA 2BJ4B 3ERDA 4RUOX 1T7RA 3TKCA 5G3JA 3ET3A 5DVSA 1X78A 3T03A 3UUDB 1VJBA 3BC5A 4DM8A 4PPSA 2R40D 5JI0D 3VSOA 1PQCA 2ZNOA 5EC9A 2HCDA 4ZO1X 1A52A 1E3KA 2ZY0A 4A4VA 4G2IA 5DVVA 3JZBA 3VRTA 2XYWA 5E15A 2P54A 5AVIA 5G46A 3RUUA 1FM9D 5DK9A 4DMAA 4ZN9A 3UU7B 3R29A 1GWRA 3E7CA 2G0HA 3X36A 3RLLA 2R6YA 1H9UA 4G20A 2YJAB 4IWCA 3B65A 4OKBA 2QXMA 3UVVB 3BQDA 1NQ7A 5CJ6A 2AYRA 3ET1A 1XNXA 3F5CB 1YJEA 2HWQA 2PINA 2YLQA 5DV3A 2O4JA 3WJ5A 4JGVA 5DKBA 4FGYA 1G50A 3B0WA 1R1KA 5KCUA 2Q7LA 4N1YA 4N73A 1I7IA 4TV1B 1OT7A 1XV9B 1MVCA 4OK1A 4OFRA 4E4QA 2HWRA 4MGAA 4RMDA 3ADWA 4MGCA 5HJSA 2Q5PA 1NUOA 2AXAA 4OEYA 4IV4A 3WTQA 4HEEX 1Y9RA 2QH6A 5L7HA 3FS1A 2GPPA 1PRGA 4G2HA 2QNVA 4OZRU 5DXMA 1QKMA 2AB2A 4FHHA 2ABIA 4QM0A 3KFCA 3W0IA 1GS4A 5I4VA 5M96A 2VV4A 2ACLB 2NV7A 2P1UA 5DZ3A 1ZDTA 4OLMA 2VSRA 4JYHA 1X7EA 5G45A 3VHUA 5C4OA 2AA2A 4OJBA 3V9VA 5GT4A 1XP9A 1ZEOA 3D90A 5E0WA 4S0TA 2J4AA 2PNUA 4ZI1A 2PRGA 1U9EA 2JJ3A 4DK7A 4PF3A 3UUCA 2ZL9A 4IA2A 4LNWA 3R8AA 3VRWA 5DXGA 5HZCA 2O4RA 1YA3A 3FEJA 1T74A 2ZNPA 3B67A 3DZUA 3V4AA 1HG4A 1N4HA 5DX3A 3GWSX 3MNPA 3OMPA 4PWLA 3GWXA 3OS9A 4RUJA 5DLRA 2P4YA 4ZJWA 4NIEA 3A78A 3ZRBA 4IVYA 3OAPA 2REWA 2ZK0A 5E1CA 2I0JA 1R1KD 2AMAA 1L2JA 4OH6A 5E19A 3E94A 3G8OA 4XUMA 1ILHA 3O1DA 5DKSA 5L11A 3IPUA 5KYAA 2Z4BA 5DVCA 2NPAA 4MG6A 5FQRA 4MGDB 1K4WA 1X7RA 1Y0SA 2J7YA 3D57A 1T7MA 5A86A 1RDTD 3VI8A 5DZ1A 1XNNA 4QL8A 4RE8A 5DXEA 5EJVA 4Q13A 4NB6A 3P8XA 4FHIA 5IZ0A 1PDUA 1TFCA 2PIOA 3A2JA 1SKXA 3SP6A 2J14A 3VT8A 4LSJA 4CI5A 5AWKA 2P7ZA 3X31A 1XP1A 1LBDA 2I0GA 1XVPB 2AX8A 1G1UA 4RMEA 3PLZA 3FALB 2Q6JA 1BSXA 1T73A 3CDPA 2QA6A 1K74D 3AX8A 4IS8A 4OJ4A 4POHA 2E2RA 3WGPA 1T65A 1T7TA 3RVFA 5KD9A 1XDKA 2OM9A 4ONIA 4YNKA 4EMAA 5B41A 3AN3A 2XHSA 3ADVA 3W0GA 3OKHA 3ADXA 5DWLA 3OMQA 1S0ZA 3DZUD 4ZNVA 4OGHA 5GICA 4FNEA 3L0JA 4OJ9A 1S0XA 5APHA 4ZNSA 5DXKA 1NQ2A 2QSEA 5KRKA 4IUIA 2QE4A 4R06A 1NQ0A 5AK2A 4RZGA 2XYJA 3LBDA 4MG5A 1OVLA 2I4JA 2Q1HA 2VV2A 3P89A 2P7AA 2YFEA 3H52A 4IU7A 4P6WA 4TUZA 5EGVA 3ERTA 5DRJA 5DWEA 3H0AD 1FCZA 2GL8A 4QJRA 4Y29A 1FCYA 4XLDA 4POJA 5HJPA 1T63A 4APUA 3GN8A 2G0GA 3X1IA 5C4UA 2ZNNA 3NOAA 3ZR7A 2JF9A 4G1ZA 3HODA 5KRFA 1Q4XA 1U3QA 1XB7A 1N46A 5AWJA 2ZXNA 4E4KA 1A28A 1NYXA 3AZ1A 4G21A 5HYRA 3E00A 4E2JA 1I7GA 1RKHA 4NUFA 3VT7A 2OCFA 3FC6B 4RZEA 4RWVA 1FM6D 2B1ZA 1U3RA 4LNXA 1X7JA 3VSPA 4OH5A 3DCTA 1I37A 1R20A 2H79A 1QKUA 2ATHA 3HVLA 5EI1A 4NQAB 2FAIA 4KZIA 3OZJA 2QABA 3OZ0A 3U9QA 4YMQA 5LGAA 3G9EA 3HO0A 5DTVA 1YYEA 5G43A 3PRGA 4BCRA 1XP6A 2ZLCA 5DMFA 4JYIA 3HC6A 3VJHA 1U3SA 2R6WA 2POBA 5DKEA 5DZIA 5EHJA 2NXXA 2PJLA 2ZK6A 3OLSA 3RUTA 3HC5A 4O8FA 4OKTA 2ZK5A 5DYBA 2Z4JA 1T79A 3ADSA 2JFAA 2O9IA 1NAVA 4ZNHA 1DKFA 1KNUA 3L3XA 3VTDA 4J26A 1XAPA 4OARA 2VV1A 3KDTA 2GWXA 3G8IA 2ZK2A 4K7AA 3GBKA 3FLIA 4XI3A 3ADTA 1ERRA 3IPQA 3V3QA 2VV0A 1IE8A 2HVCA 3VRUA 5HYKA 1YIMA 3DZYA 1PQ6A 2ZFXA 2ZMIA 3CS6A 3OS8A 4X1GA 5AAVA 1PCGA 5DIDA 2IOKA 3MNEA 1LV2A 4MG8A 2P1VA 2PIQA 3VT9A 3IPSA 1PQ9A 3OKIA 3CS4A 5HCVA 1MZNA 1KV6A 2YLYA 2IHQA 2ZMHA 2ZK3A 3B3KA 2P1TA 3BEJA 4OIUA 2Q60A 2Q6SA 5E7VA 3TX7B 3CDSA 3W0AA 1OSVA 3WT7A 5LWPA 3NSPA 3P0UA 1SJ0A 4QE8A 5KROA 3MNOA 1TXIA 4OZTU 3DCUA 4CI4A 3S9SA 3WMHA 1XLSA 3DY6A 4IW6A 2QA8A 5DYDA 2PKLA 3R8IA 5DZHA 1SR7A 5KRJA 2QZOA 2VV3A 3GD2A 5ACCA 4XAOA 1S19A 2ZXMA 4EM9A 1EREA 1XQCA 5DV6A 5APJA 5IXKA 3ET0A 3D5FA 2ZMJA 3W5QA 2ZKCA 4JYGA 4S15A 4XTAA 3K8SA 5DSHA 4RZFA 3IXPA 3HM1A 2F4BA 4IVWA 2Q3YA 4S0SA 3X1HA 3A2HA 5DZ0A 5KRCA 1YY4A 3L3ZA 4R2UA 4WHGA 4ZNWA 3OSAA 2VSTA 3G0WA 5FQSA 5DMCA 2B50A 2AX7A 4OKWA 4J5WA 5L7GA 2HC4A 1X7BA 3R2AA 1XZXX 4FN9A 4IA7A 4MGAB 3WJ4A 3KMGA 4HLWA 1KKQA 1UHLA 3PBAA 1R5KA 1S9QA 2Q59A 4MG7A 4DOSA 5IAWA 5KCDA 4PXMA 4UDBA 5DXBA 3DZYD 4KZMA 1PK5A 3RLJA 2B1VA 2PIXA 4A4WA 5DI7A 1X76A 4OEAA 3K23A 5JJMB 4WVDA 2Q1VA 1NDEA 3Q95A 2VV4B 4J5XC 1NRLA 2QW4A 1E3GA 3K22A 5DXQA 1ZDUA 3V9TA 3FURA 4M8EA 5EITA 4QE6A 1QKNA 2HASA 3IA6A 4RMCA 3W5RA 2ZVTA 2J7XA 4IV2A 2BJ4A 4WLBA 4XT9A 5DUGA 3OGTA 3AZ2A 3R5NA 1G5YA 3LMPA 4REFA 5ETHA 3UUDA 1GWXA 4ZNUA 2Q8SA 2ZNQA 3GZ9A 4WPFA 3EYBA 4F9MA 3AFRA 4ZOMA 2HB7A 2Q7KA 3W5TA 5DX3B 2BAWA 3OMOA 2HB8A 3CS8A 5DWIA 1RKGA 5KR9A 1XIUA 3OMKA 4PLEA 3HQ5A 3PCUA 4M8HA 4PVUA 5AVLA 1FM9A 3VTBA 1NHZA 2ZK1A 3UU7A 2ZBSA 4IQRA 5DP0A 3L1BA 1Y0XX 2QR9A 4IA1A 2OAXA 2Q5GA 3GYUA 4UDDA 3IMYA 3UVVA 3OMMA 3OSWA 4KZJA 4ITFA 3W0CA 4Q50A 2HARA 3F5CA 3K6PA 5DL4A 2I4PA 3B0RA 3WWRA 4MGBA 3CTBA 4OZRE 3AUNA 1Z5XU 3V9YA 1MV9A 3A3ZX 3ADUA 4TV1A 3UUAA 1XV9A 1UPVA 1ZH7A 1UPWA 4REEA 1T5ZA 5DV8A 4CSJA 3B0QA 3B1MA 3Q95B 3OOFA 3SP9A 2P7GA 1YOWA 3W0YA 2AM9A 4ITEA 5C4SA 3TY0A 3L0EA 1M7WA 1DB1A 4PRGA 5DXRA 2GP7A 5G42A 