2ZXMA

A new class of vitamin d receptor ligands that induce structural rearrangement of the ligand-binding pocket
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
251
structure length
240
Chain Sequence
KLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMSPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Class of Vitamin D Analogues that Induce Structural Rearrangement of the Ligand-Binding Pocket of the Receptor
pubmed doi rcsb
molecule keywords Vitamin D3 receptor
molecule tags Transcription
source organism Rattus norvegicus
total genus 92
structure length 240
sequence length 251
ec nomenclature
pdb deposition date 2009-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2zxmA00
1R6GA 3ADTA 2LBDA 2H79A 4JGVA 5DU5A 3IPUA 4IA3A 5KCUA 3KMZA 3P8XA 4G21A 1ERRA 5DV6A 1XIUA 4K6IA 5DIGA 5DX3A 1GS4A 5E19A 2ZMIA 2ZK6A 1R1KD 2FAIA 3TY0A 3ADWA 1EXXA 5AVIA 3R29A 3W0AA 2B1VA 2HASA 3E00A 2XHSA 1KV6A 2Q3YA 2QA8B 3FUGA 3GD2A 2OM9A 1M7WA 3D24A 3MNOA 2G44A 3OGTA 4OKXA 2P1TA 1OSVA 3UUAA 1RKGA 3W5QA 1OT7A 5M96A 2HB8A 3FC6A 4N8RA 5EHJA 5GT4A 5KROA 1XQ3A 2AXAA 3VI8A 2AO6A 4RAKA 1XQCA 3P0UA 5GICA 5B5BA 2V0VA 3V3QA 2I4ZA 2ZL9A 2R6WA 3VT8A 4BCRA 3B0WA 4APUA 4OJ4A 1S0ZA 4PLDA 3R5NA 4REEA 2JFAA 3T03A 4LNWA 2IOGA 4PXMA 4ZO1B 3VJTA 2ACLB 2NPAA 5DKSA 3V49A 5G42A 3H0AD 2HFPA 5EC9A 2AA7A 3GWSX 3OS8A 1NDEA 5KRFA 1RKHA 2PKLA 5FQTA 4IWCA 1LV2A 2B1ZA 2ZXMA 4OKBA 2HC4A 5SYZA 4JAZA 1E3GA 2AA2A 2G5OA 2P4YA 2YLPA 2OVHA 3F7DA 5ACCA 2QXSA 4HLWA 3FXVA 4MDDA 5KRIA 5DXEA 4RZEA 3G9EA 5DXGA 3VT6A 1FD0A 4S0SA 3H52A 5IXKA 2R40D 5EGVA 1ZKYA 4ZNWA 5A86A 3ZQTA 4PWLA 5AAVB 5B41A 1NRLA 3HM1A 4WHFA 1M13A 2G0HA 1SKXA 3DZYA 2G0GA 4WPFA 4JL4A 4OZRE 3W5PA 4A4VA 5IAWA 5DIEA 5L7GA 2QABA 3WTQA 4DQMA 3UP0A 1XAPA 3ADUA 1T7RA 3CDSA 3PCUA 4X1FA 5DSHA 4REFA 5AZTA 1XB7A 1G1UA 3DCTA 2OUZA 4ZI1A 2P7ZA 1Q4XA 2QSEA 3VT7A 3RUUA 1E3KA 1T63A 3IPQA 2IOKA 5DYBA 2OVMA 4IW6A 4OHAA 4ITEA 3R8DA 3CS8A 3KBAA 2QA8A 1XLSA 5KD9A 4JYIA 1GWQA 3A2HA 2P7AA 2YHDA 1UHLB 1FBYA 1WM0X 5E15A 2AWHA 4MG8A 2P7GA 4MG9B 4G1YA 3QT0A 5HJPB 1T7MA 5HCVA 1DB1A 1NQ2A 1RDTD 3KMRA 4Y29A 1Z5XU 3OSIA 4PRGA 4R6SA 5KRAA 5KYAA 2F4BA 3L3ZA 5DXMA 2R6YA 3AUQA 5GIDA 3VTDA 2ZK2A 4J5WC 4P6WA 5K13A 4OH5A 3ADXA 1I7IA 1XDKA 2ACLA 4OGHA 3X1HA 3G8OA 5DKEA 5C4TA 4NY9A 3WFFA 1R20D 4A2JA 4ZO1X 1T7TA 2QMVA 3GYTA 3M7RA 1KKQA 5DWIA 1XVPB 1U3RA 2Q1HA 2VV4B 1PK5A 1IE9A 3IXPD 4IV2A 3ET0A 1U3SA 2Q7LA 1A28A 3EYBA 4WVDA 1HJ1A 1N4HA 5E7VA 2YLQA 2VV3A 5JJMB 3CTBA 5C4OA 3PO9A 5F9BA 2QGWA 1YY4A 1XP9A 1ZAFA 2ZK3A 5DZ3A 4RWVA 4TV1B 4OEZA 1X7JA 2JJ3A 3IMYA 2PJLA 5C4SA 5AAVA 2Q7JA 5KRLA 1X7EA 2YJDA 5JI0D 1ZUCA 5KCFA 4OEYA 4DM6A 1ZGYA 2AAXA 1IE8A 5E0WA 2Q59B 3PBAA 2W8YA 4YNKA 1X76A 2HBHA 3AZ1A 1FCZA 3AZ2A 3W0JA 3W5RA 2E2RA 2ZNQA 3K8SA 3G0WA 4PP6A 3DZUA 2GPPA 3FURA 2P15A 3L3XA 4QE6A 2AX6A 2VSRA 4R06A 3W0CA 1MZNA 3KPZA 4RFWA 1NQ1A 1S0XA 4OEAA 1UHLA 3VHWA 5KRJA 4PPPA 3UUCA 1XJ7A 4Q13A 5DXBB 2GTKA 3O1DA 4XUHA 5HZCA 4E2JA 2ZVTA 4XHDA 4MG9A 1Y0SA 2Q60A 3DY6A 2NV7A 4OARA 3W5TA 5HJPA 1ZH7A 1Y0XX 4IVWA 3P88A 4L98A 1XNXA 4ZNSA 2V7CA 4XT9A 3CQVA 1U3QA 4FGYA 2P54A 3R2AA 1PQCA 4UDDA 5JY3A 1UOMA 2BJ4B 2ZASA 2HARA 5EITA 1L2JA 5ICKA 3W0HA 1X7RA 1XZXX 1XNNA 2GPVA 2YJAB 3MNEA 4G2HA 5DWLA 4UDBA 3D6DA 3GWXA 4OIVA 3ZRAA 4IUIA 5KR9A 2ZXZA 3O1EA 4XI3A 3TKCA 4POJA 2ZFXA 1P8DA 2AYRA 3F5CB 4ZJWA 2ZK1A 1XVPA 3JZCA 3TX7B 3GN8A 3HODA 4KZMA 2AX7A 2QH6A 2VV4A 5G46A 3SZ1A 3UVVB 3KMGA 4IA1A 3WT6A 2Z4JA 3V9YA 2GIUA 1N83A 2QTUA 3ET3A 4OJBA 3JZBA 3V9VA 5JJMA 1K4WA 3ET2A 1S19A 2Q61A 3L1BA 5DKGA 2ZY0A 1X7BA 3WT5A 4TV1A 1T65A 1YA3A 3HZFA 3KWYA 4MGBB 2GPUA 2ZMHA 3GZ9A 4DK7A 3UP3A 1LBDA 2VV2A 4RMDA 2J7YA 3OZJA 5DV8A 3VJHA 1XLSE 4MGCA 5DTVA 2PIWA 4MG6A 2Q59A 1YOKA 1XP6A 4IVYA 4MG7B 1XP1A 4RUPA 2OZ7A 3E00D 3FLIA 1EREA 3L0EA 2P1UA 4LNXA 2ZK0A 3CS4A 5E1CA 3AURA 4J5XC 1ILHA 1K74A 4OC7A 1YP0A 4KZJA 3PLZA 4YPQA 3WWRA 3NOAA 1RJKA 5G43A 2I4JA 5DRMA 3B67A 1H9UA 3FEJA 1DKFB 2AM9A 4M8HA 5H1EA 5KCCA 2BAWA 4J24A 4XUMA 3LMPA 5E0XA 5L7HA 4PF3A 4POHA 2FSZA 2HWQA 4OH6A 1NQ0A 2ZXNA 3VN2A 4FHIA 4DOSA 4G1DA 3OS9A 4ZN7A 5DXBA 2Q5SA 4RUJA 4JYHA 4ZNTA 4WQPA 2Q6RA 1OVLB 4OKWA 1HG4A 2QNVA 5LGAA 5DUEA 3W0GA 2HAMA 5DUGA 1N46A 3AFRA 2QZOB 4OEDA 3VT4A 2BJ4A 1FM9A 1YYEA 3K6PA 3KFCA 1YIMA 1Z5XE 3AN4A 1NQ7A 3ET1A 5FQRA 5HJSA 3ZRBA 1QKUA 3VHUA 4NIEA 2AX9A 3IA6A 4ZNVA 2PIVA 3F5CA 3RLJA 5DX3B 4ZNUA 1XPCA 2B50A 3A3ZX 4OZTU 3UVVA 3KDTA 5KRHA 3D5FA 3OOFA 1GWRA 3GBKA 4R2UA 3IPSA 3L0JA 3VRUA 1T76A 3A9EB 3Q95B 4RUOX 3VHVA 1FM6A 4ZNHA 1PDUA 2NXXA 1NUOA 2QPYA 2AMBA 3ADVA 5EI1A 4N1YA 2VSTA 3B5RA 5DV3A 2Z4BA 1SR7A 4MGBA 1ZDUA 2B23A 1YOWA 3D57A 3UU7B 5AAUA 4IA2A 5DIDA 3OMQA 5L7EA 2Q7IA 5DZHA 3B0TA 1R1KA 1S9QA 4XTAA 4MG7A 4HEEX 3OMMA 5EJVA 4OIUA 3FALB 2VV0A 3SP9A 4J5WA 1L2IA 1UPWA 5DXRA 5I4VA 3GYUA 3B65A 4RMCA 3A40X 1YJEA 5CJ6A 5DXQA 5KCTA 5DMCA 2AA6A 2QR9A 3B66A 2REWA 4XLDA 4K4JA 1DKFA 2I0JA 4IV4A 2EWPA 1T73A 3NSQA 2PNUA 3BQDA 4E4QA 4Q50A 5FQSA 1I38A 3G8IA 4LTWA 2PIUA 1FCYA 4WHGA 4A4WA 3VSPA 2P1VA 1OVLA 1VJBA 5AWKA 3UUDB 4F9MA 3VSOA 2XYJA 4OFUA 4IW8A 4PPSA 1UPVA 2GPOA 3OMPA 1TXIA 2J7XA 2AA5A 3HVLA 3KDUA 2GP7A 3OSAA 1YMTA 2XYWA 4PP5A 3CWDA 3HC5A 2QZOA 3WGPA 5DK9A 1R5KA 3H0AA 3HO0A 3OLFA 4QL8A 3RUTA 5KRKA 2ZBSA 3V3EA 2Q8SA 2XYXA 2HWRA 5KCDA 1T79A 1EXAA 3AUNA 4PP3A 2PIXA 4QM0A 2PIOA 4RZFA 2IHQA 2Q5PA 3VTCA 3WFGA 3LBDA 4X1GA 3DCUA 4XAOA 5KRMA 2YFEA 3AZ3A 1ZEOA 5DVSA 1NAXA 1Z95A 3VRTA 3KYTA 4M8EA 3L03A 3WJ5A 3OOKA 2Q6JA 5DWGA 3V4AA 1K7LA 2PIQA 3K22A 1U9EA 3FS1A 2POGA 3OKIA 1TFCA 1T74A 1PCGA 3A9EA 3Q95A 4QJRA 5DVVA 3R8IA 2R40A 4IQRA 3OS8C 3AN3A 3VT5A 5APHA 2A3IA 2PITA 4DMAA 2GL8A 3HC6A 5AK2A 1OSHA 3CDPA 4J26A 5DI7A 5AVLA 5GIEA 4IS8A 4UDCA 5G44A 2YLOA 3UU7A 4MG8B 1MVCA 3HLVA 4ZJRA 4OFRA 3DZUD 3ILZA 2QA6A 3B3KA 4LSJA 2PINA 3AX8A 2ABIA 2ZLCA 3A2IA 3FALA 4G1ZA 4DK8A 4EM9A 3W0IA 5KRCA 2J4AA 2ZLAA 5G45A 4S15A 3RVFA 4N73A 4QK4A 2H77A 4ZN9A 1NAVA 1QKNA 3R5MA 4YMQA 1RK3A 1XDKB 2VV1B 2NW4A 5DWJA 2YLYA 4S0TA 3VRVA 1T7FA 5DP0A 3OMOA 5AYGA 4B7WA 2ZK5A 4MGDB 2PIPL 1BSXA 5FQPA 5KCEA 4Q0AC 5LWPA 4O8FA 4MGAB 5DKBA 3VT9A 1RDTA 5DXPA 4RE8A 3X1IA 1QKMA 3MNPA 1XOWA 3UUDA 3SP6A 5DY8A 3P89A 3S9SA 1XV9B 2FVJA 5KYJA 4NQAB 4EMAA 4TUZB 2XKWA 2I4PA 1NHZA 2HCDA 5DVCA 5APJA 4FN9A 1M2ZA 1R20A 2O9IA 3ADSA 2NXXE 4NUFA 3L0LA 3PRGA 4OKTA 2QGTA 1FCXA 3BC5A 3ERDA 4OZRU 4RMEA 5DL4A 1YINA 2O4JA 1PRGA 4FNEA 3IXPA 4IA7A 5DXKA 4OK1A 2Q1VA 4J5XA 3X36A 4JYGA 3ERTA 3VJIA 4S14A 5IZ0A 3TKMA 4K7AA 