2AWHA 3WFGA 1HJ1A 2GPVA 2ACLA 4OHAA 1EXAA 2QTUA 4L96A 4JAZA 4MDDA 1NAXA 3QT0A 3D24A 5E0XA 3OSIA 3DT3A 4UDAA 1XOWA 4PP6A 1XDKB 1YUCA 3VT3A 4ZJRA 3KWYA 5DY8A 2YJDA 4OFUA 4XUHA 5FQPA 2OZ7A 5KCWA 2PIUA 2W8YA 3B0TA 3B68A 4N8RA 5K13A 5DWJA 5FQTA 3CQVA 1RJKA 4QK4A 2QPYA 3RY9A 4OILA 2AA5A 1OVLB 2AAXA 2ZK4A 2B23A 4XHDA 4TUZB 2AX6A 1SQNA 3HZFA 3O1EA 5HJPB 1FD0A 2PIPL 4K6IA 2NXXE 1I38A 2AX9A 3CLDA 3FEIA 3NSQA 2ZLAA 3VN2A 3WFFA 3W5PA 4ZNTA 5KCEA 4R6SA 5DU5A 4MGBB 4P6XA 4MG9A 1T76A 2NW4A 2FVJA 3OLFA 3VHVA 3M7RA 5GIDA 5F9BA 3UUAB 3W0HA 2QMVA 4WHFA 3E00D 3D6DA 4UDCA 5G44A 1RK3A 4IW8A 2G5OA 4L98A 4MGDA 1GWQA 3FUGA 1T7FA 3VT5A 3ET2A 3SZ1A 3UP3A 5JJMA 1ILGA 2PIRA 1R20D 3A9EA 1RDTA 3W0JA 1S9PA 1IE9A 2XYXA 4RFWA 5AYGA 2HFPA 2Q61A 5DXPA 3TKMA 2OVMA 3KMZA 4PPPA 1K7LA 2G44A 4RAKA 2OVHA 4YPQA 2A3IA 1EXXA 4OEZA 4Q0AC 1QKTA 2Q6RA 2ZXZA 3B5RA 5GIEA 5H1EA 4G1DA 1XVPA 1FBYA 4J5XA 3VHWA 2YHDA 5L7EA 3FALA 1P93A 3HLVA 1P8DA 3L0LA 3VJTA 1WM0X 2ZASA 2GPOA 4PP5A 5DUHA 4YT1A 5KRAA 1K74A 4S14A 1XLSE 2EWPA 2YLPA 3V49A 3VT6A 2JFAB 3FXVA 1ZKYA 3B66A 1DKFB 1ZUCA 3VJIA 5KRIA 2PIWA 4NY9A 2VV1B 1XQ3A 3VTCA 3WT5A 4PLDA 3AN4A 2V7CA 3OS8C 3KBAA 5C4TA 3CJWA 4LTWA 4DQMA 3DR1A 5KCTA 1YP0A 1Z5XE 1PZLA 5AAVB 1XJ7A 2Q5SA 3KPZA 2AA7A 5KCCA 5ICKA 4J24A 5APKA 2XKWA 4MG8B 2QGWA 4DM6A 3PO9A 2P15A 3H0AA 5SYZA 4WQPA 3F7DA 5KCFA 4MG9B 4OC7A 1R6GA 4LBDA 3JZCA 4X1FA 2YATA 5KRHA 2V0VA 5KYJA 4DORA 4DK8A 5KRMA 2HBHA 3GYTA 4PP3A 1YMTA 5DIGA 4ZO1B 2POGA 4OEDA 3OOKA 2I4ZA 5AZTA 4IA3A 1ZAFA 3KMRA 5AAUA 1Z95A 3A9EB 3ZRAA 2QA8B 5JY3A 2YLOA 3AZ3A 2HAMA 2R40A 3PEQA 1M13A 3FC6A 2QZOB 1L2IA 2Q70A 3OLLA 5DIEA 3P88A 1FM6A 2AO6A 1ZGYA 4IWFA 3VJSA 2GIUA 4RUPA 2FSZA 3N00A 3IXPD 4N5GA 5DWGA 1OSHA 2IOGA 5KRLA 2QXSA 1N83A 4J5WC 3AURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2N A;  5DKG A;  2AA6 A;  3VT4 A;  1UOM A;  3A40 X;  4G1Y A;  2GPU A;  2OUZ A;  1M2Z A;  3A2I A;  5B5B A;  1YOK A;  3CWD A;  1NQ1 A;  3L03 A;  3WT6 A;  3UP0 A;  4OKX A;  1UHL B;  2H77 A;  4MG7 B;  5E14 A;  2Q59 B;  4B7W A;  3KDU A;  5DXB B;  1FCX A;  3R5M A;  2PIT A;  5AZV A;  4OIV A;  4A2J A;  4K4J A;  3AUQ A;  3ILZ A;  5G5W A;  4ZN7 A;  5DUE A;  2Q7I A;  2PIV A;  4OZT E;  2LBD A;  5FQV A;  2GTK A;  1XPC A;  1YIN A;  3V3E A;  3ZQT A;  3KYT A;  2AMB A;  3R8D A;  5DRM A;  3VRV A;  2QGT A;  4JL4 A;  2Q7J A;  2BJ4 B;  3ERD A;  4RUO X;  1T7R A;  3TKC A;  5G3J A;  3ET3 A;  5DVS A;  1X78 A;  3T03 A;  3UUD B;  1VJB A;  3BC5 A;  4DM8 A;  4PPS A;  2R40 D;  5JI0 D;  3VSO A;  1PQC A;  2ZNO A;  5EC9 A;  2HCD A;  4ZO1 X;  1A52 A;  1E3K A;  2ZY0 A;  4A4V A;  4G2I A;  5DVV A;  3JZB A;  3VRT A;  2XYW A;  5E15 A;  2P54 A;  5AVI A;  5G46 A;  3RUU A;  1FM9 D;  5DK9 A;  4DMA A;  4ZN9 A;  3UU7 B;  3R29 A;  1GWR A;  3E7C A;  2G0H A;  3X36 A;  3RLL A;  2R6Y A;  1H9U A;  4G20 A;  2YJA B;  4IWC A;  3B65 A;  4OKB A;  2QXM A;  3UVV B;  3BQD A;  1NQ7 A;  5CJ6 A;  2AYR A;  3ET1 A;  1XNX A;  3F5C B;  1YJE A;  2HWQ A;  2PIN A;  2YLQ A;  5DV3 A;  2O4J A;  3WJ5 A;  4JGV A;  5DKB A;  4FGY A;  1G50 A;  3B0W A;  1R1K A;  5KCU A;  2Q7L A;  4N1Y A;  4N73 A;  1I7I A;  4TV1 B;  1OT7 A;  1XV9 B;  1MVC A;  4OK1 A;  4OFR A;  4E4Q A;  2HWR A;  4MGA A;  4RMD A;  3ADW A;  4MGC A;  5HJS A;  2Q5P A;  1NUO A;  2AXA A;  4OEY A;  4IV4 A;  3WTQ A;  4HEE X;  1Y9R A;  2QH6 A;  5L7H A;  3FS1 A;  2GPP A;  1PRG A;  4G2H A;  2QNV A;  4OZR U;  5DXM A;  1QKM A;  2AB2 A;  4FHH A;  2ABI A;  4QM0 A;  3KFC A;  3W0I A;  1GS4 A;  5I4V A;  5M96 A;  2VV4 A;  2ACL B;  2NV7 A;  2P1U A;  5DZ3 A;  1ZDT A;  4OLM A;  2VSR A;  4JYH A;  1X7E A;  5G45 A;  3VHU A;  5C4O A;  2AA2 A;  4OJB A;  3V9V A;  5GT4 A;  1XP9 A;  1ZEO A;  3D90 A;  5E0W A;  4S0T A;  2J4A A;  2PNU A;  4ZI1 A;  2PRG A;  1U9E A;  2JJ3 A;  4DK7 A;  4PF3 A;  3UUC A;  2ZL9 A;  4IA2 A;  4LNW A;  3R8A A;  3VRW A;  5DXG A;  5HZC A;  2O4R A;  1YA3 A;  3FEJ A;  1T74 A;  2ZNP A;  3B67 A;  3DZU A;  3V4A A;  1HG4 A;  1N4H A;  5DX3 A;  3GWS X;  3MNP A;  3OMP A;  4PWL A;  3GWX A;  3OS9 A;  4RUJ A;  5DLR A;  2P4Y A;  4ZJW A;  4NIE A;  3A78 A;  3ZRB A;  4IVY A;  3OAP A;  2REW A;  2ZK0 A;  5E1C A;  2I0J A;  1R1K D;  2AMA A;  1L2J A;  4OH6 A;  5E19 A;  3E94 A;  3G8O A;  4XUM A;  1ILH A;  3O1D A;  5DKS A;  5L11 A;  3IPU A;  5KYA A;  2Z4B A;  5DVC A;  2NPA A;  4MG6 A;  5FQR A;  4MGD B;  1K4W A;  1X7R A;  1Y0S A;  2J7Y A;  3D57 A;  1T7M A;  5A86 A;  1RDT D;  3VI8 A;  5DZ1 A;  1XNN A;  4QL8 A;  4RE8 A;  5DXE A;  5EJV A;  4Q13 A;  4NB6 A;  3P8X A;  4FHI A;  5IZ0 A;  1PDU A;  1TFC A;  2PIO A;  3A2J A;  1SKX A;  3SP6 A;  2J14 A;  3VT8 A;  4LSJ A;  4CI5 A;  5AWK A;  2P7Z A;  3X31 A;  1XP1 A;  1LBD A;  2I0G A;  1XVP B;  2AX8 A;  1G1U A;  4RME A;  3PLZ A;  3FAL B;  2Q6J A;  1BSX A;  1T73 A;  3CDP A;  2QA6 A;  1K74 D;  3AX8 A;  4IS8 A;  4OJ4 A;  4POH A;  2E2R A;  3WGP A;  1T65 A;  1T7T A;  3RVF A;  5KD9 A;  1XDK A;  2OM9 A;  4ONI A;  4YNK A;  4EMA A;  5B41 A;  3AN3 A;  2XHS A;  3ADV A;  3W0G A;  3OKH A;  3ADX A;  5DWL A;  3OMQ A;  1S0Z A;  3DZU D;  4ZNV A;  4OGH A;  5GIC A;  4FNE A;  3L0J A;  4OJ9 A;  1S0X A;  5APH A;  4ZNS A;  5DXK A;  1NQ2 A;  2QSE A;  5KRK A;  4IUI A;  2QE4 A;  4R06 A;  1NQ0 A;  5AK2 A;  4RZG A;  2XYJ A;  3LBD A;  4MG5 A;  1OVL A;  2I4J A;  2Q1H A;  2VV2 A;  3P89 A;  2P7A A;  2YFE A;  3H52 A;  4IU7 A;  4P6W A;  4TUZ A;  5EGV A;  3ERT A;  5DRJ A;  5DWE A;  3H0A D;  1FCZ A;  2GL8 A;  4QJR A;  4Y29 A;  1FCY A;  4XLD A;  4POJ A;  5HJP A;  1T63 A;  4APU A;  3GN8 A;  2G0G A;  3X1I A;  5C4U A;  2ZNN A;  3NOA A;  3ZR7 A;  2JF9 A;  4G1Z A;  3HOD A;  5KRF A;  1Q4X A;  1U3Q A;  1XB7 A;  1N46 A;  5AWJ A;  2ZXN A;  4E4K A;  1A28 A;  1NYX A;  3AZ1 A;  4G21 A;  5HYR A;  3E00 A;  4E2J A;  1I7G A;  1RKH A;  4NUF A;  3VT7 A;  2OCF A;  3FC6 B;  4RZE A;  4RWV A;  1FM6 D;  2B1Z A;  1U3R A;  4LNX A;  1X7J A;  3VSP A;  4OH5 A;  3DCT A;  1I37 A;  1R20 A;  2H79 A;  1QKU A;  2ATH A;  3HVL A;  5EI1 A;  4NQA B;  2FAI A;  4KZI A;  3OZJ A;  2QAB A;  3OZ0 A;  3U9Q A;  4YMQ A;  5LGA A;  3G9E A;  3HO0 A;  5DTV A;  1YYE A;  5G43 A;  3PRG A;  4BCR A;  1XP6 A;  2ZLC A;  5DMF A;  4JYI A;  3HC6 A;  3VJH A;  1U3S A;  2R6W A;  2POB A;  5DKE A;  5DZI A;  5EHJ A;  2NXX A;  2PJL A;  2ZK6 A;  3OLS A;  3RUT A;  3HC5 A;  4O8F A;  4OKT A;  2ZK5 A;  5DYB A;  2Z4J A;  1T79 A;  3ADS A;  2JFA A;  2O9I A;  1NAV A;  4ZNH A;  1DKF A;  1KNU A;  3L3X A;  3VTD A;  4J26 A;  1XAP A;  4OAR A;  2VV1 A;  3KDT A;  2GWX A;  3G8I A;  2ZK2 A;  4K7A A;  3GBK A;  3FLI A;  4XI3 A;  3ADT A;  1ERR A;  3IPQ A;  3V3Q A;  2VV0 A;  1IE8 A;  2HVC A;  3VRU A;  5HYK A;  1YIM A;  3DZY A;  1PQ6 A;  2ZFX A;  2ZMI A;  3CS6 A;  3OS8 A;  4X1G A;  5AAV A;  1PCG A;  5DID A;  2IOK A;  3MNE A;  1LV2 A;  4MG8 A;  2P1V A;  2PIQ A;  3VT9 A;  3IPS A;  1PQ9 A;  3OKI A;  3CS4 A;  5HCV A;  1MZN A;  1KV6 A;  2YLY A;  2IHQ A;  2ZMH A;  2ZK3 A;  3B3K A;  2P1T A;  3BEJ A;  4OIU A;  2Q60 A;  2Q6S A;  5E7V A;  3TX7 B;  3CDS A;  3W0A A;  1OSV A;  3WT7 A;  5LWP A;  3NSP A;  3P0U A;  1SJ0 A;  4QE8 A;  5KRO A;  3MNO A;  1TXI A;  4OZT U;  3DCU A;  4CI4 A;  3S9S A;  3WMH A;  1XLS A;  3DY6 A;  4IW6 A;  2QA8 A;  5DYD A;  2PKL A;  3R8I A;  5DZH A;  1SR7 A;  5KRJ A;  2QZO A;  2VV3 A;  3GD2 A;  5ACC A;  4XAO A;  1S19 A;  2ZXM A;  4EM9 A;  1ERE A;  1XQC A;  5DV6 A;  5APJ A;  5IXK A;  3ET0 A;  3D5F A;  2ZMJ A;  3W5Q A;  2ZKC A;  4JYG A;  4S15 A;  4XTA A;  3K8S A;  5DSH A;  4RZF A;  3IXP A;  3HM1 A;  2F4B A;  4IVW A;  2Q3Y A;  4S0S A;  3X1H A;  3A2H A;  5DZ0 A;  5KRC A;  1YY4 A;  3L3Z A;  4R2U A;  4WHG A;  4ZNW A;  3OSA A;  2VST A;  3G0W A;  5FQS A;  5DMC A;  2B50 A;  2AX7 A;  4OKW A;  4J5W A;  5L7G A;  2HC4 A;  1X7B A;  3R2A A;  1XZX X;  4FN9 A;  4IA7 A;  4MGA B;  3WJ4 A;  3KMG A;  4HLW A;  1KKQ A;  1UHL A;  3PBA A;  1R5K A;  1S9Q A;  2Q59 A;  4MG7 A;  4DOS A;  5IAW A;  5KCD A;  4PXM A;  4UDB A;  5DXB A;  3DZY D;  4KZM A;  1PK5 A;  3RLJ A;  2B1V A;  2PIX A;  4A4W A;  5DI7 A;  1X76 A;  4OEA A;  3K23 A;  5JJM B;  4WVD A;  2Q1V A;  1NDE A;  3Q95 A;  2VV4 B;  4J5X C;  1NRL A;  2QW4 A;  1E3G A;  3K22 A;  5DXQ A;  1ZDU A;  3V9T A;  3FUR A;  4M8E A;  5EIT A;  4QE6 A;  1QKN A;  2HAS A;  3IA6 A;  4RMC A;  3W5R A;  2ZVT A;  2J7X A;  4IV2 A;  2BJ4 A;  4WLB A;  4XT9 A;  5DUG A;  3OGT A;  3AZ2 A;  3R5N A;  1G5Y A;  3LMP A;  4REF A;  5ETH A;  3UUD A;  1GWX A;  4ZNU A;  2Q8S A;  2ZNQ A;  3GZ9 A;  4WPF A;  3EYB A;  4F9M A;  3AFR A;  4ZOM A;  2HB7 A;  2Q7K A;  3W5T A;  5DX3 B;  2BAW A;  3OMO A;  2HB8 A;  3CS8 A;  5DWI A;  1RKG A;  5KR9 A;  1XIU A;  3OMK A;  4PLE A;  3HQ5 A;  3PCU A;  4M8H A;  4PVU A;  5AVL A;  1FM9 A;  3VTB A;  1NHZ A;  2ZK1 A;  3UU7 A;  2ZBS A;  4IQR A;  5DP0 A;  3L1B A;  1Y0X X;  2QR9 A;  4IA1 A;  2OAX A;  2Q5G A;  3GYU A;  4UDD A;  3IMY A;  3UVV A;  3OMM A;  3OSW A;  4KZJ A;  4ITF A;  3W0C A;  4Q50 A;  2HAR A;  3F5C A;  3K6P A;  5DL4 A;  2I4P A;  3B0R A;  3WWR A;  4MGB A;  3CTB A;  4OZR E;  3AUN A;  1Z5X U;  3V9Y A;  1MV9 A;  3A3Z X;  3ADU A;  4TV1 A;  3UUA A;  1XV9 A;  1UPV A;  1ZH7 A;  1UPW A;  4REE A;  1T5Z A;  5DV8 A;  4CSJ A;  3B0Q A;  3B1M A;  3Q95 B;  3OOF A;  3SP9 A;  2P7G A;  1YOW A;  3W0Y A;  2AM9 A;  4ITE A;  5C4S A;  3TY0 A;  3L0E A;  1M7W A;  