3A78A 3W0YA 4N5GA 1I7GA 4ZOMA 3FEIA 3BEJA 3OLLA 4DORA 3CLDA 4OLMA 4PLEA 1P93A 4IU7A 5DMFA 2O4RA 3DT3A 4ONIA 3WT7A 5AZVA 4KZIA 5HYKA 4CI4A 5C4UA 5DLRA 4OZTE 1G2NA 3VRWA 4UDAA 5DZ0A 5AWJA 3OZ0A 3X31A 3DZYD 4MG5A 2OCFA 4OILA 1S9PA 1K74D 5L11A 3ZR7A 1PQ6A 3B68A 1T5ZA 3OSWA 1MV9A 2GWXA 2Q7KA 3V9TA 3VJSA 2Q6SA 3A2JA 5DWEA 3UUAB 2J14A 1PQ9A 4E4KA 1X78A 3FC6B 5G5WA 3NSPA 3E7CA 3D90A 1ILGA 2HVCA 2I0GA 5HYRA 3RLLA 4L96A 2PIRA 2JF9A 3OMKA 2OAXA 3U9QA 2AB2A 1ZDTA 4YT1A 1A52A 3B1MA 1G5YA 2VV1A 4RZGA 1NYXA 5DZIA 3HQ5A 5G3JA 1GWXA 5DZ1A 4LBDA 2AMAA 2JFAB 3B0QA 3N00A 4MGDA 3E94A 2ZNOA 1SJ0A 2ATHA 2ZKCA 3VTBA 1SQNA 2ZNPA 3B0RA 4MGAA 1PZLA 4IWFA 3OLSA 2Q70A 2POBA 2ZK4A 4FHHA 1KNUA 4G20A 1FM9D 4CI5A 1G50A 2AX8A 2QXMA 2YATA 2ZNNA 1XV9A 3K23A 5ETHA 1YUCA 5KCWA 3RY9A 5E14A 3WJ4A 3DR1A 4G2IA 4OJ9A 4TUZA 3OKHA 5DYDA 5FQVA 3VT3A 5DUHA 3WMHA 3CJWA 4NB6A 1I37A 2QE4A 4DM8A 2QW4A 2ZMJA 3OAPA 4P6XA 2PRGA 3R8AA 4QE8A 2HB7A 1FM6D 4CSJA 2Q5GA 3CS6A 4WLBA 4PVUA 5DRJA 1QKTA 1Y9RA 5APKA 4ITFA 3PEQA
chains in the Genus database with same CATH superfamily
1R6GA 3ADTA 2LBDA 2H79A 4JGVA 5DU5A 3IPUA 4IA3A 5KCUA 3KMZA 3P8XA 4G21A 1ERRA 5DV6A 1XIUA 4K6IA 5DIGA 5DX3A 1GS4A 5E19A 2ZMIA 2ZK6A 1R1KD 2FAIA 3TY0A 3ADWA 1EXXA 5AVIA 3R29A 3W0AA 2B1VA 2HASA 3E00A 2XHSA 1KV6A 2Q3YA 2QA8B 3FUGA 3GD2A 2OM9A 1M7WA 3D24A 3MNOA 2G44A 3OGTA 4OKXA 2P1TA 1OSVA 3UUAA 1RKGA 3W5QA 1OT7A 5M96A 2HB8A 3FC6A 4N8RA 5EHJA 5GT4A 5KROA 1XQ3A 2AXAA 3VI8A 2AO6A 4RAKA 1XQCA 3P0UA 5GICA 5B5BA 2V0VA 3V3QA 2I4ZA 2ZL9A 2R6WA 3VT8A 4BCRA 3B0WA 4APUA 4OJ4A 1S0ZA 4PLDA 3R5NA 4REEA 2JFAA 3T03A 4LNWA 2IOGA 4PXMA 4ZO1B 3VJTA 2ACLB 2NPAA 5DKSA 3V49A 5G42A 3H0AD 2HFPA 5EC9A 2AA7A 3GWSX 3OS8A 1NDEA 5KRFA 1RKHA 2PKLA 5FQTA 4IWCA 1LV2A 2B1ZA 2ZXMA 4OKBA 2HC4A 5SYZA 4JAZA 1E3GA 2AA2A 2G5OA 2P4YA 2YLPA 2OVHA 3F7DA 5ACCA 2QXSA 4HLWA 3FXVA 4MDDA 5KRIA 5DXEA 4RZEA 3G9EA 5DXGA 3VT6A 1FD0A 4S0SA 3H52A 5IXKA 2R40D 5EGVA 1ZKYA 4ZNWA 5A86A 3ZQTA 4PWLA 5AAVB 5B41A 1NRLA 3HM1A 4WHFA 1M13A 2G0HA 1SKXA 3DZYA 2G0GA 4WPFA 4JL4A 4OZRE 3W5PA 4A4VA 5IAWA 5DIEA 5L7GA 2QABA 3WTQA 4DQMA 3UP0A 1XAPA 3ADUA 1T7RA 3CDSA 3PCUA 4X1FA 5DSHA 4REFA 5AZTA 1XB7A 1G1UA 3DCTA 2OUZA 4ZI1A 2P7ZA 1Q4XA 2QSEA 3VT7A 3RUUA 1E3KA 1T63A 3IPQA 2IOKA 5DYBA 2OVMA 4IW6A 4OHAA 4ITEA 3R8DA 3CS8A 3KBAA 2QA8A 1XLSA 5KD9A 4JYIA 1GWQA 3A2HA 2P7AA 2YHDA 1UHLB 1FBYA 1WM0X 5E15A 2AWHA 4MG8A 2P7GA 4MG9B 4G1YA 3QT0A 5HJPB 1T7MA 5HCVA 1DB1A 1NQ2A 1RDTD 3KMRA 4Y29A 1Z5XU 3OSIA 4PRGA 4R6SA 5KRAA 5KYAA 2F4BA 3L3ZA 5DXMA 2R6YA 3AUQA 5GIDA 3VTDA 2ZK2A 4J5WC 4P6WA 5K13A 4OH5A 3ADXA 1I7IA 1XDKA 2ACLA 4OGHA 3X1HA 3G8OA 5DKEA 5C4TA 4NY9A 3WFFA 1R20D 4A2JA 4ZO1X 1T7TA 2QMVA 3GYTA 3M7RA 1KKQA 5DWIA 1XVPB 1U3RA 2Q1HA 2VV4B 1PK5A 1IE9A 3IXPD 4IV2A 3ET0A 1U3SA 2Q7LA 1A28A 3EYBA 4WVDA 1HJ1A 1N4HA 5E7VA 2YLQA 2VV3A 5JJMB 3CTBA 5C4OA 3PO9A 5F9BA 2QGWA 1YY4A 1XP9A 1ZAFA 2ZK3A 5DZ3A 4RWVA 4TV1B 4OEZA 1X7JA 2JJ3A 3IMYA 2PJLA 5C4SA 5AAVA 2Q7JA 5KRLA 1X7EA 2YJDA 5JI0D 1ZUCA 5KCFA 4OEYA 4DM6A 1ZGYA 2AAXA 1IE8A 5E0WA 2Q59B 3PBAA 2W8YA 4YNKA 1X76A 2HBHA 3AZ1A 1FCZA 3AZ2A 3W0JA 3W5RA 2E2RA 2ZNQA 3K8SA 3G0WA 4PP6A 3DZUA 2GPPA 3FURA 2P15A 3L3XA 4QE6A 2AX6A 2VSRA 4R06A 3W0CA 1MZNA 3KPZA 4RFWA 1NQ1A 1S0XA 4OEAA 1UHLA 3VHWA 5KRJA 4PPPA 3UUCA 1XJ7A 4Q13A 5DXBB 2GTKA 3O1DA 4XUHA 5HZCA 4E2JA 2ZVTA 4XHDA 4MG9A 1Y0SA 2Q60A 3DY6A 2NV7A 4OARA 3W5TA 5HJPA 1ZH7A 1Y0XX 4IVWA 3P88A 4L98A 1XNXA 4ZNSA 2V7CA 4XT9A 3CQVA 1U3QA 4FGYA 2P54A 3R2AA 1PQCA 4UDDA 5JY3A 1UOMA 2BJ4B 2ZASA 2HARA 5EITA 1L2JA 5ICKA 3W0HA 1X7RA 1XZXX 1XNNA 2GPVA 2YJAB 3MNEA 4G2HA 5DWLA 4UDBA 3D6DA 3GWXA 4OIVA 3ZRAA 4IUIA 5KR9A 2ZXZA 3O1EA 4XI3A 3TKCA 4POJA 2ZFXA 1P8DA 2AYRA 3F5CB 4ZJWA 2ZK1A 1XVPA 3JZCA 3TX7B 3GN8A 3HODA 4KZMA 2AX7A 2QH6A 2VV4A 5G46A 3SZ1A 3UVVB 3KMGA 4IA1A 3WT6A 2Z4JA 3V9YA 2GIUA 1N83A 2QTUA 3ET3A 4OJBA 3JZBA 3V9VA 5JJMA 1K4WA 3ET2A 1S19A 2Q61A 3L1BA 5DKGA 2ZY0A 1X7BA 3WT5A 4TV1A 1T65A 1YA3A 3HZFA 3KWYA 4MGBB 2GPUA 2ZMHA 3GZ9A 4DK7A 3UP3A 1LBDA 2VV2A 4RMDA 2J7YA 3OZJA 5DV8A 3VJHA 1XLSE 4MGCA 5DTVA 2PIWA 4MG6A 2Q59A 1YOKA 1XP6A 4IVYA 4MG7B 1XP1A 4RUPA 2OZ7A 3E00D 3FLIA 1EREA 3L0EA 2P1UA 4LNXA 2ZK0A 3CS4A 5E1CA 3AURA 4J5XC 1ILHA 1K74A 4OC7A 1YP0A 4KZJA 3PLZA 4YPQA 3WWRA 3NOAA 1RJKA 5G43A 2I4JA 5DRMA 3B67A 1H9UA 3FEJA 1DKFB 2AM9A 4M8HA 5H1EA 5KCCA 2BAWA 4J24A 4XUMA 3LMPA 5E0XA 5L7HA 4PF3A 4POHA 2FSZA 2HWQA 4OH6A 1NQ0A 2ZXNA 3VN2A 4FHIA 4DOSA 4G1DA 3OS9A 4ZN7A 5DXBA 2Q5SA 4RUJA 4JYHA 4ZNTA 4WQPA 2Q6RA 1OVLB 4OKWA 1HG4A 2QNVA 5LGAA 5DUEA 3W0GA 2HAMA 5DUGA 1N46A 3AFRA 2QZOB 4OEDA 3VT4A 2BJ4A 1FM9A 1YYEA 3K6PA 3KFCA 1YIMA 1Z5XE 3AN4A 1NQ7A 3ET1A 5FQRA 5HJSA 3ZRBA 1QKUA 3VHUA 4NIEA 2AX9A 3IA6A 4ZNVA 2PIVA 3F5CA 3RLJA 5DX3B 4ZNUA 1XPCA 2B50A 3A3ZX 4OZTU 3UVVA 3KDTA 5KRHA 3D5FA 3OOFA 1GWRA 3GBKA 4R2UA 3IPSA 3L0JA 3VRUA 1T76A 3A9EB 3Q95B 4RUOX 3VHVA 1FM6A 4ZNHA 1PDUA 2NXXA 1NUOA 2QPYA 2AMBA 3ADVA 5EI1A 4N1YA 2VSTA 3B5RA 5DV3A 2Z4BA 1SR7A 4MGBA 1ZDUA 2B23A 1YOWA 3D57A 3UU7B 5AAUA 4IA2A 5DIDA 3OMQA 5L7EA 2Q7IA 5DZHA 3B0TA 1R1KA 1S9QA 4XTAA 4MG7A 4HEEX 3OMMA 5EJVA 4OIUA 3FALB 2VV0A 3SP9A 4J5WA 1L2IA 1UPWA 5DXRA 5I4VA 3GYUA 3B65A 4RMCA 3A40X 1YJEA 5CJ6A 5DXQA 5KCTA 5DMCA 2AA6A 2QR9A 3B66A 2REWA 4XLDA 4K4JA 1DKFA 2I0JA 4IV4A 2EWPA 1T73A 3NSQA 2PNUA 3BQDA 4E4QA 4Q50A 5FQSA 1I38A 3G8IA 4LTWA 2PIUA 1FCYA 4WHGA 4A4WA 3VSPA 2P1VA 1OVLA 1VJBA 5AWKA 3UUDB 4F9MA 3VSOA 2XYJA 4OFUA 4IW8A 4PPSA 1UPVA 2GPOA 3OMPA 1TXIA 2J7XA 2AA5A 3HVLA 3KDUA 2GP7A 3OSAA 1YMTA 2XYWA 4PP5A 3CWDA 3HC5A 2QZOA 3WGPA 5DK9A 1R5KA 3H0AA 3HO0A 3OLFA 4QL8A 3RUTA 5KRKA 2ZBSA 3V3EA 2Q8SA 2XYXA 2HWRA 5KCDA 1T79A 1EXAA 3AUNA 4PP3A 2PIXA 4QM0A 2PIOA 4RZFA 2IHQA 2Q5PA 3VTCA 3WFGA 3LBDA 4X1GA 3DCUA 4XAOA 5KRMA 2YFEA 3AZ3A 1ZEOA 5DVSA 1NAXA 1Z95A 3VRTA 3KYTA 4M8EA 3L03A 3WJ5A 3OOKA 2Q6JA 5DWGA 3V4AA 1K7LA 2PIQA 3K22A 1U9EA 3FS1A 2POGA 3OKIA 1TFCA 1T74A 1PCGA 3A9EA 3Q95A 4QJRA 5DVVA 3R8IA 2R40A 4IQRA 3OS8C 3AN3A 3VT5A 5APHA 2A3IA 2PITA 4DMAA 2GL8A 3HC6A 5AK2A 1OSHA 3CDPA 4J26A 5DI7A 5AVLA 5GIEA 4IS8A 4UDCA 5G44A 2YLOA 3UU7A 4MG8B 1MVCA 3HLVA 4ZJRA 4OFRA 3DZUD 3ILZA 2QA6A 3B3KA 4LSJA 2PINA 3AX8A 2ABIA 2ZLCA 3A2IA 3FALA 4G1ZA 4DK8A 4EM9A 3W0IA 5KRCA 2J4AA 2ZLAA 5G45A 4S15A 3RVFA 4N73A 4QK4A 2H77A 4ZN9A 1NAVA 1QKNA 3R5MA 4YMQA 1RK3A 1XDKB 2VV1B 2NW4A 5DWJA 2YLYA 4S0TA 3VRVA 1T7FA 5DP0A 3OMOA 5AYGA 4B7WA 2ZK5A 4MGDB 2PIPL 1BSXA 5FQPA 5KCEA 4Q0AC 5LWPA 4O8FA 4MGAB 5DKBA 3VT9A 1RDTA 5DXPA 4RE8A 3X1IA 