1DB1 A;  4PRG A;  5DXR A;  2GP7 A;  5G42 A;  2AWH A;  3WFG A;  1HJ1 A;  2GPV A;  2ACL A;  4OHA A;  1EXA A;  2QTU A;  4L96 A;  4JAZ A;  4MDD A;  1NAX A;  3QT0 A;  3D24 A;  5E0X A;  3OSI A;  3DT3 A;  4UDA A;  1XOW A;  4PP6 A;  1XDK B;  1YUC A;  3VT3 A;  4ZJR A;  3KWY A;  5DY8 A;  2YJD A;  4OFU A;  4XUH A;  5FQP A;  2OZ7 A;  5KCW A;  2PIU A;  2W8Y A;  3B0T A;  3B68 A;  4N8R A;  5K13 A;  5DWJ A;  5FQT A;  3CQV A;  1RJK A;  4QK4 A;  2QPY A;  3RY9 A;  4OIL A;  2AA5 A;  1OVL B;  2AAX A;  2ZK4 A;  2B23 A;  4XHD A;  4TUZ B;  2AX6 A;  1SQN A;  3HZF A;  3O1E A;  5HJP B;  1FD0 A;  2PIP L;  4K6I A;  2NXX E;  1I38 A;  2AX9 A;  3CLD A;  3FEI A;  3NSQ A;  2ZLA A;  3VN2 A;  3WFF A;  3W5P A;  4ZNT A;  5KCE A;  4R6S A;  5DU5 A;  4MGB B;  4P6X A;  4MG9 A;  1T76 A;  2NW4 A;  2FVJ A;  3OLF A;  3VHV A;  3M7R A;  5GID A;  5F9B A;  3UUA B;  3W0H A;  2QMV A;  4WHF A;  3E00 D;  3D6D A;  4UDC A;  5G44 A;  1RK3 A;  4IW8 A;  2G5O A;  4L98 A;  4MGD A;  1GWQ A;  3FUG A;  1T7F A;  3VT5 A;  3ET2 A;  3SZ1 A;  3UP3 A;  5JJM A;  1ILG A;  2PIR A;  1R20 D;  3A9E A;  1RDT A;  3W0J A;  1S9P A;  1IE9 A;  2XYX A;  4RFW A;  5AYG A;  2HFP A;  2Q61 A;  5DXP A;  3TKM A;  2OVM A;  3KMZ A;  4PPP A;  1K7L A;  2G44 A;  4RAK A;  2OVH A;  4YPQ A;  2A3I A;  1EXX A;  4OEZ A;  4Q0A C;  1QKT A;  2Q6R A;  2ZXZ A;  3B5R A;  5GIE A;  5H1E A;  4G1D A;  1XVP A;  1FBY A;  4J5X A;  3VHW A;  2YHD A;  5L7E A;  3FAL A;  1P93 A;  3HLV A;  1P8D A;  3L0L A;  3VJT A;  1WM0 X;  2ZAS A;  2GPO A;  4PP5 A;  5DUH A;  4YT1 A;  5KRA A;  1K74 A;  4S14 A;  1XLS E;  2EWP A;  2YLP A;  3V49 A;  3VT6 A;  2JFA B;  3FXV A;  1ZKY A;  3B66 A;  1DKF B;  1ZUC A;  3VJI A;  5KRI A;  2PIW A;  4NY9 A;  2VV1 B;  1XQ3 A;  3VTC A;  3WT5 A;  4PLD A;  3AN4 A;  2V7C A;  3OS8 C;  3KBA A;  5C4T A;  3CJW A;  4LTW A;  4DQM A;  3DR1 A;  5KCT A;  1YP0 A;  1Z5X E;  1PZL A;  5AAV B;  1XJ7 A;  2Q5S A;  3KPZ A;  2AA7 A;  5KCC A;  5ICK A;  4J24 A;  5APK A;  2XKW A;  4MG8 B;  2QGW A;  4DM6 A;  3PO9 A;  2P15 A;  3H0A A;  5SYZ A;  4WQP A;  3F7D A;  5KCF A;  4MG9 B;  4OC7 A;  1R6G A;  4LBD A;  3JZC A;  4X1F A;  2YAT A;  5KRH A;  2V0V A;  5KYJ A;  4DOR A;  4DK8 A;  5KRM A;  2HBH A;  3GYT A;  4PP3 A;  1YMT A;  5DIG A;  4ZO1 B;  2POG A;  4OED A;  3OOK A;  2I4Z A;  5AZT A;  4IA3 A;  1ZAF A;  3KMR A;  5AAU A;  1Z95 A;  3A9E B;  3ZRA A;  2QA8 B;  5JY3 A;  2YLO A;  3AZ3 A;  2HAM A;  2R40 A;  3PEQ A;  1M13 A;  3FC6 A;  2QZO B;  1L2I A;  2Q70 A;  3OLL A;  5DIE A;  3P88 A;  1FM6 A;  2AO6 A;  1ZGY A;  4IWF A;  3VJS A;  2GIU A;  4RUP A;  2FSZ A;  3N00 A;  3IXP D;  4N5G A;  5DWG A;  1OSH A;  2IOG A;  5KRL A;  2QXS A;  1N83 A;  4J5W C;  3AUR A; 
#chains in the Genus database with same CATH topology
 1G2N A;  5DKG A;  2AA6 A;  3VT4 A;  1UOM A;  3A40 X;  4G1Y A;  2GPU A;  2OUZ A;  1M2Z A;  3A2I A;  5B5B A;  1YOK A;  3CWD A;  1NQ1 A;  3L03 A;  3WT6 A;  3UP0 A;  4OKX A;  1UHL B;  2H77 A;  4MG7 B;  5E14 A;  2Q59 B;  4B7W A;  3KDU A;  5DXB B;  1FCX A;  3R5M A;  2PIT A;  5AZV A;  4OIV A;  4A2J A;  4K4J A;  3AUQ A;  3ILZ A;  5G5W A;  4ZN7 A;  5DUE A;  2Q7I A;  2PIV A;  4OZT E;  2LBD A;  5FQV A;  2GTK A;  1XPC A;  1YIN A;  3V3E A;  3ZQT A;  3KYT A;  2AMB A;  3R8D A;  5DRM A;  3VRV A;  2QGT A;  4JL4 A;  2Q7J A;  2BJ4 B;  3ERD A;  4RUO X;  1T7R A;  3TKC A;  5G3J A;  3ET3 A;  5DVS A;  1X78 A;  3T03 A;  3UUD B;  1VJB A;  3BC5 A;  4DM8 A;  4PPS A;  2R40 D;  5JI0 D;  3VSO A;  1PQC A;  2ZNO A;  5EC9 A;  2HCD A;  4ZO1 X;  1A52 A;  1E3K A;  2ZY0 A;  4A4V A;  4G2I A;  5DVV A;  3JZB A;  3VRT A;  2XYW A;  5E15 A;  2P54 A;  5AVI A;  5G46 A;  3RUU A;  1FM9 D;  5DK9 A;  4DMA A;  4ZN9 A;  3UU7 B;  3R29 A;  1GWR A;  3E7C A;  2G0H A;  3X36 A;  3RLL A;  2R6Y A;  1H9U A;  4G20 A;  2YJA B;  4IWC A;  3B65 A;  4OKB A;  2QXM A;  3UVV B;  3BQD A;  1NQ7 A;  5CJ6 A;  2AYR A;  3ET1 A;  1XNX A;  3F5C B;  1YJE A;  2HWQ A;  2PIN A;  2YLQ A;  5DV3 A;  2O4J A;  3WJ5 A;  4JGV A;  5DKB A;  4FGY A;  1G50 A;  3B0W A;  1R1K A;  5KCU A;  2Q7L A;  4N1Y A;  4N73 A;  1I7I A;  4TV1 B;  1OT7 A;  1XV9 B;  1MVC A;  4OK1 A;  4OFR A;  4E4Q A;  2HWR A;  4MGA A;  4RMD A;  3ADW A;  4MGC A;  5HJS A;  2Q5P A;  1NUO A;  2AXA A;  4OEY A;  4IV4 A;  3WTQ A;  4HEE X;  1Y9R A;  2QH6 A;  5L7H A;  3FS1 A;  2GPP A;  1PRG A;  4G2H A;  2QNV A;  4OZR U;  5DXM A;  1QKM A;  2AB2 A;  4FHH A;  2ABI A;  4QM0 A;  3KFC A;  3W0I A;  1GS4 A;  5I4V A;  5M96 A;  2VV4 A;  2ACL B;  2NV7 A;  2P1U A;  5DZ3 A;  1ZDT A;  4OLM A;  2VSR A;  4JYH A;  1X7E A;  5G45 A;  3VHU A;  5C4O A;  2AA2 A;  4OJB A;  3V9V A;  5GT4 A;  1XP9 A;  1ZEO A;  3D90 A;  5E0W A;  4S0T A;  2J4A A;  2PNU A;  4ZI1 A;  2PRG A;  1U9E A;  2JJ3 A;  4DK7 A;  4PF3 A;  3UUC A;  2ZL9 A;  4IA2 A;  4LNW A;  3R8A A;  3VRW A;  5DXG A;  5HZC A;  2O4R A;  1YA3 A;  3FEJ A;  1T74 A;  2ZNP A;  3B67 A;  3DZU A;  3V4A A;  1HG4 A;  1N4H A;  5DX3 A;  3GWS X;  3MNP A;  3OMP A;  4PWL A;  3GWX A;  3OS9 A;  4RUJ A;  5DLR A;  2P4Y A;  4ZJW A;  4NIE A;  3A78 A;  3ZRB A;  4IVY A;  3OAP A;  2REW A;  2ZK0 A;  5E1C A;  2I0J A;  1R1K D;  2AMA A;  1L2J A;  4OH6 A;  5E19 A;  3E94 A;  3G8O A;  4XUM A;  1ILH A;  3O1D A;  5DKS A;  5L11 A;  3IPU A;  5KYA A;  2Z4B A;  5DVC A;  2NPA A;  4MG6 A;  5FQR A;  4MGD B;  1K4W A;  1X7R A;  1Y0S A;  2J7Y A;  3D57 A;  1T7M A;  5A86 A;  1RDT D;  3VI8 A;  5DZ1 A;  1XNN A;  4QL8 A;  4RE8 A;  5DXE A;  5EJV A;  4Q13 A;  4NB6 A;  3P8X A;  4FHI A;  5IZ0 A;  1PDU A;  1TFC A;  2PIO A;  3A2J A;  1SKX A;  3SP6 A;  2J14 A;  3VT8 A;  4LSJ A;  4CI5 A;  5AWK A;  2P7Z A;  3X31 A;  1XP1 A;  1LBD A;  2I0G A;  1XVP B;  2AX8 A;  1G1U A;  4RME A;  3PLZ A;  3FAL B;  2Q6J A;  1BSX A;  1T73 A;  3CDP A;  2QA6 A;  1K74 D;  3AX8 A;  4IS8 A;  4OJ4 A;  4POH A;  2E2R A;  3WGP A;  1T65 A;  1T7T A;  3RVF A;  5KD9 A;  1XDK A;  2OM9 A;  4ONI A;  4YNK A;  4EMA A;  5B41 A;  3AN3 A;  2XHS A;  3ADV A;  3W0G A;  3OKH A;  3ADX A;  5DWL A;  3OMQ A;  1S0Z A;  3DZU D;  4ZNV A;  4OGH A;  5GIC A;  4FNE A;  3L0J A;  4OJ9 A;  1S0X A;  5APH A;  4ZNS A;  5DXK A;  1NQ2 A;  2QSE A;  5KRK A;  4IUI A;  2QE4 A;  4R06 A;  1NQ0 A;  5AK2 A;  4RZG A;  2XYJ A;  3LBD A;  4MG5 A;  1OVL A;  2I4J A;  2Q1H A;  2VV2 A;  3P89 A;  2P7A A;  2YFE A;  3H52 A;  4IU7 A;  4P6W A;  4TUZ A;  5EGV A;  3ERT A;  5DRJ A;  5DWE A;  3H0A D;  1FCZ A;  2GL8 A;  4QJR A;  4Y29 A;  1FCY A;  4XLD A;  4POJ A;  5HJP A;  1T63 A;  4APU A;  3GN8 A;  2G0G A;  3X1I A;  5C4U A;  2ZNN A;  3NOA A;  3ZR7 A;  2JF9 A;  4G1Z A;  3HOD A;  5KRF A;  1Q4X A;  1U3Q A;  1XB7 A;  1N46 A;  5AWJ A;  2ZXN A;  4E4K A;  1A28 A;  1NYX A;  3AZ1 A;  4G21 A;  5HYR A;  3E00 A;  4E2J A;  1I7G A;  1RKH A;  4NUF A;  3VT7 A;  2OCF A;  3FC6 B;  4RZE A;  4RWV A;  1FM6 D;  2B1Z A;  1U3R A;  4LNX A;  1X7J A;  3VSP A;  4OH5 A;  3DCT A;  1I37 A;  1R20 A;  2H79 A;  1QKU A;  2ATH A;  3HVL A;  5EI1 A;  4NQA B;  2FAI A;  4KZI A;  3OZJ A;  2QAB A;  3OZ0 A;  3U9Q A;  4YMQ A;  5LGA A;  3G9E A;  3HO0 A;  5DTV A;  1YYE A;  5G43 A;  3PRG A;  4BCR A;  1XP6 A;  2ZLC A;  5DMF A;  4JYI A;  3HC6 A;  3VJH A;  1U3S A;  2R6W A;  2POB A;  5DKE A;  5DZI A;  5EHJ A;  2NXX A;  2PJL A;  2ZK6 A;  3OLS A;  3RUT A;  3HC5 A;  4O8F A;  4OKT A;  2ZK5 A;  5DYB A;  2Z4J A;  1T79 A;  3ADS A;  2JFA A;  2O9I A;  1NAV A;  4ZNH A;  1DKF A;  1KNU A;  3L3X A;  3VTD A;  4J26 A;  1XAP A;  4OAR A;  2VV1 A;  3KDT A;  2GWX A;  3G8I A;  2ZK2 A;  4K7A A;  3GBK A;  3FLI A;  4XI3 A;  3ADT A;  1ERR A;  3IPQ A;  3V3Q A;  2VV0 A;  1IE8 A;  2HVC A;  3VRU A;  5HYK A;  1YIM A;  3DZY A;  1PQ6 A;  2ZFX A;  2ZMI A;  3CS6 A;  3OS8 A;  4X1G A;  5AAV A;  1PCG A;  5DID A;  2IOK A;  3MNE A;  1LV2 A;  4MG8 A;  2P1V A;  2PIQ A;  3VT9 A;  3IPS A;  1PQ9 A;  3OKI A;  3CS4 A;  5HCV A;  1MZN A;  1KV6 A;  2YLY A;  2IHQ A;  2ZMH A;  2ZK3 A;  3B3K A;  2P1T A;  3BEJ A;  4OIU A;  2Q60 A;  2Q6S A;  5E7V A;  3TX7 B;  3CDS A;  3W0A A;  1OSV A;  3WT7 A;  5LWP A;  3NSP A;  3P0U A;  1SJ0 A;  4QE8 A;  5KRO A;  3MNO A;  1TXI A;  4OZT U;  3DCU A;  4CI4 A;  3S9S A;  3WMH A;  1XLS A;  3DY6 A;  4IW6 A;  2QA8 A;  5DYD A;  2PKL A;  3R8I A;  5DZH A;  1SR7 A;  5KRJ A;  2QZO A;  2VV3 A;  3GD2 A;  5ACC A;  4XAO A;  1S19 A;  2ZXM A;  4EM9 A;  1ERE A;  1XQC A;  5DV6 A;  5APJ A;  5IXK A;  3ET0 A;  3D5F A;  2ZMJ A;  3W5Q A;  2ZKC A;  4JYG A;  4S15 A;  4XTA A;  3K8S A;  5DSH A;  4RZF A;  3IXP A;  3HM1 A;  2F4B A;  4IVW A;  2Q3Y A;  4S0S A;  3X1H A;  3A2H A;  5DZ0 A;  5KRC A;  1YY4 A;  3L3Z A;  4R2U A;  4WHG A;  4ZNW A;  3OSA A;  2VST A;  3G0W A;  5FQS A;  5DMC A;  2B50 A;  2AX7 A;  4OKW A;  4J5W A;  5L7G A;  2HC4 A;  1X7B A;  3R2A A;  1XZX X;  4FN9 A;  4IA7 A;  4MGA B;  3WJ4 A;  3KMG A;  4HLW A;  1KKQ A;  1UHL A;  3PBA A;  1R5K A;  1S9Q A;  2Q59 A;  4MG7 A;  4DOS A;  5IAW A;  5KCD A;  4PXM A;  4UDB A;  5DXB A;  3DZY D;  4KZM A;  1PK5 A;  3RLJ A;  2B1V A;  2PIX A;  4A4W A;  5DI7 A;  1X76 A;  4OEA A;  3K23 A;  5JJM B;  4WVD A;  2Q1V A;  1NDE A;  3Q95 A;  2VV4 B;  4J5X C;  1NRL A;  2QW4 A;  1E3G A;  3K22 A;  5DXQ A;  1ZDU A;  3V9T A;  3FUR A;  4M8E A;  5EIT A;  4QE6 A;  1QKN A;  2HAS A;  3IA6 A;  4RMC A;  3W5R A;  2ZVT A;  2J7X A;  4IV2 A;  2BJ4 A;  4WLB A;  4XT9 A;  5DUG A;  3OGT A;  3AZ2 A;  