1QKMA 3MNPA 1XOWA 3UUDA 3SP6A 5DY8A 3P89A 3S9SA 1XV9B 2FVJA 5KYJA 4NQAB 4EMAA 4TUZB 2XKWA 2I4PA 1NHZA 2HCDA 5DVCA 5APJA 4FN9A 1M2ZA 1R20A 2O9IA 3ADSA 2NXXE 4NUFA 3L0LA 3PRGA 4OKTA 2QGTA 1FCXA 3BC5A 3ERDA 4OZRU 4RMEA 5DL4A 1YINA 2O4JA 1PRGA 4FNEA 3IXPA 4IA7A 5DXKA 4OK1A 2Q1VA 4J5XA 3X36A 4JYGA 3ERTA 3VJIA 4S14A 5IZ0A 3TKMA 4K7AA 3A78A 3W0YA 4N5GA 1I7GA 4ZOMA 3FEIA 3BEJA 3OLLA 4DORA 3CLDA 4OLMA 4PLEA 1P93A 4IU7A 5DMFA 2O4RA 3DT3A 4ONIA 3WT7A 5AZVA 4KZIA 5HYKA 4CI4A 5C4UA 5DLRA 4OZTE 1G2NA 3VRWA 4UDAA 5DZ0A 5AWJA 3OZ0A 3X31A 3DZYD 4MG5A 2OCFA 4OILA 1S9PA 1K74D 5L11A 3ZR7A 1PQ6A 3B68A 1T5ZA 3OSWA 1MV9A 2GWXA 2Q7KA 3V9TA 3VJSA 2Q6SA 3A2JA 5DWEA 3UUAB 2J14A 1PQ9A 4E4KA 1X78A 3FC6B 5G5WA 3NSPA 3E7CA 3D90A 1ILGA 2HVCA 2I0GA 5HYRA 3RLLA 4L96A 2PIRA 2JF9A 3OMKA 2OAXA 3U9QA 2AB2A 1ZDTA 4YT1A 1A52A 3B1MA 1G5YA 2VV1A 4RZGA 1NYXA 5DZIA 3HQ5A 5G3JA 1GWXA 5DZ1A 4LBDA 2AMAA 2JFAB 3B0QA 3N00A 4MGDA 3E94A 2ZNOA 1SJ0A 2ATHA 2ZKCA 3VTBA 1SQNA 2ZNPA 3B0RA 4MGAA 1PZLA 4IWFA 3OLSA 2Q70A 2POBA 2ZK4A 4FHHA 1KNUA 4G20A 1FM9D 4CI5A 1G50A 2AX8A 2QXMA 2YATA 2ZNNA 1XV9A 3K23A 5ETHA 1YUCA 5KCWA 3RY9A 5E14A 3WJ4A 3DR1A 4G2IA 4OJ9A 4TUZA 3OKHA 5DYDA 5FQVA 3VT3A 5DUHA 3WMHA 3CJWA 4NB6A 1I37A 2QE4A 4DM8A 2QW4A 2ZMJA 3OAPA 4P6XA 2PRGA 3R8AA 4QE8A 2HB7A 1FM6D 4CSJA 2Q5GA 3CS6A 4WLBA 4PVUA 5DRJA 1QKTA 1Y9RA 5APKA 4ITFA 3PEQA
chains in the Genus database with same CATH topology
1R6GA 3ADTA 2LBDA 2H79A 4JGVA 5DU5A 3IPUA 4IA3A 5KCUA 3KMZA 3P8XA 4G21A 1ERRA 5DV6A 1XIUA 4K6IA 5DIGA 5DX3A 1GS4A 5E19A 2ZMIA 2ZK6A 1R1KD 2FAIA 3TY0A 3ADWA 1EXXA 5AVIA 3R29A 3W0AA 2B1VA 2HASA 3E00A 2XHSA 1KV6A 2Q3YA 2QA8B 3FUGA 3GD2A 2OM9A 1M7WA 3D24A 3MNOA 2G44A 3OGTA 4OKXA 2P1TA 1OSVA 3UUAA 1RKGA 3W5QA 1OT7A 5M96A 2HB8A 3FC6A 4N8RA 5EHJA 5GT4A 5KROA 1XQ3A 2AXAA 3VI8A 2AO6A 4RAKA 1XQCA 3P0UA 5GICA 5B5BA 2V0VA 3V3QA 2I4ZA 2ZL9A 2R6WA 3VT8A 4BCRA 3B0WA 4APUA 4OJ4A 1S0ZA 4PLDA 3R5NA 4REEA 2JFAA 3T03A 4LNWA 2IOGA 4PXMA 4ZO1B 3VJTA 2ACLB 2NPAA 5DKSA 3V49A 5G42A 3H0AD 2HFPA 5EC9A 2AA7A 3GWSX 3OS8A 1NDEA 5KRFA 1RKHA 2PKLA 5FQTA 4IWCA 1LV2A 2B1ZA 2ZXMA 4OKBA 2HC4A 5SYZA 4JAZA 1E3GA 2AA2A 2G5OA 2P4YA 2YLPA 2OVHA 3F7DA 5ACCA 2QXSA 4HLWA 3FXVA 4MDDA 5KRIA 5DXEA 4RZEA 3G9EA 5DXGA 3VT6A 1FD0A 4S0SA 3H52A 5IXKA 2R40D 5EGVA 1ZKYA 4ZNWA 5A86A 3ZQTA 4PWLA 5AAVB 5B41A 1NRLA 3HM1A 4WHFA 1M13A 2G0HA 1SKXA 3DZYA 2G0GA 4WPFA 4JL4A 4OZRE 3W5PA 4A4VA 5IAWA 5DIEA 5L7GA 2QABA 3WTQA 4DQMA 3UP0A 1XAPA 3ADUA 1T7RA 3CDSA 3PCUA 4X1FA 5DSHA 4REFA 5AZTA 1XB7A 1G1UA 3DCTA 2OUZA 4ZI1A 2P7ZA 1Q4XA 2QSEA 3VT7A 3RUUA 1E3KA 1T63A 3IPQA 2IOKA 5DYBA 2OVMA 4IW6A 4OHAA 4ITEA 3R8DA 3CS8A 3KBAA 2QA8A 1XLSA 5KD9A 4JYIA 1GWQA 3A2HA 2P7AA 2YHDA 1UHLB 1FBYA 1WM0X 5E15A 2AWHA 4MG8A 2P7GA 4MG9B 4G1YA 3QT0A 5HJPB 1T7MA 5HCVA 1DB1A 1NQ2A 1RDTD 3KMRA 4Y29A 1Z5XU 3OSIA 4PRGA 4R6SA 5KRAA 5KYAA 2F4BA 3L3ZA 5DXMA 2R6YA 3AUQA 5GIDA 3VTDA 2ZK2A 4J5WC 4P6WA 5K13A 4OH5A 3ADXA 1I7IA 1XDKA 2ACLA 4OGHA 3X1HA 3G8OA 5DKEA 5C4TA 4NY9A 3WFFA 1R20D 4A2JA 4ZO1X 1T7TA 2QMVA 3GYTA 3M7RA 1KKQA 5DWIA 1XVPB 1U3RA 2Q1HA 2VV4B 1PK5A 1IE9A 3IXPD 4IV2A 3ET0A 1U3SA 2Q7LA 1A28A 3EYBA 4WVDA 1HJ1A 1N4HA 5E7VA 2YLQA 2VV3A 5JJMB 3CTBA 5C4OA 3PO9A 5F9BA 2QGWA 1YY4A 1XP9A 1ZAFA 2ZK3A 5DZ3A 4RWVA 4TV1B 4OEZA 1X7JA 2JJ3A 3IMYA 2PJLA 5C4SA 5AAVA 2Q7JA 5KRLA 1X7EA 2YJDA 5JI0D 1ZUCA 5KCFA 4OEYA 4DM6A 1ZGYA 2AAXA 1IE8A 5E0WA 2Q59B 3PBAA 2W8YA 4YNKA 1X76A 2HBHA 3AZ1A 1FCZA 3AZ2A 3W0JA 3W5RA 2E2RA 2ZNQA 3K8SA 3G0WA 4PP6A 3DZUA 2GPPA 3FURA 2P15A 3L3XA 4QE6A 2AX6A 2VSRA 4R06A 3W0CA 1MZNA 3KPZA 4RFWA 1NQ1A 1S0XA 4OEAA 1UHLA 3VHWA 5KRJA 4PPPA 3UUCA 1XJ7A 4Q13A 5DXBB 2GTKA 3O1DA 4XUHA 5HZCA 4E2JA 2ZVTA 4XHDA 4MG9A 1Y0SA 2Q60A 3DY6A 2NV7A 4OARA 3W5TA 5HJPA 1ZH7A 1Y0XX 4IVWA 3P88A 4L98A 1XNXA 4ZNSA 2V7CA 4XT9A 3CQVA 1U3QA 4FGYA 2P54A 3R2AA 1PQCA 4UDDA 5JY3A 1UOMA 2BJ4B 2ZASA 2HARA 5EITA 1L2JA 5ICKA 3W0HA 1X7RA 1XZXX 1XNNA 2GPVA 2YJAB 3MNEA 4G2HA 5DWLA 4UDBA 3D6DA 3GWXA 4OIVA 3ZRAA 4IUIA 5KR9A 2ZXZA 3O1EA 4XI3A 3TKCA 4POJA 2ZFXA 1P8DA 2AYRA 3F5CB 4ZJWA 2ZK1A 1XVPA 3JZCA 3TX7B 3GN8A 3HODA 4KZMA 2AX7A 2QH6A 2VV4A 5G46A 3SZ1A 3UVVB 3KMGA 4IA1A 3WT6A 2Z4JA 3V9YA 2GIUA 1N83A 2QTUA 3ET3A 4OJBA 3JZBA 3V9VA 5JJMA 1K4WA 3ET2A 1S19A 2Q61A 3L1BA 5DKGA 2ZY0A 1X7BA 3WT5A 4TV1A 1T65A 1YA3A 3HZFA 3KWYA 4MGBB 2GPUA 2ZMHA 3GZ9A 4DK7A 3UP3A 1LBDA 2VV2A 4RMDA 2J7YA 3OZJA 5DV8A 3VJHA 1XLSE 4MGCA 5DTVA 2PIWA 4MG6A 2Q59A 1YOKA 1XP6A 4IVYA 4MG7B 1XP1A 4RUPA 2OZ7A 3E00D 3FLIA 1EREA 3L0EA 2P1UA 4LNXA 2ZK0A 3CS4A 5E1CA 3AURA 4J5XC 1ILHA 1K74A 4OC7A 1YP0A 4KZJA 3PLZA 4YPQA 3WWRA 3NOAA 1RJKA 5G43A 2I4JA 5DRMA 3B67A 1H9UA 3FEJA 1DKFB 2AM9A 4M8HA 5H1EA 5KCCA 2BAWA 4J24A 4XUMA 3LMPA 5E0XA 5L7HA 4PF3A 4POHA 2FSZA 2HWQA 4OH6A 1NQ0A 2ZXNA 3VN2A 4FHIA 4DOSA 4G1DA 3OS9A 4ZN7A 5DXBA 2Q5SA 4RUJA 4JYHA 4ZNTA 4WQPA 2Q6RA 1OVLB 4OKWA 1HG4A 2QNVA 5LGAA 5DUEA 3W0GA 2HAMA 5DUGA 1N46A 3AFRA 2QZOB 4OEDA 3VT4A 2BJ4A 1FM9A 1YYEA 3K6PA 3KFCA 1YIMA 1Z5XE 3AN4A 1NQ7A 3ET1A 5FQRA 5HJSA 3ZRBA 1QKUA 3VHUA 4NIEA 2AX9A 3IA6A 4ZNVA 2PIVA 3F5CA 3RLJA 5DX3B 4ZNUA 1XPCA 2B50A 3A3ZX 4OZTU 3UVVA 3KDTA 5KRHA 3D5FA 3OOFA 1GWRA 3GBKA 4R2UA 3IPSA 3L0JA 3VRUA 1T76A 3A9EB 3Q95B 4RUOX 3VHVA 1FM6A 4ZNHA 1PDUA 2NXXA 1NUOA 2QPYA 2AMBA 3ADVA 5EI1A 4N1YA 2VSTA 3B5RA 5DV3A 2Z4BA 1SR7A 4MGBA 1ZDUA 2B23A 1YOWA 3D57A 3UU7B 5AAUA 4IA2A 5DIDA 3OMQA 5L7EA 2Q7IA 5DZHA 3B0TA 1R1KA 1S9QA 4XTAA 4MG7A 4HEEX 3OMMA 5EJVA 4OIUA 3FALB 2VV0A 3SP9A 4J5WA 1L2IA 1UPWA 5DXRA 5I4VA 3GYUA 3B65A 4RMCA 3A40X 1YJEA 5CJ6A 5DXQA 5KCTA 5DMCA 2AA6A 2QR9A 3B66A 2REWA 4XLDA 4K4JA 1DKFA 2I0JA 4IV4A 2EWPA 1T73A 3NSQA 2PNUA 3BQDA 4E4QA 4Q50A 5FQSA 1I38A 3G8IA 4LTWA 2PIUA 1FCYA 4WHGA 4A4WA 3VSPA 2P1VA 1OVLA 1VJBA 5AWKA 3UUDB 4F9MA 3VSOA 2XYJA 4OFUA 4IW8A 4PPSA 1UPVA 2GPOA 3OMPA 1TXIA 2J7XA 2AA5A 3HVLA 3KDUA 2GP7A 3OSAA 1YMTA 2XYWA 4PP5A 3CWDA 3HC5A 2QZOA 3WGPA 5DK9A 1R5KA 3H0AA 3HO0A 3OLFA 4QL8A 3RUTA 5KRKA 2ZBSA 3V3EA 2Q8SA 2XYXA 2HWRA 5KCDA 1T79A 1EXAA 3AUNA 4PP3A 2PIXA 4QM0A 2PIOA 4RZFA 2IHQA 2Q5PA 3VTCA 3WFGA 3LBDA 4X1GA 3DCUA 4XAOA 5KRMA 2YFEA 3AZ3A 1ZEOA 5DVSA 1NAXA 1Z95A 3VRTA 3KYTA 4M8EA 3L03A 3WJ5A 3OOKA 2Q6JA 5DWGA 3V4AA 1K7LA 2PIQA 3K22A 1U9EA 3FS1A 2POGA 3OKIA 1TFCA 1T74A 1PCGA 3A9EA 3Q95A 4QJRA 5DVVA 3R8IA 2R40A 4IQRA 3OS8C 3AN3A 3VT5A 5APHA 2A3IA 2PITA 4DMAA 2GL8A 3HC6A 5AK2A 1OSHA 3CDPA 4J26A 5DI7A 5AVLA 5GIEA 4IS8A 4UDCA 5G44A 2YLOA 3UU7A 4MG8B 1MVCA 3HLVA 4ZJRA 4OFRA 3DZUD 3ILZA 2QA6A 3B3KA 