3R5N A;  1G5Y A;  3LMP A;  4REF A;  5ETH A;  3UUD A;  1GWX A;  4ZNU A;  2Q8S A;  2ZNQ A;  3GZ9 A;  4WPF A;  3EYB A;  4F9M A;  3AFR A;  4ZOM A;  2HB7 A;  2Q7K A;  3W5T A;  5DX3 B;  2BAW A;  3OMO A;  2HB8 A;  3CS8 A;  5DWI A;  1RKG A;  5KR9 A;  1XIU A;  3OMK A;  4PLE A;  3HQ5 A;  3PCU A;  4M8H A;  4PVU A;  5AVL A;  1FM9 A;  3VTB A;  1NHZ A;  2ZK1 A;  3UU7 A;  2ZBS A;  4IQR A;  5DP0 A;  3L1B A;  1Y0X X;  2QR9 A;  4IA1 A;  2OAX A;  2Q5G A;  3GYU A;  4UDD A;  3IMY A;  3UVV A;  3OMM A;  3OSW A;  4KZJ A;  4ITF A;  3W0C A;  4Q50 A;  2HAR A;  3F5C A;  3K6P A;  5DL4 A;  2I4P A;  3B0R A;  3WWR A;  4MGB A;  3CTB A;  4OZR E;  3AUN A;  1Z5X U;  3V9Y A;  1MV9 A;  3A3Z X;  3ADU A;  4TV1 A;  3UUA A;  1XV9 A;  1UPV A;  1ZH7 A;  1UPW A;  4REE A;  1T5Z A;  5DV8 A;  4CSJ A;  3B0Q A;  3B1M A;  3Q95 B;  3OOF A;  3SP9 A;  2P7G A;  1YOW A;  3W0Y A;  2AM9 A;  4ITE A;  5C4S A;  3TY0 A;  3L0E A;  1M7W A;  1DB1 A;  4PRG A;  5DXR A;  2GP7 A;  5G42 A;  2AWH A;  3WFG A;  1HJ1 A;  2GPV A;  2ACL A;  4OHA A;  1EXA A;  2QTU A;  4L96 A;  4JAZ A;  4MDD A;  1NAX A;  3QT0 A;  3D24 A;  5E0X A;  3OSI A;  3DT3 A;  4UDA A;  1XOW A;  4PP6 A;  1XDK B;  1YUC A;  3VT3 A;  4ZJR A;  3KWY A;  5DY8 A;  2YJD A;  4OFU A;  4XUH A;  5FQP A;  2OZ7 A;  5KCW A;  2PIU A;  2W8Y A;  3B0T A;  3B68 A;  4N8R A;  5K13 A;  5DWJ A;  5FQT A;  3CQV A;  1RJK A;  4QK4 A;  2QPY A;  3RY9 A;  4OIL A;  2AA5 A;  1OVL B;  2AAX A;  2ZK4 A;  2B23 A;  4XHD A;  4TUZ B;  2AX6 A;  1SQN A;  3HZF A;  3O1E A;  5HJP B;  1FD0 A;  2PIP L;  4K6I A;  2NXX E;  1I38 A;  2AX9 A;  3CLD A;  3FEI A;  3NSQ A;  2ZLA A;  3VN2 A;  3WFF A;  3W5P A;  4ZNT A;  5KCE A;  4R6S A;  5DU5 A;  4MGB B;  4P6X A;  4MG9 A;  1T76 A;  2NW4 A;  2FVJ A;  3OLF A;  3VHV A;  3M7R A;  5GID A;  5F9B A;  3UUA B;  3W0H A;  2QMV A;  4WHF A;  3E00 D;  3D6D A;  4UDC A;  5G44 A;  1RK3 A;  4IW8 A;  2G5O A;  4L98 A;  4MGD A;  1GWQ A;  3FUG A;  1T7F A;  3VT5 A;  3ET2 A;  3SZ1 A;  3UP3 A;  5JJM A;  1ILG A;  2PIR A;  1R20 D;  3A9E A;  1RDT A;  3W0J A;  1S9P A;  1IE9 A;  2XYX A;  4RFW A;  5AYG A;  2HFP A;  2Q61 A;  5DXP A;  3TKM A;  2OVM A;  3KMZ A;  4PPP A;  1K7L A;  2G44 A;  4RAK A;  2OVH A;  4YPQ A;  2A3I A;  1EXX A;  4OEZ A;  4Q0A C;  1QKT A;  2Q6R A;  2ZXZ A;  3B5R A;  5GIE A;  5H1E A;  4G1D A;  1XVP A;  1FBY A;  4J5X A;  3VHW A;  2YHD A;  5L7E A;  3FAL A;  1P93 A;  3HLV A;  1P8D A;  3L0L A;  3VJT A;  1WM0 X;  2ZAS A;  2GPO A;  4PP5 A;  5DUH A;  4YT1 A;  5KRA A;  1K74 A;  4S14 A;  1XLS E;  2EWP A;  2YLP A;  3V49 A;  3VT6 A;  2JFA B;  3FXV A;  1ZKY A;  3B66 A;  1DKF B;  1ZUC A;  3VJI A;  5KRI A;  2PIW A;  4NY9 A;  2VV1 B;  1XQ3 A;  3VTC A;  3WT5 A;  4PLD A;  3AN4 A;  2V7C A;  3OS8 C;  3KBA A;  5C4T A;  3CJW A;  4LTW A;  4DQM A;  3DR1 A;  5KCT A;  1YP0 A;  1Z5X E;  1PZL A;  5AAV B;  1XJ7 A;  2Q5S A;  3KPZ A;  2AA7 A;  5KCC A;  5ICK A;  4J24 A;  5APK A;  2XKW A;  4MG8 B;  2QGW A;  4DM6 A;  3PO9 A;  2P15 A;  3H0A A;  5SYZ A;  4WQP A;  3F7D A;  5KCF A;  4MG9 B;  4OC7 A;  1R6G A;  4LBD A;  3JZC A;  4X1F A;  2YAT A;  5KRH A;  2V0V A;  5KYJ A;  4DOR A;  4DK8 A;  5KRM A;  2HBH A;  3GYT A;  4PP3 A;  1YMT A;  5DIG A;  4ZO1 B;  2POG A;  4OED A;  3OOK A;  2I4Z A;  5AZT A;  4IA3 A;  1ZAF A;  3KMR A;  5AAU A;  1Z95 A;  3A9E B;  3ZRA A;  2QA8 B;  5JY3 A;  2YLO A;  3AZ3 A;  2HAM A;  2R40 A;  3PEQ A;  1M13 A;  3FC6 A;  2QZO B;  1L2I A;  2Q70 A;  3OLL A;  5DIE A;  3P88 A;  1FM6 A;  2AO6 A;  1ZGY A;  4IWF A;  3VJS A;  2GIU A;  4RUP A;  2FSZ A;  3N00 A;  3IXP D;  4N5G A;  5DWG A;  1OSH A;  2IOG A;  5KRL A;  2QXS A;  1N83 A;  4J5W C;  3AUR A; 
#chains in the Genus database with same CATH homology
 1G2N A;  5DKG A;  2AA6 A;  3VT4 A;  1UOM A;  3A40 X;  4G1Y A;  2GPU A;  2OUZ A;  1M2Z A;  3A2I A;  5B5B A;  1YOK A;  3CWD A;  1NQ1 A;  3L03 A;  3WT6 A;  3UP0 A;  4OKX A;  1UHL B;  2H77 A;  4MG7 B;  5E14 A;  2Q59 B;  4B7W A;  3KDU A;  5DXB B;  1FCX A;  3R5M A;  2PIT A;  5AZV A;  4OIV A;  4A2J A;  4K4J A;  3AUQ A;  3ILZ A;  5G5W A;  4ZN7 A;  5DUE A;  2Q7I A;  2PIV A;  4OZT E;  2LBD A;  5FQV A;  2GTK A;  1XPC A;  1YIN A;  3V3E A;  3ZQT A;  3KYT A;  2AMB A;  3R8D A;  5DRM A;  3VRV A;  2QGT A;  4JL4 A;  2Q7J A;  2BJ4 B;  3ERD A;  4RUO X;  1T7R A;  3TKC A;  5G3J A;  3ET3 A;  5DVS A;  1X78 A;  3T03 A;  3UUD B;  1VJB A;  3BC5 A;  4DM8 A;  4PPS A;  2R40 D;  5JI0 D;  3VSO A;  1PQC A;  2ZNO A;  5EC9 A;  2HCD A;  4ZO1 X;  1A52 A;  1E3K A;  2ZY0 A;  4A4V A;  4G2I A;  5DVV A;  3JZB A;  3VRT A;  2XYW A;  5E15 A;  2P54 A;  5AVI A;  5G46 A;  3RUU A;  1FM9 D;  5DK9 A;  4DMA A;  4ZN9 A;  3UU7 