4LSJA 2PINA 3AX8A 2ABIA 2ZLCA 3A2IA 3FALA 4G1ZA 4DK8A 4EM9A 3W0IA 5KRCA 2J4AA 2ZLAA 5G45A 4S15A 3RVFA 4N73A 4QK4A 2H77A 4ZN9A 1NAVA 1QKNA 3R5MA 4YMQA 1RK3A 1XDKB 2VV1B 2NW4A 5DWJA 2YLYA 4S0TA 3VRVA 1T7FA 5DP0A 3OMOA 5AYGA 4B7WA 2ZK5A 4MGDB 2PIPL 1BSXA 5FQPA 5KCEA 4Q0AC 5LWPA 4O8FA 4MGAB 5DKBA 3VT9A 1RDTA 5DXPA 4RE8A 3X1IA 1QKMA 3MNPA 1XOWA 3UUDA 3SP6A 5DY8A 3P89A 3S9SA 1XV9B 2FVJA 5KYJA 4NQAB 4EMAA 4TUZB 2XKWA 2I4PA 1NHZA 2HCDA 5DVCA 5APJA 4FN9A 1M2ZA 1R20A 2O9IA 3ADSA 2NXXE 4NUFA 3L0LA 3PRGA 4OKTA 2QGTA 1FCXA 3BC5A 3ERDA 4OZRU 4RMEA 5DL4A 1YINA 2O4JA 1PRGA 4FNEA 3IXPA 4IA7A 5DXKA 4OK1A 2Q1VA 4J5XA 3X36A 4JYGA 3ERTA 3VJIA 4S14A 5IZ0A 3TKMA 4K7AA 3A78A 3W0YA 4N5GA 1I7GA 4ZOMA 3FEIA 3BEJA 3OLLA 4DORA 3CLDA 4OLMA 4PLEA 1P93A 4IU7A 5DMFA 2O4RA 3DT3A 4ONIA 3WT7A 5AZVA 4KZIA 5HYKA 4CI4A 5C4UA 5DLRA 4OZTE 1G2NA 3VRWA 4UDAA 5DZ0A 5AWJA 3OZ0A 3X31A 3DZYD 4MG5A 2OCFA 4OILA 1S9PA 1K74D 5L11A 3ZR7A 1PQ6A 3B68A 1T5ZA 3OSWA 1MV9A 2GWXA 2Q7KA 3V9TA 3VJSA 2Q6SA 3A2JA 5DWEA 3UUAB 2J14A 1PQ9A 4E4KA 1X78A 3FC6B 5G5WA 3NSPA 3E7CA 3D90A 1ILGA 2HVCA 2I0GA 5HYRA 3RLLA 4L96A 2PIRA 2JF9A 3OMKA 2OAXA 3U9QA 2AB2A 1ZDTA 4YT1A 1A52A 3B1MA 1G5YA 2VV1A 4RZGA 1NYXA 5DZIA 3HQ5A 5G3JA 1GWXA 5DZ1A 4LBDA 2AMAA 2JFAB 3B0QA 3N00A 4MGDA 3E94A 2ZNOA 1SJ0A 2ATHA 2ZKCA 3VTBA 1SQNA 2ZNPA 3B0RA 4MGAA 1PZLA 4IWFA 3OLSA 2Q70A 2POBA 2ZK4A 4FHHA 1KNUA 4G20A 1FM9D 4CI5A 1G50A 2AX8A 2QXMA 2YATA 2ZNNA 1XV9A 3K23A 5ETHA 1YUCA 5KCWA 3RY9A 5E14A 3WJ4A 3DR1A 4G2IA 4OJ9A 4TUZA 3OKHA 5DYDA 5FQVA 3VT3A 5DUHA 3WMHA 3CJWA 4NB6A 1I37A 2QE4A 4DM8A 2QW4A 2ZMJA 3OAPA 4P6XA 2PRGA 3R8AA 4QE8A 2HB7A 1FM6D 4CSJA 2Q5GA 3CS6A 4WLBA 4PVUA 5DRJA 1QKTA 1Y9RA 5APKA 4ITFA 3PEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6G A;  3ADT A;  2LBD A;  2H79 A;  4JGV A;  5DU5 A;  3IPU A;  4IA3 A;  5KCU A;  3KMZ A;  3P8X A;  4G21 A;  1ERR A;  5DV6 A;  1XIU A;  4K6I A;  5DIG A;  5DX3 A;  1GS4 A;  5E19 A;  2ZMI A;  2ZK6 A;  1R1K D;  2FAI A;  3TY0 A;  3ADW A;  1EXX A;  5AVI A;  3R29 A;  3W0A A;  2B1V A;  2HAS A;  3E00 A;  2XHS A;  1KV6 A;  2Q3Y A;  2QA8 B;  3FUG A;  3GD2 A;  2OM9 A;  1M7W A;  3D24 A;  3MNO A;  2G44 A;  3OGT A;  4OKX A;  2P1T A;  1OSV A;  3UUA A;  1RKG A;  3W5Q A;  1OT7 A;  5M96 A;  2HB8 A;  3FC6 A;  4N8R A;  5EHJ A;  5GT4 A;  5KRO A;  1XQ3 A;  2AXA A;  3VI8 A;  2AO6 A;  4RAK A;  1XQC A;  3P0U A;  5GIC A;  5B5B A;  2V0V A;  3V3Q A;  2I4Z A;  2ZL9 A;  2R6W A;  3VT8 A;  4BCR A;  3B0W A;  4APU A;  4OJ4 A;  1S0Z A;  4PLD A;  3R5N A;  4REE A;  2JFA A;  3T03 A;  4LNW A;  2IOG A;  4PXM A;  4ZO1 B;  3VJT A;  2ACL B;  2NPA A;  5DKS A;  3V49 A;  5G42 A;  3H0A D;  2HFP A;  5EC9 A;  2AA7 A;  3GWS X;  3OS8 A;  1NDE A;  5KRF A;  1RKH A;  2PKL A;  5FQT A;  4IWC A;  1LV2 A;  2B1Z A;  2ZXM A;  4OKB A;  2HC4 A;  5SYZ A;  4JAZ A;  1E3G A;  2AA2 A;  2G5O A;  2P4Y A;  2YLP A;  2OVH A;  3F7D A;  5ACC A;  2QXS A;  4HLW A;  3FXV A;  4MDD A;  5KRI A;  5DXE A;  4RZE A;  3G9E A;  5DXG A;  3VT6 A;  1FD0 A;  4S0S A;  3H52 A;  5IXK A;  2R40 D;  5EGV A;  1ZKY A;  4ZNW A;  5A86 A;  3ZQT A;  4PWL A;  5AAV B;  5B41 A;  1NRL A;  3HM1 A;  4WHF A;  1M13 A;  2G0H A;  1SKX A;  3DZY A;  2G0G A;  4WPF A;  4JL4 A;  4OZR E;  3W5P A;  4A4V A;  5IAW A;  5DIE A;  5L7G A;  2QAB A;  3WTQ A;  4DQM A;  3UP0 A;  1XAP A;  3ADU A;  1T7R A;  3CDS A;  3PCU A;  4X1F A;  5DSH A;  4REF A;  5AZT A;  1XB7 A;  1G1U A;  3DCT A;  2OUZ A;  4ZI1 A;  2P7Z A;  1Q4X A;  2QSE A;  3VT7 A;  3RUU A;  1E3K A;  1T63 A;  3IPQ A;  2IOK A;  5DYB A;  2OVM A;  4IW6 A;  4OHA A;  4ITE A;  3R8D A;  3CS8 A;  3KBA A;  2QA8 A;  1XLS A;  5KD9 A;  4JYI A;  1GWQ A;  3A2H A;  2P7A A;  2YHD A;  1UHL B;  1FBY A;  1WM0 X;  5E15 A;  2AWH A;  4MG8 A;  2P7G A;  4MG9 B;  4G1Y A;  3QT0 A;  5HJP B;  1T7M A;  5HCV A;  1DB1 A;  1NQ2 A;  1RDT D;  3KMR A;  4Y29 A;  1Z5X U;  3OSI A;  4PRG A;  4R6S A;  5KRA A;  5KYA A;  2F4B A;  3L3Z A;  5DXM A;  2R6Y A;  3AUQ A;  5GID A;  3VTD A;  2ZK2 A;  4J5W C;  4P6W A;  5K13 A;  4OH5 A;  3ADX A;  1I7I A;  1XDK A;  2ACL A;  4OGH A;  3X1H A;  3G8O A;  5DKE A;  5C4T A;  4NY9 A;  3WFF A;  1R20 D;  4A2J A;  4ZO1 X;  1T7T A;  2QMV A;  3GYT A;  3M7R A;  1KKQ A;  5DWI A;  1XVP B;  1U3R A;  2Q1H A;  2VV4 B;  1PK5 A;  1IE9 A;  3IXP D;  4IV2 A;  3ET0 A;  1U3S A;  2Q7L A;  1A28 A;  3EYB A;  4WVD A;  1HJ1 A;  1N4H A;  5E7V A;  2YLQ A;  2VV3 A;  5JJM B;  3CTB A;  5C4O A;  3PO9 A;  5F9B A;  2QGW A;  1YY4 A;  1XP9 A;  1ZAF A;  2ZK3 A;  5DZ3 A;  4RWV A;  4TV1 B;  4OEZ A;  1X7J A;  2JJ3 A;  3IMY A;  2PJL A;  5C4S A;  5AAV A;  2Q7J A;  5KRL A;  1X7E A;  2YJD A;  5JI0 D;  1ZUC A;  5KCF A;  4OEY A;  4DM6 A;  1ZGY A;  2AAX A;  1IE8 A;  5E0W A;  2Q59 B;  3PBA A;  2W8Y A;  4YNK A;  1X76 A;  2HBH A;  3AZ1 A;  1FCZ A;  3AZ2 A;  3W0J A;  3W5R A;  2E2R A;  2ZNQ A;  3K8S A;  3G0W A;  4PP6 A;  3DZU A;  2GPP A;  3FUR A;  2P15 A;  3L3X A;  4QE6 A;  2AX6 A;  2VSR A;  4R06 A;  3W0C A;  1MZN A;  3KPZ A;  4RFW A;  1NQ1 A;  1S0X A;  4OEA A;  1UHL A;  3VHW A;  5KRJ A;  4PPP A;  3UUC A;  1XJ7 A;  4Q13 A;  5DXB B;  2GTK A;  3O1D A;  4XUH A;  5HZC A;  4E2J A;  2ZVT A;  4XHD A;  4MG9 A;  1Y0S A;  2Q60 A;  3DY6 A;  2NV7 A;  4OAR A;  3W5T A;  5HJP A;  1ZH7 A;  1Y0X X;  4IVW A;  3P88 A;  4L98 A;  1XNX A;  4ZNS A;  2V7C A;  4XT9 A;  3CQV A;  1U3Q A;  4FGY A;  2P54 A;  3R2A A;  1PQC A;  4UDD A;  5JY3 A;  1UOM A;  2BJ4 B;  2ZAS A;  2HAR A;  5EIT A;  1L2J A;  5ICK A;  3W0H A;  1X7R A;  1XZX X;  1XNN A;  2GPV A;  2YJA B;  3MNE A;  4G2H A;  5DWL A;  4UDB A;  3D6D A;  3GWX A;  4OIV A;  3ZRA A;  4IUI A;  5KR9 A;  2ZXZ A;  3O1E A;  4XI3 A;  3TKC A;  4POJ A;  2ZFX A;  1P8D A;  2AYR A;  3F5C B;  4ZJW A;  2ZK1 A;  1XVP A;  3JZC A;  3TX7 B;  3GN8 A;  3HOD A;  4KZM A;  2AX7 A;  2QH6 A;  2VV4 A;  5G46 A;  3SZ1 A;  3UVV B;  3KMG A;  4IA1 A;  3WT6 A;  2Z4J A;  3V9Y A;  2GIU A;  1N83 A;  2QTU A;  3ET3 A;  4OJB A;  3JZB A;  3V9V A;  5JJM A;  1K4W A;  3ET2 A;  1S19 A;  2Q61 A;  3L1B A;  5DKG A;  2ZY0 A;  1X7B A;  3WT5 A;  4TV1 A;  1T65 A;  1YA3 A;  3HZF A;  3KWY A;  4MGB B;  2GPU A;  2ZMH A;  3GZ9 A;  4DK7 A;  3UP3 A;  1LBD A;  2VV2 A;  4RMD A;  2J7Y A;  3OZJ A;  5DV8 A;  3VJH A;  1XLS E;  4MGC A;  5DTV A;  2PIW A;  4MG6 A;  2Q59 A;  1YOK A;  1XP6 A;  4IVY A;  4MG7 B;  1XP1 A;  4RUP A;  2OZ7 A;  3E00 D;  3FLI A;  1ERE A;  3L0E A;  2P1U A;  4LNX A;  2ZK0 A;  3CS4 A;  5E1C A;  3AUR A;  4J5X C;  1ILH A;  1K74 A;  4OC7 A;  1YP0 A;  4KZJ A;  3PLZ A;  4YPQ A;  3WWR A;  3NOA A;  1RJK A;  5G43 A;  2I4J A;  5DRM A;  3B67 A;  1H9U A;  3FEJ A;  1DKF B;  2AM9 A;  4M8H A;  5H1E A;  5KCC A;  2BAW A;  4J24 A;  4XUM A;  3LMP A;  5E0X A;  5L7H A;  4PF3 A;  4POH A;  2FSZ A;  2HWQ A;  4OH6 A;  1NQ0 A;  2ZXN A;  3VN2 A;  4FHI A;  4DOS A;  4G1D A;  3OS9 A;  4ZN7 A;  5DXB A;  2Q5S A;  4RUJ A;  4JYH A;  4ZNT A;  4WQP A;  2Q6R A;  1OVL B;  4OKW A;  1HG4 A;  2QNV A;  5LGA A;  5DUE A;  3W0G A;  2HAM A;  5DUG A;  1N46 A;  3AFR A;  2QZO B;  4OED A;  3VT4 A;  2BJ4 A;  1FM9 A;  1YYE A;  3K6P A;  3KFC A;  1YIM A;  1Z5X E;  3AN4 A;  1NQ7 A;  3ET1 A;  5FQR A;  5HJS A;  3ZRB A;  1QKU A;  3VHU A;  4NIE A;  2AX9 A;  3IA6 A;  4ZNV A;  2PIV A;  3F5C A;  3RLJ A;  5DX3 B;  4ZNU A;  1XPC A;  2B50 A;  3A3Z X;  4OZT U;  3UVV A;  3KDT A;  5KRH A;  3D5F A;  3OOF A;  1GWR A;  3GBK A;  4R2U A;  3IPS A;  3L0J A;  3VRU A;  1T76 A;  3A9E B;  3Q95 B;  4RUO X;  3VHV A;  1FM6 A;  4ZNH A;  1PDU A;  2NXX A;  1NUO A;  2QPY A;  2AMB A;  3ADV A;  5EI1 A;  4N1Y A;  2VST A;  3B5R A;  5DV3 A;  2Z4B A;  1SR7 A;  4MGB A;  1ZDU A;  2B23 A;  1YOW A;  3D57 A;  3UU7 B;  5AAU A;  4IA2 A;  5DID A;  3OMQ A;  5L7E A;  2Q7I A;  5DZH A;  3B0T A;  1R1K A;  1S9Q A;  4XTA A;  4MG7 A;  4HEE X;  3OMM A;  5EJV A;  4OIU A;  3FAL B;  2VV0 A;  3SP9 A;  4J5W A;  1L2I A;  1UPW A;  5DXR A;  5I4V A;  3GYU A;  3B65 A;  4RMC A;  3A40 X;  1YJE A;  5CJ6 A;  5DXQ A;  5KCT A;  5DMC A;  2AA6 A;  2QR9 A;  3B66 A;  2REW A;  4XLD A;  4K4J A;  1DKF A;  2I0J A;  4IV4 A;  2EWP A;  1T73 A;  3NSQ A;  2PNU A;  3BQD A;  4E4Q A;  4Q50 A;  5FQS A;  1I38 A;  3G8I A;  4LTW A;  2PIU A;  1FCY A;  4WHG A;  4A4W A;  3VSP A;  2P1V A;  1OVL A;  1VJB A;  5AWK A;  3UUD B;  4F9M A;  3VSO A;  2XYJ A;  4OFU A;  4IW8 A;  4PPS A;  1UPV A;  2GPO A;  3OMP A;  1TXI A;  2J7X A;  2AA5 A;  3HVL A;  3KDU A;  2GP7 A;  3OSA A;  1YMT A;  2XYW A;  4PP5 A;  3CWD A;  3HC5 A;  2QZO A;  3WGP A;  5DK9 A;  1R5K A;  3H0A A;  3HO0 A;  3OLF A;  4QL8 A;  3RUT A;  5KRK A;  2ZBS A;  3V3E A;  2Q8S A;  2XYX A;  2HWR A;  5KCD A;  1T79 A;  1EXA A;  3AUN A;  4PP3 A;  2PIX A;  4QM0 A;  2PIO A;  4RZF A;  2IHQ A;  2Q5P A;  3VTC A;  3WFG A;  3LBD A;  4X1G A;  3DCU A;  4XAO A;  5KRM A;  2YFE A;  3AZ3 A;  1ZEO A;  5DVS A;  1NAX A;  1Z95 A;  3VRT A;  3KYT A;  4M8E A;  3L03 A;  3WJ5 A;  3OOK A;  2Q6J A;  5DWG A;  3V4A A;  1K7L A;  2PIQ A;  3K22 A;  1U9E A;  3FS1 A;  2POG A;  3OKI A;  1TFC A;  1T74 A;  1PCG A;  3A9E A;  3Q95 A;  4QJR A;  5DVV A;  3R8I A;  2R40 A;  4IQR A;  3OS8 C;  3AN3 A;  3VT5 A;  5APH A;  2A3I A;  2PIT A;  4DMA A;  2GL8 A;  3HC6 A;  5AK2 A;  1OSH A;  3CDP A;  4J26 A;  5DI7 A;  5AVL A;  5GIE A;  4IS8 A;  4UDC A;  5G44 A;  2YLO A;  3UU7 A;  4MG8 B;  1MVC A;  3HLV A;  4ZJR A;  4OFR A;  3DZU D;  3ILZ A;  2QA6 A;  3B3K A;  4LSJ A;  2PIN A;  3AX8 A;  2ABI A;  2ZLC A;  3A2I A;  3FAL A;  4G1Z A;  4DK8 A;  4EM9 A;  3W0I A;  5KRC A;  2J4A A;  2ZLA A;  5G45 A;  4S15 A;  3RVF A;  4N73 A;  4QK4 A;  2H77 A;  4ZN9 A;  1NAV A;  1QKN A;  3R5M A;  4YMQ A;  1RK3 A;  1XDK B;  2VV1 B;  2NW4 A;  5DWJ A;  2YLY A;  4S0T A;  3VRV A;  1T7F A;  5DP0 A;  3OMO A;  5AYG A;  4B7W A;  2ZK5 A;  4MGD B;  2PIP L;  1BSX A;  5FQP A;  5KCE A;  4Q0A C;  5LWP A;  4O8F A;  4MGA B;  5DKB A;  3VT9 A;  1RDT A;  5DXP A;  4RE8 A;  3X1I A;  1QKM A;  3MNP A;  1XOW A;  3UUD A;  3SP6 A;  5DY8 A;  3P89 A;  3S9S A;  1XV9 B;  2FVJ A;  5KYJ A;  4NQA B;  4EMA A;  4TUZ B;  2XKW A;  2I4P A;  1NHZ A;  2HCD A;  5DVC A;  5APJ A;  4FN9 A;  1M2Z A;  1R20 A;  2O9I A;  3ADS A;  2NXX E;  4NUF A;  3L0L A;  3PRG A;  4OKT A;  2QGT A;  1FCX A;  3BC5 A;  3ERD A;  4OZR U;  4RME A;  5DL4 A;  1YIN A;  2O4J A;  1PRG A;  4FNE A;  3IXP A;  4IA7 A;  5DXK A;  4OK1 A;  2Q1V A;  4J5X A;  3X36 A;  4JYG A;  3ERT A;  3VJI A;  4S14 A;  5IZ0 A;  3TKM A;  4K7A A;  3A78 A;  3W0Y A;  4N5G A;  1I7G A;  4ZOM A;  3FEI A;  3BEJ A;  3OLL A;  4DOR A;  3CLD A;  4OLM A;  4PLE A;  1P93 A;  4IU7 A;  5DMF A;  2O4R A;  3DT3 A;  4ONI A;  3WT7 A;  5AZV A;  4KZI A;  5HYK A;  4CI4 A;  5C4U A;  5DLR A;  4OZT E;  1G2N A;  3VRW A;  4UDA A;  5DZ0 A;  5AWJ A;  3OZ0 A;  3X31 A;  3DZY D;  4MG5 A;  2OCF A;  4OIL A;  1S9P A;  1K74 D;  5L11 A;  3ZR7 A;  1PQ6 A;  3B68 A;  1T5Z A;  3OSW A;  1MV9 A;  2GWX A;  2Q7K A;  3V9T A;  3VJS A;  2Q6S A;  3A2J A;  5DWE A;  3UUA B;  2J14 A;  1PQ9 A;  4E4K A;  1X78 A;  3FC6 B;  5G5W A;  3NSP A;  3E7C A;  3D90 A;  1ILG A;  2HVC A;  2I0G A;  5HYR A;  3RLL A;  4L96 A;  2PIR A;  2JF9 A;  3OMK A;  2OAX A;  3U9Q A;  2AB2 A;  1ZDT A;  4YT1 A;  1A52 A;  3B1M A;  1G5Y A;  2VV1 A;  4RZG A;  1NYX A;  5DZI A;  3HQ5 A;  5G3J A;  1GWX A;  5DZ1 A;  4LBD A;  2AMA A;  2JFA B;  3B0Q A;  3N00 A;  4MGD A;  3E94 A;  2ZNO A;  1SJ0 A;  2ATH A;  2ZKC A;  3VTB A;  1SQN A;  2ZNP A;  3B0R A;  4MGA A;  1PZL A;  4IWF A;  3OLS A;  2Q70 A;  2POB A;  2ZK4 A;  4FHH A;  1KNU A;  4G20 A;  1FM9 D;  4CI5 A;  1G50 A;  2AX8 A;  2QXM A;  2YAT A;  2ZNN A;  1XV9 A;  3K23 A;  5ETH A;  1YUC A;  5KCW A;  3RY9 A;  5E14 A;  3WJ4 A;  3DR1 A;  4G2I A;  4OJ9 A;  4TUZ A;  3OKH A;  5DYD A;  5FQV A;  3VT3 A;  5DUH A;  3WMH A;  3CJW A;  4NB6 A;  1I37 A;  2QE4 A;  4DM8 A;  2QW4 A;  2ZMJ A;  3OAP A;  4P6X A;  2PRG A;  3R8A A;  4QE8 A;  2HB7 A;  1FM6 D;  4CSJ A;  2Q5G A;  3CS6 A;  4WLB A;  4PVU A;  5DRJ A;  1QKT A;  1Y9R A;  5APK A;  4ITF A;  3PEQ A; 
#chains in the Genus database with same CATH topology
 1R6G A;  3ADT A;  2LBD A;  2H79 A;  4JGV A;  5DU5 A;  3IPU A;  4IA3 A;  5KCU A;  3KMZ A;  3P8X A;  4G21 A;  1ERR A;  5DV6 A;  1XIU A;  4K6I A;  5DIG A;  5DX3 A;  1GS4 A;  5E19 A;  2ZMI A;  2ZK6 A;  1R1K D;  2FAI A;  3TY0 A;  3ADW A;  1EXX A;  5AVI A;  3R29 A;  3W0A A;  2B1V A;  2HAS A;  3E00 A;  2XHS A;  1KV6 A;  2Q3Y A;  2QA8 B;  3FUG A;  3GD2 A;  2OM9 A;  1M7W A;  3D24 A;  3MNO A;  2G44 A;  3OGT A;  4OKX A;  2P1T A;  1OSV A;  3UUA A;  1RKG A;  3W5Q A;  1OT7 A;  5M96 A;  2HB8 A;  3FC6 A;  4N8R A;  5EHJ A;  5GT4 A;  5KRO A;  1XQ3 A;  2AXA A;  3VI8 A;  2AO6 A;  4RAK A;  1XQC A;  3P0U A;  5GIC A;  5B5B A;  2V0V A;  3V3Q A;  2I4Z A;  2ZL9 A;  2R6W A;  3VT8 A;  4BCR A;  3B0W A;  4APU A;  4OJ4 A;  1S0Z A;  4PLD A;  3R5N A;  4REE A;  2JFA A;  3T03 A;  4LNW A;  2IOG A;  4PXM A;  4ZO1 B;  3VJT A;  2ACL B;  2NPA A;  5DKS A;  3V49 A;  5G42 A;  3H0A D;  2HFP A;  5EC9 A;  2AA7 A;  3GWS X;  3OS8 A;  1NDE A;  5KRF A;  1RKH A;  