B;  3R29 A;  1GWR A;  3E7C A;  2G0H A;  3X36 A;  3RLL A;  2R6Y A;  1H9U A;  4G20 A;  2YJA B;  4IWC A;  3B65 A;  4OKB A;  2QXM A;  3UVV B;  3BQD A;  1NQ7 A;  5CJ6 A;  2AYR A;  3ET1 A;  1XNX A;  3F5C B;  1YJE A;  2HWQ A;  2PIN A;  2YLQ A;  5DV3 A;  2O4J A;  3WJ5 A;  4JGV A;  5DKB A;  4FGY A;  1G50 A;  3B0W A;  1R1K A;  5KCU A;  2Q7L A;  4N1Y A;  4N73 A;  1I7I A;  4TV1 B;  1OT7 A;  1XV9 B;  1MVC A;  4OK1 A;  4OFR A;  4E4Q A;  2HWR A;  4MGA A;  4RMD A;  3ADW A;  4MGC A;  5HJS A;  2Q5P A;  1NUO A;  2AXA A;  4OEY A;  4IV4 A;  3WTQ A;  4HEE X;  1Y9R A;  2QH6 A;  5L7H A;  3FS1 A;  2GPP A;  1PRG A;  4G2H A;  2QNV A;  4OZR U;  5DXM A;  1QKM A;  2AB2 A;  4FHH A;  2ABI A;  4QM0 A;  3KFC A;  3W0I A;  1GS4 A;  5I4V A;  5M96 A;  2VV4 A;  2ACL B;  2NV7 A;  2P1U A;  5DZ3 A;  1ZDT A;  4OLM A;  2VSR A;  4JYH A;  1X7E A;  5G45 A;  3VHU A;  5C4O A;  2AA2 A;  4OJB A;  3V9V A;  5GT4 A;  1XP9 A;  1ZEO A;  3D90 A;  5E0W A;  4S0T A;  2J4A A;  2PNU A;  4ZI1 A;  2PRG A;  1U9E A;  2JJ3 A;  4DK7 A;  4PF3 A;  3UUC A;  2ZL9 A;  4IA2 A;  4LNW A;  3R8A A;  3VRW A;  5DXG A;  5HZC A;  2O4R A;  1YA3 A;  3FEJ A;  1T74 A;  2ZNP A;  3B67 A;  3DZU A;  3V4A A;  1HG4 A;  1N4H A;  5DX3 A;  3GWS X;  3MNP A;  3OMP A;  4PWL A;  3GWX A;  3OS9 A;  4RUJ A;  5DLR A;  2P4Y A;  4ZJW A;  4NIE A;  3A78 A;  3ZRB A;  4IVY A;  3OAP A;  2REW A;  2ZK0 A;  5E1C A;  2I0J A;  1R1K D;  2AMA A;  1L2J A;  4OH6 A;  5E19 A;  3E94 A;  3G8O A;  4XUM A;  1ILH A;  3O1D A;  5DKS A;  5L11 A;  3IPU A;  5KYA A;  2Z4B A;  5DVC A;  2NPA A;  4MG6 A;  5FQR A;  4MGD B;  1K4W A;  1X7R A;  1Y0S A;  2J7Y A;  3D57 A;  1T7M A;  5A86 A;  1RDT D;  3VI8 A;  5DZ1 A;  1XNN A;  4QL8 A;  4RE8 A;  5DXE A;  5EJV A;  4Q13 A;  4NB6 A;  3P8X A;  4FHI A;  5IZ0 A;  1PDU A;  1TFC A;  2PIO A;  3A2J A;  1SKX A;  3SP6 A;  2J14 A;  3VT8 A;  4LSJ A;  4CI5 A;  5AWK A;  2P7Z A;  3X31 A;  1XP1 A;  1LBD A;  2I0G A;  1XVP B;  2AX8 A;  1G1U A;  4RME A;  3PLZ A;  3FAL B;  2Q6J A;  1BSX A;  1T73 A;  3CDP A;  2QA6 A;  1K74 D;  3AX8 A;  4IS8 A;  4OJ4 A;  4POH A;  2E2R A;  3WGP A;  1T65 A;  1T7T A;  3RVF A;  5KD9 A;  1XDK A;  2OM9 A;  4ONI A;  4YNK A;  4EMA A;  5B41 A;  3AN3 A;  2XHS A;  3ADV A;  3W0G A;  3OKH A;  3ADX A;  5DWL A;  3OMQ A;  1S0Z A;  3DZU D;  4ZNV A;  4OGH A;  5GIC A;  4FNE A;  3L0J A;  4OJ9 A;  1S0X A;  5APH A;  4ZNS A;  5DXK A;  1NQ2 A;  2QSE A;  5KRK A;  4IUI A;  2QE4 A;  4R06 A;  1NQ0 A;  5AK2 A;  4RZG A;  2XYJ A;  3LBD A;  4MG5 A;  1OVL A;  2I4J A;  2Q1H A;  2VV2 A;  3P89 A;  2P7A A;  2YFE A;  3H52 A;  4IU7 A;  4P6W A;  4TUZ A;  5EGV A;  3ERT A;  5DRJ A;  5DWE A;  3H0A D;  1FCZ A;  2GL8 A;  4QJR A;  4Y29 A;  1FCY A;  4XLD A;  4POJ A;  5HJP A;  1T63 A;  4APU A;  3GN8 A;  2G0G A;  3X1I A;  5C4U A;  2ZNN A;  3NOA A;  3ZR7 A;  2JF9 A;  4G1Z A;  3HOD A;  5KRF A;  1Q4X A;  1U3Q A;  1XB7 A;  1N46 A;  5AWJ A;  2ZXN A;  4E4K A;  1A28 A;  1NYX A;  3AZ1 A;  4G21 A;  5HYR A;  3E00 A;  4E2J A;  1I7G A;  1RKH A;  4NUF A;  3VT7 A;  2OCF A;  3FC6 B;  4RZE A;  4RWV A;  1FM6 D;  2B1Z A;  1U3R A;  4LNX A;  1X7J A;  3VSP A;  4OH5 A;  3DCT A;  1I37 A;  1R20 A;  2H79 A;  1QKU A;  2ATH A;  3HVL A;  5EI1 A;  4NQA B;  2FAI A;  4KZI A;  3OZJ A;  2QAB A;  3OZ0 A;  3U9Q A;  4YMQ A;  5LGA A;  3G9E A;  3HO0 A;  5DTV A;  1YYE A;  5G43 A;  3PRG A;  4BCR A;  1XP6 A;  2ZLC A;  5DMF A;  4JYI A;  3HC6 A;  3VJH A;  1U3S A;  2R6W A;  2POB A;  5DKE A;  5DZI A;  5EHJ A;  2NXX A;  2PJL A;  2ZK6 A;  3OLS A;  3RUT A;  3HC5 A;  4O8F A;  4OKT A;  2ZK5 A;  5DYB A;  2Z4J A;  1T79 A;  3ADS A;  2JFA A;  2O9I A;  1NAV A;  4ZNH A;  1DKF A;  1KNU A;  3L3X A;  3VTD A;  4J26 A;  1XAP A;  4OAR A;  2VV1 A;  3KDT A;  2GWX A;  3G8I A;  2ZK2 A;  4K7A A;  3GBK A;  3FLI A;  4XI3 A;  3ADT A;  1ERR A;  3IPQ A;  3V3Q A;  2VV0 A;  1IE8 A;  2HVC A;  3VRU A;  5HYK A;  1YIM A;  3DZY A;  1PQ6 A;  2ZFX A;  2ZMI A;  3CS6 A;  3OS8 A;  4X1G A;  5AAV A;  1PCG A;  5DID A;  2IOK A;  3MNE A;  1LV2 A;  4MG8 A;  2P1V A;  2PIQ A;  3VT9 A;  3IPS A;  1PQ9 A;  3OKI A;  3CS4 A;  5HCV A;  1MZN A;  1KV6 A;  2YLY A;  2IHQ A;  2ZMH A;  2ZK3 A;  3B3K A;  2P1T A;  3BEJ A;  4OIU A;  2Q60 A;  2Q6S A;  5E7V A;  3TX7 B;  3CDS A;  3W0A A;  1OSV A;  3WT7 A;  5LWP A;  3NSP A;  3P0U A;  1SJ0 A;  4QE8 A;  5KRO A;  3MNO A;  1TXI A;  4OZT U;  3DCU A;  4CI4 A;  3S9S A;  3WMH A;  1XLS A;  3DY6 A;  4IW6 A;  2QA8 A;  5DYD A;  2PKL A;  3R8I A;  5DZH A;  1SR7 A;  5KRJ A;  2QZO A;  2VV3 A;  3GD2 A;  5ACC A;  4XAO A;  1S19 A;  2ZXM A;  4EM9 A;  1ERE A;  1XQC A;  5DV6 A;  5APJ A;  5IXK A;  3ET0 A;  3D5F A;  2ZMJ A;  