2PKL A;  5FQT A;  4IWC A;  1LV2 A;  2B1Z A;  2ZXM A;  4OKB A;  2HC4 A;  5SYZ A;  4JAZ A;  1E3G A;  2AA2 A;  2G5O A;  2P4Y A;  2YLP A;  2OVH A;  3F7D A;  5ACC A;  2QXS A;  4HLW A;  3FXV A;  4MDD A;  5KRI A;  5DXE A;  4RZE A;  3G9E A;  5DXG A;  3VT6 A;  1FD0 A;  4S0S A;  3H52 A;  5IXK A;  2R40 D;  5EGV A;  1ZKY A;  4ZNW A;  5A86 A;  3ZQT A;  4PWL A;  5AAV B;  5B41 A;  1NRL A;  3HM1 A;  4WHF A;  1M13 A;  2G0H A;  1SKX A;  3DZY A;  2G0G A;  4WPF A;  4JL4 A;  4OZR E;  3W5P A;  4A4V A;  5IAW A;  5DIE A;  5L7G A;  2QAB A;  3WTQ A;  4DQM A;  3UP0 A;  1XAP A;  3ADU A;  1T7R A;  3CDS A;  3PCU A;  4X1F A;  5DSH A;  4REF A;  5AZT A;  1XB7 A;  1G1U A;  3DCT A;  2OUZ A;  4ZI1 A;  2P7Z A;  1Q4X A;  2QSE A;  3VT7 A;  3RUU A;  1E3K A;  1T63 A;  3IPQ A;  2IOK A;  5DYB A;  2OVM A;  4IW6 A;  4OHA A;  4ITE A;  3R8D A;  3CS8 A;  3KBA A;  2QA8 A;  1XLS A;  5KD9 A;  4JYI A;  1GWQ A;  3A2H A;  2P7A A;  2YHD A;  1UHL B;  1FBY A;  1WM0 X;  5E15 A;  2AWH A;  4MG8 A;  2P7G A;  4MG9 B;  4G1Y A;  3QT0 A;  5HJP B;  1T7M A;  5HCV A;  1DB1 A;  1NQ2 A;  1RDT D;  3KMR A;  4Y29 A;  1Z5X U;  3OSI A;  4PRG A;  4R6S A;  5KRA A;  5KYA A;  2F4B A;  3L3Z A;  5DXM A;  2R6Y A;  3AUQ A;  5GID A;  3VTD A;  2ZK2 A;  4J5W C;  4P6W A;  5K13 A;  4OH5 A;  3ADX A;  1I7I A;  1XDK A;  2ACL A;  4OGH A;  3X1H A;  3G8O A;  5DKE A;  5C4T A;  4NY9 A;  3WFF A;  1R20 D;  4A2J A;  4ZO1 X;  1T7T A;  2QMV A;  3GYT A;  3M7R A;  1KKQ A;  5DWI A;  1XVP B;  1U3R A;  2Q1H A;  2VV4 B;  1PK5 A;  1IE9 A;  3IXP D;  4IV2 A;  3ET0 A;  1U3S A;  2Q7L A;  1A28 A;  3EYB A;  4WVD A;  1HJ1 A;  1N4H A;  5E7V A;  2YLQ A;  2VV3 A;  5JJM B;  3CTB A;  5C4O A;  3PO9 A;  5F9B A;  2QGW A;  1YY4 A;  1XP9 A;  1ZAF A;  2ZK3 A;  5DZ3 A;  4RWV A;  4TV1 B;  4OEZ A;  1X7J A;  2JJ3 A;  3IMY A;  2PJL A;  5C4S A;  5AAV A;  2Q7J A;  5KRL A;  1X7E A;  2YJD A;  5JI0 D;  1ZUC A;  5KCF A;  4OEY A;  4DM6 A;  1ZGY A;  2AAX A;  1IE8 A;  5E0W A;  2Q59 B;  3PBA A;  2W8Y A;  4YNK A;  1X76 A;  2HBH A;  3AZ1 A;  1FCZ A;  3AZ2 A;  3W0J A;  3W5R A;  2E2R A;  2ZNQ A;  3K8S A;  3G0W A;  4PP6 A;  3DZU A;  2GPP A;  3FUR A;  2P15 A;  3L3X A;  4QE6 A;  2AX6 A;  2VSR A;  4R06 A;  3W0C A;  1MZN A;  3KPZ A;  4RFW A;  1NQ1 A;  1S0X A;  4OEA A;  1UHL A;  3VHW A;  5KRJ A;  4PPP A;  3UUC A;  1XJ7 A;  4Q13 A;  5DXB B;  2GTK A;  3O1D A;  4XUH A;  5HZC A;  4E2J A;  2ZVT A;  4XHD A;  4MG9 A;  1Y0S A;  2Q60 A;  3DY6 A;  2NV7 A;  4OAR A;  3W5T A;  5HJP A;  1ZH7 A;  1Y0X X;  4IVW A;  3P88 A;  4L98 A;  1XNX A;  4ZNS A;  2V7C A;  4XT9 A;  3CQV A;  1U3Q A;  4FGY A;  2P54 A;  3R2A A;  1PQC A;  4UDD A;  5JY3 A;  1UOM A;  2BJ4 B;  2ZAS A;  2HAR A;  5EIT A;  1L2J A;  5ICK A;  3W0H A;  1X7R A;  1XZX X;  1XNN A;  2GPV A;  2YJA B;  3MNE A;  4G2H A;  5DWL A;  4UDB A;  3D6D A;  3GWX A;  4OIV A;  3ZRA A;  4IUI A;  5KR9 A;  2ZXZ A;  3O1E A;  4XI3 A;  3TKC A;  4POJ A;  2ZFX A;  1P8D A;  2AYR A;  3F5C B;  4ZJW A;  2ZK1 A;  1XVP A;  3JZC A;  3TX7 B;  3GN8 A;  3HOD A;  4KZM A;  2AX7 A;  2QH6 A;  2VV4 A;  5G46 A;  3SZ1 A;  3UVV B;  3KMG A;  4IA1 A;  3WT6 A;  2Z4J A;  3V9Y A;  2GIU A;  1N83 A;  2QTU A;  3ET3 A;  4OJB A;  3JZB A;  3V9V A;  5JJM A;  1K4W A;  3ET2 A;  1S19 A;  2Q61 A;  3L1B A;  5DKG A;  2ZY0 A;  1X7B A;  3WT5 A;  4TV1 A;  1T65 A;  1YA3 A;  3HZF A;  3KWY A;  4MGB B;  2GPU A;  2ZMH A;  3GZ9 A;  4DK7 A;  3UP3 A;  1LBD A;  2VV2 A;  4RMD A;  2J7Y A;  3OZJ A;  5DV8 A;  3VJH A;  1XLS E;  4MGC A;  5DTV A;  2PIW A;  4MG6 A;  2Q59 A;  1YOK A;  1XP6 A;  4IVY A;  4MG7 B;  1XP1 A;  4RUP A;  2OZ7 A;  3E00 D;  3FLI A;  1ERE A;  3L0E A;  2P1U A;  4LNX A;  2ZK0 A;  3CS4 A;  5E1C A;  3AUR A;  4J5X C;  1ILH A;  1K74 A;  4OC7 A;  1YP0 A;  4KZJ A;  3PLZ A;  4YPQ A;  3WWR A;  3NOA A;  1RJK A;  5G43 A;  2I4J A;  5DRM A;  3B67 A;  1H9U A;  3FEJ A;  1DKF B;  2AM9 A;  4M8H A;  5H1E A;  5KCC A;  2BAW A;  4J24 A;  4XUM A;  3LMP A;  5E0X A;  5L7H A;  4PF3 A;  4POH A;  2FSZ A;  2HWQ A;  4OH6 A;  1NQ0 A;  2ZXN A;  3VN2 A;  4FHI A;  4DOS A;  4G1D A;  3OS9 A;  4ZN7 A;  5DXB A;  2Q5S A;  4RUJ A;  4JYH A;  4ZNT A;  4WQP A;  2Q6R A;  1OVL B;  4OKW A;  1HG4 A;  2QNV A;  5LGA A;  5DUE A;  3W0G A;  2HAM A;  5DUG A;  1N46 A;  3AFR A;  2QZO B;  4OED A;  3VT4 A;  2BJ4 A;  1FM9 A;  1YYE A;  3K6P A;  3KFC A;  1YIM A;  1Z5X E;  3AN4 A;  1NQ7 A;  3ET1 A;  5FQR A;  5HJS A;  3ZRB A;  1QKU A;  3VHU A;  4NIE A;  2AX9 A;  3IA6 A;  4ZNV A;  2PIV A;  3F5C A;  3RLJ A;  5DX3 B;  4ZNU A;  1XPC A;  2B50 A;  3A3Z X;  4OZT U;  3UVV A;  3KDT A;  5KRH A;  3D5F A;  3OOF A;  1GWR A;  3GBK A;  4R2U A;  3IPS A;  3L0J A;  3VRU A;  1T76 A;  3A9E B;  3Q95 B;  4RUO X;  3VHV A;  1FM6 A;  4ZNH A;  1PDU A;  2NXX A;  1NUO A;  2QPY A;  2AMB A;  3ADV A;  5EI1 A;  4N1Y A;  2VST A;  3B5R A;  5DV3 A;  2Z4B A;  1SR7 A;  4MGB A;  1ZDU A;  2B23 A;  1YOW A;  3D57 A;  3UU7 B;  5AAU A;  4IA2 A;  5DID A;  3OMQ A;  5L7E A;  2Q7I A;  5DZH A;  3B0T A;  1R1K A;  1S9Q A;  4XTA A;  4MG7 A;  4HEE X;  3OMM A;  5EJV A;  4OIU A;  3FAL B;  2VV0 A;  3SP9 A;  4J5W A;  1L2I A;  1UPW A;  5DXR A;  5I4V A;  3GYU A;  3B65 A;  4RMC A;  3A40 X;  1YJE A;  5CJ6 A;  5DXQ A;  5KCT A;  5DMC A;  2AA6 A;  2QR9 A;  3B66 A;  2REW A;  4XLD A;  4K4J A;  1DKF A;  2I0J A;  4IV4 A;  2EWP A;  1T73 A;  3NSQ A;  2PNU A;  3BQD A;  4E4Q A;  4Q50 A;  5FQS A;  1I38 A;  3G8I A;  4LTW A;  2PIU A;  1FCY A;  4WHG A;  4A4W A;  3VSP A;  2P1V A;  1OVL A;  1VJB A;  5AWK A;  3UUD B;  4F9M A;  3VSO A;  2XYJ A;  4OFU A;  4IW8 A;  4PPS A;  1UPV A;  2GPO A;  3OMP A;  1TXI A;  2J7X A;  2AA5 A;  3HVL A;  3KDU A;  2GP7 A;  3OSA A;  1YMT A;  2XYW A;  4PP5 A;  3CWD A;  3HC5 A;  2QZO A;  3WGP A;  5DK9 A;  1R5K A;  3H0A A;  3HO0 A;  3OLF A;  4QL8 A;  3RUT A;  5KRK A;  2ZBS A;  3V3E A;  2Q8S A;  2XYX A;  2HWR A;  5KCD A;  1T79 A;  1EXA A;  3AUN A;  4PP3 A;  2PIX A;  4QM0 A;  2PIO A;  4RZF A;  2IHQ A;  2Q5P A;  3VTC A;  3WFG A;  3LBD A;  4X1G A;  3DCU A;  4XAO A;  5KRM A;  2YFE A;  3AZ3 A;  1ZEO A;  5DVS A;  1NAX A;  1Z95 A;  3VRT A;  3KYT A;  4M8E A;  3L03 A;  3WJ5 A;  3OOK A;  2Q6J A;  5DWG A;  3V4A A;  1K7L A;  2PIQ A;  3K22 A;  1U9E A;  3FS1 A;  2POG A;  3OKI A;  1TFC A;  1T74 A;  1PCG A;  3A9E A;  3Q95 A;  4QJR A;  5DVV A;  3R8I A;  2R40 A;  4IQR A;  3OS8 C;  3AN3 A;  3VT5 A;  5APH A;  2A3I A;  2PIT A;  4DMA A;  2GL8 A;  3HC6 A;  5AK2 A;  1OSH A;  3CDP A;  4J26 A;  5DI7 A;  5AVL A;  5GIE A;  4IS8 A;  4UDC A;  5G44 A;  2YLO A;  3UU7 A;  4MG8 B;  1MVC A;  3HLV A;  4ZJR A;  4OFR A;  3DZU D;  3ILZ A;  2QA6 A;  3B3K A;  4LSJ A;  2PIN A;  3AX8 A;  2ABI A;  2ZLC A;  3A2I A;  3FAL A;  4G1Z A;  4DK8 A;  4EM9 A;  3W0I A;  5KRC A;  2J4A A;  2ZLA A;  5G45 A;  4S15 A;  3RVF A;  4N73 A;  4QK4 A;  2H77 A;  4ZN9 A;  1NAV A;  1QKN A;  3R5M A;  4YMQ A;  1RK3 A;  1XDK B;  2VV1 B;  2NW4 A;  5DWJ A;  2YLY A;  4S0T A;  3VRV A;  1T7F A;  5DP0 A;  3OMO A;  5AYG A;  4B7W A;  2ZK5 A;  4MGD B;  2PIP L;  1BSX A;  5FQP A;  5KCE A;  4Q0A C;  5LWP A;  4O8F A;  4MGA B;  5DKB A;  3VT9 A;  1RDT A;  5DXP A;  4RE8 A;  3X1I A;  1QKM A;  3MNP A;  1XOW A;  3UUD A;  3SP6 A;  5DY8 A;  3P89 A;  3S9S A;  1XV9 B;  2FVJ A;  5KYJ A;  4NQA B;  4EMA A;  4TUZ B;  2XKW A;  2I4P A;  1NHZ A;  2HCD A;  5DVC A;  5APJ A;  4FN9 A;  1M2Z A;  1R20 A;  2O9I A;  3ADS A;  2NXX E;  4NUF A;  3L0L A;  3PRG A;  4OKT A;  2QGT A;  1FCX A;  3BC5 A;  3ERD A;  4OZR U;  4RME A;  5DL4 A;  1YIN A;  2O4J A;  1PRG A;  4FNE A;  3IXP A;  4IA7 A;  5DXK A;  4OK1 A;  2Q1V A;  4J5X A;  3X36 A;  4JYG A;  3ERT A;  3VJI A;  4S14 A;  5IZ0 A;  3TKM A;  4K7A A;  3A78 A;  3W0Y A;  4N5G A;  1I7G A;  4ZOM A;  3FEI A;  3BEJ A;  3OLL A;  4DOR A;  3CLD A;  4OLM A;  4PLE A;  1P93 A;  4IU7 A;  5DMF A;  2O4R A;  3DT3 A;  4ONI A;  3WT7 A;  5AZV A;  4KZI A;  5HYK A;  4CI4 A;  5C4U A;  5DLR A;  4OZT E;  1G2N A;  3VRW A;  4UDA A;  5DZ0 A;  5AWJ A;  3OZ0 A;  3X31 A;  3DZY D;  4MG5 A;  2OCF A;  4OIL A;  1S9P A;  1K74 D;  5L11 A;  3ZR7 A;  1PQ6 A;  3B68 A;  1T5Z A;  3OSW A;  1MV9 A;  2GWX A;  2Q7K A;  3V9T A;  3VJS A;  2Q6S A;  3A2J A;  5DWE A;  3UUA B;  2J14 A;  1PQ9 A;  4E4K A;  1X78 A;  3FC6 B;  5G5W A;  3NSP A;  3E7C A;  3D90 A;  1ILG A;  2HVC A;  2I0G A;  5HYR A;  3RLL A;  4L96 A;  2PIR A;  2JF9 A;  3OMK A;  2OAX A;  3U9Q A;  2AB2 A;  1ZDT A;  4YT1 A;  1A52 A;  3B1M A;  1G5Y A;  2VV1 A;  4RZG A;  1NYX A;  5DZI A;  3HQ5 A;  5G3J A;  1GWX A;  5DZ1 A;  4LBD A;  2AMA A;  2JFA B;  3B0Q A;  3N00 A;  4MGD A;  3E94 A;  2ZNO A;  1SJ0 A;  2ATH A;  2ZKC A;  3VTB A;  1SQN A;  2ZNP A;  3B0R A;  4MGA A;  1PZL A;  4IWF A;  3OLS A;  2Q70 A;  2POB A;  2ZK4 A;  4FHH A;  1KNU A;  4G20 A;  1FM9 D;  4CI5 A;  1G50 A;  2AX8 A;  2QXM A;  2YAT A;  2ZNN A;  1XV9 A;  3K23 A;  5ETH A;  1YUC A;  5KCW A;  3RY9 A;  5E14 A;  3WJ4 A;  3DR1 A;  4G2I A;  4OJ9 A;  4TUZ A;  3OKH A;  5DYD A;  5FQV A;  3VT3 A;  5DUH A;  3WMH A;  3CJW A;  4NB6 A;  1I37 A;  2QE4 A;  4DM8 A;  2QW4 A;  2ZMJ A;  3OAP A;  4P6X A;  2PRG A;  3R8A A;  4QE8 A;  2HB7 A;  1FM6 D;  4CSJ A;  2Q5G A;  3CS6 A;  4WLB A;  4PVU A;  5DRJ A;  1QKT A;  1Y9R A;  5APK A;  4ITF A;  3PEQ A; 
#chains in the Genus database with same CATH homology
 1R6G A;  3ADT A;  2LBD A;  2H79 A;  4JGV A;  5DU5 A;  3IPU A;  4IA3 A;  5KCU A;  3KMZ A;  3P8X A;  4G21 A;  1ERR A;  5DV6 A;  1XIU A;  4K6I A;  5DIG A;  5DX3 A;  1GS4 A;  5E19 A;  2ZMI A;  2ZK6 A;  1R1K D;  2FAI A;  3TY0 A;  3ADW A;  1EXX A;  5AVI A;  3R29 A;  3W0A A;  2B1V A;  2HAS A;  3E00 A;  2XHS A;  1KV6 A;  2Q3Y A;  2QA8 B;  3FUG A;  3GD2 A;  2OM9 A;  1M7W A;  3D24 A;  3MNO A;  2G44 A;  3OGT A;  4OKX A;  2P1T A;  1OSV A;  3UUA A;  1RKG A;  3W5Q A;  1OT7 A;  5M96 A;  2HB8 A;  3FC6 A;  4N8R A;  5EHJ A;  5GT4 A;  5KRO A;  1XQ3 A;  2AXA A;  3VI8 A;  2AO6 A;  4RAK A;  1XQC A;  3P0U A;  5GIC A;  5B5B A;  2V0V A;  3V3Q A;  2I4Z A;  2ZL9 A;  2R6W A;  3VT8 A;  4BCR A;  3B0W A;  4APU A;  4OJ4 A;  1S0Z A;  4PLD A;  3R5N A;  4REE A;  2JFA A;  3T03 A;  4LNW A;  2IOG A;  4PXM A;  4ZO1 B;  3VJT A;  2ACL B;  2NPA A;  5DKS A;  3V49 A;  5G42 A;  3H0A D;  2HFP A;  5EC9 A;  2AA7 A;  3GWS X;  3OS8 A;  1NDE A;  5KRF A;  1RKH A;  2PKL A;  5FQT A;  4IWC A;  1LV2 A;  2B1Z A;  2ZXM A;  4OKB A;  2HC4 A;  5SYZ A;  4JAZ A;  1E3G A;  2AA2 A;  2G5O A;  2P4Y A;  2YLP A;  2OVH A;  3F7D A;  5ACC A;  2QXS A;  4HLW A;  3FXV A;  4MDD A;  5KRI A;  5DXE A;  4RZE A;  3G9E A;  5DXG A;  3VT6 A;  1FD0 A;  4S0S A;  3H52 A;  5IXK A;  2R40 D;  5EGV A;  1ZKY A;  4ZNW A;  5A86 A;  3ZQT A;  4PWL A;  5AAV B;  5B41 A;  1NRL A;  3HM1 A;  4WHF A;  1M13 A;  2G0H A;  1SKX A;  3DZY A;  2G0G A;  4WPF A;  4JL4 A;  4OZR E;  3W5P A;  4A4V A;  5IAW A;  5DIE A;  5L7G A;  2QAB A;  3WTQ A;  4DQM A;  3UP0 A;  1XAP A;  3ADU A;  1T7R A;  3CDS A;  3PCU A;  4X1F A;  5DSH A;  4REF A;  5AZT A;  1XB7 A;  1G1U A;  3DCT A;  2OUZ A;  4ZI1 A;  2P7Z A;  1Q4X A;  2QSE A;  3VT7 A;  3RUU A;  1E3K A;  1T63 A;  3IPQ A;  2IOK A;  5DYB A;  2OVM A;  4IW6 A;  4OHA A;  4ITE A;  3R8D A;  3CS8 A;  3KBA A;  2QA8 A;  1XLS A;  5KD9 A;  4JYI A;  1GWQ A;  3A2H A;  2P7A A;  2YHD A;  1UHL B;  1FBY A;  1WM0 X;  5E15 A;  2AWH A;  4MG8 A;  2P7G A;  4MG9 B;  4G1Y A;  3QT0 A;  5HJP B;  1T7M A;  5HCV A;  1DB1 A;  1NQ2 A;  1RDT D;  3KMR A;  4Y29 A;  1Z5X U;  3OSI A;  4PRG A;  4R6S A;  5KRA A;  5KYA A;  2F4B A;  3L3Z A;  5DXM A;  2R6Y A;  3AUQ A;  5GID A;  3VTD A;  2ZK2 A;  4J5W C;  4P6W A;  5K13 A;  4OH5 A;  3ADX A;  1I7I A;  1XDK A;  2ACL A;  4OGH A;  3X1H A;  3G8O A;  5DKE A;  5C4T A;  4NY9 A;  3WFF A;  1R20 D;  4A2J A;  4ZO1 X;  1T7T A;  2QMV A;  3GYT A;  3M7R A;  1KKQ A;  5DWI A;  1XVP B;  1U3R A;  2Q1H A;  2VV4 B;  1PK5 A;  1IE9 A;  3IXP D;  4IV2 A;  3ET0 A;  1U3S A;  2Q7L A;  1A28 A;  3EYB A;  4WVD A;  1HJ1 A;  1N4H A;  5E7V A;  2YLQ A;  2VV3 A;  5JJM B;  3CTB A;  5C4O A;  3PO9 A;  5F9B A;  2QGW A;  1YY4 A;  1XP9 A;  1ZAF A;  2ZK3 A;  5DZ3 A;  4RWV A;  4TV1 B;  4OEZ A;  1X7J A;  2JJ3 A;  3IMY A;  2PJL A;  5C4S A;  5AAV A;  2Q7J A;  5KRL A;  1X7E A;  2YJD A;  5JI0 D;  1ZUC A;  5KCF A;  4OEY A;  4DM6 A;  1ZGY A;  2AAX A;  1IE8 A;  5E0W A;  2Q59 B;  3PBA A;  2W8Y A;  4YNK A;  1X76 A;  2HBH A;  3AZ1 A;  1FCZ A;  3AZ2 A;  3W0J A;  3W5R A;  2E2R A;  2ZNQ A;  3K8S A;  3G0W A;  4PP6 A;  3DZU A;  2GPP A;  3FUR A;  2P15 A;  3L3X A;  4QE6 A;  2AX6 A;  2VSR A;  4R06 A;  3W0C A;  1MZN A;  3KPZ A;  4RFW A;  1NQ1 A;  1S0X A;  4OEA A;  1UHL A;  3VHW A;  5KRJ A;  4PPP A;  3UUC A;  1XJ7 A;  4Q13 A;  5DXB B;  2GTK A;  3O1D A;  4XUH A;  5HZC A;  4E2J A;  2ZVT A;  4XHD A;  4MG9 A;  1Y0S A;  2Q60 A;  3DY6 A;  2NV7 A;  4OAR A;  3W5T A;  5HJP A;  1ZH7 A;  1Y0X X;  4IVW A;  3P88 A;  4L98 A;  1XNX A;  4ZNS A;  2V7C A;  4XT9 A;  3CQV A;  1U3Q A;  4FGY A;  2P54 A;  3R2A A;  1PQC A;  4UDD A;  5JY3 A;  1UOM A;  2BJ4 B;  2ZAS A;  2HAR A;  5EIT A;  1L2J A;  5ICK A;  3W0H A;  1X7R A;  1XZX