3W5Q A;  2ZKC A;  4JYG A;  4S15 A;  4XTA A;  3K8S A;  5DSH A;  4RZF A;  3IXP A;  3HM1 A;  2F4B A;  4IVW A;  2Q3Y A;  4S0S A;  3X1H A;  3A2H A;  5DZ0 A;  5KRC A;  1YY4 A;  3L3Z A;  4R2U A;  4WHG A;  4ZNW A;  3OSA A;  2VST A;  3G0W A;  5FQS A;  5DMC A;  2B50 A;  2AX7 A;  4OKW A;  4J5W A;  5L7G A;  2HC4 A;  1X7B A;  3R2A A;  1XZX X;  4FN9 A;  4IA7 A;  4MGA B;  3WJ4 A;  3KMG A;  4HLW A;  1KKQ A;  1UHL A;  3PBA A;  1R5K A;  1S9Q A;  2Q59 A;  4MG7 A;  4DOS A;  5IAW A;  5KCD A;  4PXM A;  4UDB A;  5DXB A;  3DZY D;  4KZM A;  1PK5 A;  3RLJ A;  2B1V A;  2PIX A;  4A4W A;  5DI7 A;  1X76 A;  4OEA A;  3K23 A;  5JJM B;  4WVD A;  2Q1V A;  1NDE A;  3Q95 A;  2VV4 B;  4J5X C;  1NRL A;  2QW4 A;  1E3G A;  3K22 A;  5DXQ A;  1ZDU A;  3V9T A;  3FUR A;  4M8E A;  5EIT A;  4QE6 A;  1QKN A;  2HAS A;  3IA6 A;  4RMC A;  3W5R A;  2ZVT A;  2J7X A;  4IV2 A;  2BJ4 A;  4WLB A;  4XT9 A;  5DUG A;  3OGT A;  3AZ2 A;  3R5N A;  1G5Y A;  3LMP A;  4REF A;  5ETH A;  3UUD A;  1GWX A;  4ZNU A;  2Q8S A;  2ZNQ A;  3GZ9 A;  4WPF A;  3EYB A;  4F9M A;  3AFR A;  4ZOM A;  2HB7 A;  2Q7K A;  3W5T A;  5DX3 B;  2BAW A;  3OMO A;  2HB8 A;  3CS8 A;  5DWI A;  1RKG A;  5KR9 A;  1XIU A;  3OMK A;  4PLE A;  3HQ5 A;  3PCU A;  4M8H A;  4PVU A;  5AVL A;  1FM9 A;  3VTB A;  1NHZ A;  2ZK1 A;  3UU7 A;  2ZBS A;  4IQR A;  5DP0 A;  3L1B A;  1Y0X X;  2QR9 A;  4IA1 A;  2OAX A;  2Q5G A;  3GYU A;  4UDD A;  3IMY A;  3UVV A;  3OMM A;  3OSW A;  4KZJ A;  4ITF A;  3W0C A;  4Q50 A;  2HAR A;  3F5C A;  3K6P A;  5DL4 A;  2I4P A;  3B0R A;  3WWR A;  4MGB A;  3CTB A;  4OZR E;  3AUN A;  1Z5X U;  3V9Y A;  1MV9 A;  3A3Z X;  3ADU A;  4TV1 A;  3UUA A;  1XV9 A;  1UPV A;  1ZH7 A;  1UPW A;  4REE A;  1T5Z A;  5DV8 A;  4CSJ A;  3B0Q A;  3B1M A;  3Q95 B;  3OOF A;  3SP9 A;  2P7G A;  1YOW A;  3W0Y A;  2AM9 A;  4ITE A;  5C4S A;  3TY0 A;  3L0E A;  1M7W A;  1DB1 A;  4PRG A;  5DXR A;  2GP7 A;  5G42 A;  2AWH A;  3WFG A;  1HJ1 A;  2GPV A;  2ACL A;  4OHA A;  1EXA A;  2QTU A;  4L96 A;  4JAZ A;  4MDD A;  1NAX A;  3QT0 A;  3D24 A;  5E0X A;  3OSI A;  3DT3 A;  4UDA A;  1XOW A;  4PP6 A;  1XDK B;  1YUC A;  3VT3 A;  4ZJR A;  3KWY A;  5DY8 A;  2YJD A;  4OFU A;  4XUH A;  5FQP A;  2OZ7 A;  5KCW A;  2PIU A;  2W8Y A;  3B0T A;  3B68 A;  4N8R A;  5K13 A;  5DWJ A;  5FQT A;  3CQV A;  1RJK A;  4QK4 A;  2QPY A;  3RY9 A;  4OIL A;  2AA5 A;  1OVL B;  2AAX A;  2ZK4 A;  2B23 A;  4XHD A;  4TUZ B;  2AX6 A;  1SQN A;  3HZF A;  3O1E A;  5HJP B;  1FD0 A;  2PIP L;  4K6I A;  2NXX E;  1I38 A;  2AX9 A;  3CLD A;  3FEI A;  3NSQ A;  2ZLA A;  3VN2 A;  3WFF A;  3W5P A;  4ZNT A;  5KCE A;  4R6S A;  5DU5 A;  4MGB B;  4P6X A;  4MG9 A;  1T76 A;  2NW4 A;  2FVJ A;  3OLF A;  3VHV A;  3M7R A;  5GID A;  5F9B A;  3UUA B;  3W0H A;  2QMV A;  4WHF A;  3E00 D;  3D6D A;  4UDC A;  5G44 A;  1RK3 A;  4IW8 A;  2G5O A;  4L98 A;  4MGD A;  1GWQ A;  3FUG A;  1T7F A;  3VT5 A;  3ET2 A;  3SZ1 A;  3UP3 A;  5JJM A;  1ILG A;  2PIR A;  1R20 D;  3A9E A;  1RDT A;  3W0J A;  1S9P A;  1IE9 A;  2XYX A;  4RFW A;  5AYG A;  2HFP A;  2Q61 A;  5DXP A;  3TKM A;  2OVM A;  3KMZ A;  4PPP A;  1K7L A;  2G44 A;  4RAK A;  2OVH A;  4YPQ A;  2A3I A;  1EXX A;  4OEZ A;  4Q0A C;  1QKT A;  2Q6R A;  2ZXZ A;  3B5R A;  5GIE A;  5H1E A;  4G1D A;  1XVP A;  1FBY A;  4J5X A;  3VHW A;  2YHD A;  5L7E A;  3FAL A;  1P93 A;  3HLV A;  1P8D A;  3L0L A;  3VJT A;  1WM0 X;  2ZAS A;  2GPO A;  4PP5 A;  5DUH A;  4YT1 A;  5KRA A;  1K74 A;  4S14 A;  1XLS E;  2EWP A;  2YLP A;  3V49 A;  3VT6 A;  2JFA B;  3FXV A;  1ZKY A;  3B66 A;  1DKF B;  1ZUC A;  3VJI A;  5KRI A;  2PIW A;  4NY9 A;  2VV1 B;  1XQ3 A;  3VTC A;  3WT5 A;  4PLD A;  3AN4 A;  2V7C A;  3OS8 C;  3KBA A;  5C4T A;  3CJW A;  4LTW A;  4DQM A;  3DR1 A;  5KCT A;  1YP0 A;  1Z5X E;  1PZL A;  5AAV B;  1XJ7 A;  2Q5S A;  3KPZ A;  2AA7 A;  5KCC A;  5ICK A;  4J24 A;  5APK A;  2XKW A;  4MG8 B;  2QGW A;  4DM6 A;  3PO9 A;  2P15 A;  3H0A A;  5SYZ A;  4WQP A;  3F7D A;  5KCF A;  4MG9 B;  4OC7 A;  1R6G A;  4LBD A;  3JZC A;  4X1F A;  2YAT A;  5KRH A;  2V0V A;  5KYJ A;  4DOR A;  4DK8 A;  5KRM A;  2HBH A;  3GYT A;  4PP3 A;  1YMT A;  5DIG A;  4ZO1 B;  2POG A;  4OED A;  3OOK A;  2I4Z A;  5AZT A;  4IA3 A;  1ZAF A;  3KMR A;  5AAU A;  1Z95 A;  3A9E B;  3ZRA A;  2QA8 B;  5JY3 A;  2YLO A;  3AZ3 A;  2HAM A;  2R40 A;  3PEQ A;  1M13 A;  3FC6 A;  2QZO B;  1L2I A;  2Q70 A;  3OLL A;  5DIE A;  3P88 A;  1FM6 A;  2AO6 A;  1ZGY A;  4IWF A;  3VJS A;  2GIU A;  4RUP A;  2FSZ A;  3N00 A;  3IXP D;  4N5G A;  5DWG A;  1OSH A;  2IOG A;  5KRL A;  2QXS A;  1N83 A;  4J5W C;  3AUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...