X;  1XNN A;  2GPV A;  2YJA B;  3MNE A;  4G2H A;  5DWL A;  4UDB A;  3D6D A;  3GWX A;  4OIV A;  3ZRA A;  4IUI A;  5KR9 A;  2ZXZ A;  3O1E A;  4XI3 A;  3TKC A;  4POJ A;  2ZFX A;  1P8D A;  2AYR A;  3F5C B;  4ZJW A;  2ZK1 A;  1XVP A;  3JZC A;  3TX7 B;  3GN8 A;  3HOD A;  4KZM A;  2AX7 A;  2QH6 A;  2VV4 A;  5G46 A;  3SZ1 A;  3UVV B;  3KMG A;  4IA1 A;  3WT6 A;  2Z4J A;  3V9Y A;  2GIU A;  1N83 A;  2QTU A;  3ET3 A;  4OJB A;  3JZB A;  3V9V A;  5JJM A;  1K4W A;  3ET2 A;  1S19 A;  2Q61 A;  3L1B A;  5DKG A;  2ZY0 A;  1X7B A;  3WT5 A;  4TV1 A;  1T65 A;  1YA3 A;  3HZF A;  3KWY A;  4MGB B;  2GPU A;  2ZMH A;  3GZ9 A;  4DK7 A;  3UP3 A;  1LBD A;  2VV2 A;  4RMD A;  2J7Y A;  3OZJ A;  5DV8 A;  3VJH A;  1XLS E;  4MGC A;  5DTV A;  2PIW A;  4MG6 A;  2Q59 A;  1YOK A;  1XP6 A;  4IVY A;  4MG7 B;  1XP1 A;  4RUP A;  2OZ7 A;  3E00 D;  3FLI A;  1ERE A;  3L0E A;  2P1U A;  4LNX A;  2ZK0 A;  3CS4 A;  5E1C A;  3AUR A;  4J5X C;  1ILH A;  1K74 A;  4OC7 A;  1YP0 A;  4KZJ A;  3PLZ A;  4YPQ A;  3WWR A;  3NOA A;  1RJK A;  5G43 A;  2I4J A;  5DRM A;  3B67 A;  1H9U A;  3FEJ A;  1DKF B;  2AM9 A;  4M8H A;  5H1E A;  5KCC A;  2BAW A;  4J24 A;  4XUM A;  3LMP A;  5E0X A;  5L7H A;  4PF3 A;  4POH A;  2FSZ A;  2HWQ A;  4OH6 A;  1NQ0 A;  2ZXN A;  3VN2 A;  4FHI A;  4DOS A;  4G1D A;  3OS9 A;  4ZN7 A;  5DXB A;  2Q5S A;  4RUJ A;  4JYH A;  4ZNT A;  4WQP A;  2Q6R A;  1OVL B;  4OKW A;  1HG4 A;  2QNV A;  5LGA A;  5DUE A;  3W0G A;  2HAM A;  5DUG A;  1N46 A;  3AFR A;  2QZO B;  4OED A;  3VT4 A;  2BJ4 A;  1FM9 A;  1YYE A;  3K6P A;  3KFC A;  1YIM A;  1Z5X E;  3AN4 A;  1NQ7 A;  3ET1 A;  5FQR A;  5HJS A;  3ZRB A;  1QKU A;  3VHU A;  4NIE A;  2AX9 A;  3IA6 A;  4ZNV A;  2PIV A;  3F5C A;  3RLJ A;  5DX3 B;  4ZNU A;  1XPC A;  2B50 A;  3A3Z X;  4OZT U;  3UVV A;  3KDT A;  5KRH A;  3D5F A;  3OOF A;  1GWR A;  3GBK A;  4R2U A;  3IPS A;  3L0J A;  3VRU A;  1T76 A;  3A9E B;  3Q95 B;  4RUO X;  3VHV A;  1FM6 A;  4ZNH A;  1PDU A;  2NXX A;  1NUO A;  2QPY A;  2AMB A;  3ADV A;  5EI1 A;  4N1Y A;  2VST A;  3B5R A;  5DV3 A;  2Z4B A;  1SR7 A;  4MGB A;  1ZDU A;  2B23 A;  1YOW A;  3D57 A;  3UU7 B;  5AAU A;  4IA2 A;  5DID A;  3OMQ A;  5L7E A;  2Q7I A;  5DZH A;  3B0T A;  1R1K A;  1S9Q A;  4XTA A;  4MG7 A;  4HEE X;  3OMM A;  5EJV A;  4OIU A;  3FAL B;  2VV0 A;  3SP9 A;  4J5W A;  1L2I A;  1UPW A;  5DXR A;  5I4V A;  3GYU A;  3B65 A;  4RMC A;  3A40 X;  1YJE A;  5CJ6 A;  5DXQ A;  5KCT A;  5DMC A;  2AA6 A;  2QR9 A;  3B66 A;  2REW A;  4XLD A;  4K4J A;  1DKF A;  2I0J A;  4IV4 A;  2EWP A;  1T73 A;  3NSQ A;  2PNU A;  3BQD A;  4E4Q A;  4Q50 A;  5FQS A;  1I38 A;  3G8I A;  4LTW A;  2PIU A;  1FCY A;  4WHG A;  4A4W A;  3VSP A;  2P1V A;  1OVL A;  1VJB A;  5AWK A;  3UUD B;  4F9M A;  3VSO A;  2XYJ A;  4OFU A;  4IW8 A;  4PPS A;  1UPV A;  2GPO A;  3OMP A;  1TXI A;  2J7X A;  2AA5 A;  3HVL A;  3KDU A;  2GP7 A;  3OSA A;  1YMT A;  2XYW A;  4PP5 A;  3CWD A;  3HC5 A;  2QZO A;  3WGP A;  5DK9 A;  1R5K A;  3H0A A;  3HO0 A;  3OLF A;  4QL8 A;  3RUT A;  5KRK A;  2ZBS A;  3V3E A;  2Q8S A;  2XYX A;  2HWR A;  5KCD A;  1T79 A;  1EXA A;  3AUN A;  4PP3 A;  2PIX A;  4QM0 A;  2PIO A;  4RZF A;  2IHQ A;  2Q5P A;  3VTC A;  3WFG A;  3LBD A;  4X1G A;  3DCU A;  4XAO A;  5KRM A;  2YFE A;  3AZ3 A;  1ZEO A;  5DVS A;  1NAX A;  1Z95 A;  3VRT A;  3KYT A;  4M8E A;  3L03 A;  3WJ5 A;  3OOK A;  2Q6J A;  5DWG A;  3V4A A;  1K7L A;  2PIQ A;  3K22 A;  1U9E A;  3FS1 A;  2POG A;  3OKI A;  1TFC A;  1T74 A;  1PCG A;  3A9E A;  3Q95 A;  4QJR A;  5DVV A;  3R8I A;  2R40 A;  4IQR A;  3OS8 C;  3AN3 A;  3VT5 A;  5APH A;  2A3I A;  2PIT A;  4DMA A;  2GL8 A;  3HC6 A;  5AK2 A;  1OSH A;  3CDP A;  4J26 A;  5DI7 A;  5AVL A;  5GIE A;  4IS8 A;  4UDC A;  5G44 A;  2YLO A;  3UU7 A;  4MG8 B;  1MVC A;  3HLV A;  4ZJR A;  4OFR A;  3DZU D;  3ILZ A;  2QA6 A;  3B3K A;  4LSJ A;  2PIN A;  3AX8 A;  2ABI A;  2ZLC A;  3A2I A;  3FAL A;  4G1Z A;  4DK8 A;  4EM9 A;  3W0I A;  5KRC A;  2J4A A;  2ZLA A;  5G45 A;  4S15 A;  3RVF A;  4N73 A;  4QK4 A;  2H77 A;  4ZN9 A;  1NAV A;  1QKN A;  3R5M A;  4YMQ A;  1RK3 A;  1XDK B;  2VV1 B;  2NW4 A;  5DWJ A;  2YLY A;  4S0T A;  3VRV A;  1T7F A;  5DP0 A;  3OMO A;  5AYG A;  4B7W A;  2ZK5 A;  4MGD B;  2PIP L;  1BSX A;  5FQP A;  5KCE A;  4Q0A C;  5LWP A;  4O8F A;  4MGA B;  5DKB A;  3VT9 A;  1RDT A;  5DXP A;  4RE8 A;  3X1I A;  1QKM A;  3MNP A;  1XOW A;  3UUD A;  3SP6 A;  5DY8 A;  3P89 A;  3S9S A;  1XV9 B;  2FVJ A;  5KYJ A;  4NQA B;  4EMA A;  4TUZ B;  2XKW A;  2I4P A;  1NHZ A;  2HCD A;  5DVC A;  5APJ A;  4FN9 A;  1M2Z A;  1R20 A;  2O9I A;  3ADS A;  2NXX E;  4NUF A;  3L0L A;  3PRG A;  4OKT A;  2QGT A;  1FCX A;  3BC5 A;  3ERD A;  4OZR U;  4RME A;  5DL4 A;  1YIN A;  2O4J A;  1PRG A;  4FNE A;  3IXP A;  4IA7 A;  5DXK A;  4OK1 A;  2Q1V A;  4J5X A;  3X36 A;  4JYG A;  3ERT A;  3VJI A;  4S14 A;  5IZ0 A;  3TKM A;  4K7A A;  3A78 A;  3W0Y A;  4N5G A;  1I7G A;  4ZOM A;  3FEI A;  3BEJ A;  3OLL A;  4DOR A;  3CLD A;  4OLM A;  4PLE A;  1P93 A;  4IU7 A;  5DMF A;  2O4R A;  3DT3 A;  4ONI A;  3WT7 A;  5AZV A;  4KZI A;  5HYK A;  4CI4 A;  5C4U A;  5DLR A;  4OZT E;  1G2N A;  3VRW A;  4UDA A;  5DZ0 A;  5AWJ A;  3OZ0 A;  3X31 A;  3DZY D;  4MG5 A;  2OCF A;  4OIL A;  1S9P A;  1K74 D;  5L11 A;  3ZR7 A;  1PQ6 A;  3B68 A;  1T5Z A;  3OSW A;  1MV9 A;  2GWX A;  2Q7K A;  3V9T A;  3VJS A;  2Q6S A;  3A2J A;  5DWE A;  3UUA B;  2J14 A;  1PQ9 A;  4E4K A;  1X78 A;  3FC6 B;  5G5W A;  3NSP A;  3E7C A;  3D90 A;  1ILG A;  2HVC A;  2I0G A;  5HYR A;  3RLL A;  4L96 A;  2PIR A;  2JF9 A;  3OMK A;  2OAX A;  3U9Q A;  2AB2 A;  1ZDT A;  4YT1 A;  1A52 A;  3B1M A;  1G5Y A;  2VV1 A;  4RZG A;  1NYX A;  5DZI A;  3HQ5 A;  5G3J A;  1GWX A;  5DZ1 A;  4LBD A;  2AMA A;  2JFA B;  3B0Q A;  3N00 A;  4MGD A;  3E94 A;  2ZNO A;  1SJ0 A;  2ATH A;  2ZKC A;  3VTB A;  1SQN A;  2ZNP A;  3B0R A;  4MGA A;  1PZL A;  4IWF A;  3OLS A;  2Q70 A;  2POB A;  2ZK4 A;  4FHH A;  1KNU A;  4G20 A;  1FM9 D;  4CI5 A;  1G50 A;  2AX8 A;  2QXM A;  2YAT A;  2ZNN A;  1XV9 A;  3K23 A;  5ETH A;  1YUC A;  5KCW A;  3RY9 A;  5E14 A;  3WJ4 A;  3DR1 A;  4G2I A;  4OJ9 A;  4TUZ A;  3OKH A;  5DYD A;  5FQV A;  3VT3 A;  5DUH A;  3WMH A;  3CJW A;  4NB6 A;  1I37 A;  2QE4 A;  4DM8 A;  2QW4 A;  2ZMJ A;  3OAP A;  4P6X A;  2PRG A;  3R8A A;  4QE8 A;  2HB7 A;  1FM6 D;  4CSJ A;  2Q5G A;  3CS6 A;  4WLB A;  4PVU A;  5DRJ A;  1QKT A;  1Y9R A;  5APK A;  4ITF A;  3PEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...