1PK5A

Crystal structure of the orphan nuclear receptor lrh-1
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
242
structure length
242
Chain Sequence
ASIPHLILELLKCEPDEPQVQAKIMAYLQQEQSNRNRQEKLSAFGLLCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVAHGKEGTIFLVTGEHVDYSTIISHTEVAFNNLLSLAQELVVRLRSLQFDQREFVCLKFLVLFSSDVKNLENLQLVEGVQEQVNAALLDYTVCNYPQQTEKFGQLLLRLPELRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHAKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for ligand-independent activation of the orphan nuclear receptor LRH-1
pubmed doi rcsb
molecule keywords Orphan nuclear receptor NR5A2
molecule tags Gene regulation
source organism Mus musculus
total genus 89
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 1pk5A00
4DM8A 2ZVTA 3UUAB 1Y9RA 3BC5A 4S14A 1XQ3A 5HJSA 1YP0A 4OH5A 2OAXA 3E7CA 3P8XA 5KYAA 2J14A 1FBYA 3NSQA 3VN2A 4RUPA 4S0TA 2GIUA 2HCDA 4APUA 2ACLB 3HQ5A 5DX3B 5AAVA 2OM9A 4PPPA 2HASA 1H9UA 1XQCA 3ADUA 4IU7A 3MNEA 2JFAA 4ONIA 4IV4A 5SYZA 1XVPA 4XT9A 3PLZA 4LNWA 5HJPA 3M7RA 4OZRE 4PRGA 5DV3A 5EHJA 1GWQA 2P7AA 2GL8A 3AUNA 4Q13A 4XLDA 4DMAA 1RKHA 2O9IA 2AX9A 4MGBB 4IA3A 3EYBA 5FQVA 3WMHA 3E00A 1Z5XE 3UUAA 1XLSE 2P7ZA 3F5CA 1Y0XX 1XP6A 3FS1A 2YHDA 3L0JA 4LSJA 5APHA 5G44A 3ERDA 3UUDA 3GZ9A 4ZN9A 3DZYD 3CDSA 3ERTA 1SKXA 3LMPA 5DK9A 2QH6A 2NXXA 3OSIA 4OEAA 4REEA 5DWIA 3R5MA 3W0IA 1KKQA 5KCTA 5KRIA 2VSTA 5CJ6A 2V7CA 2ZXZA 3A3ZX 4IVYA 5LGAA 4IWFA 3KMZA 1NAVA 2QXMA 3Q95A 4OJBA 5DV8A 4MDDA 5HYKA 5IAWA 3B5RA 4EM9A 1T65A 3O1DA 4YMQA 1YIMA 4WHGA 4MG6A 2ZMJA 4OIVA 3UVVB 2ZASA 5DXPA 4OIUA 5G46A 2GTKA 2G0GA 4OARA 2QTUA 5IZ0A 4YPQA 5DXBB 5DLRA 2ZK6A 3DZUA 3AURA 2IHQA 3SZ1A 3ET2A 3OOKA 3RUUA 2AMBA 2ZK2A 2AYRA 1IE8A 1ERRA 1M13A 2R40D 4NY9A 4OZTU 4PVUA 2Q59B 3BEJA 4K7AA 1SQNA 2Z4JA 4QJRA 3L1BA 3D90A 4J5WA 2XHSA 4MG7B 1MVCA 3OMOA 4G1YA 2GPUA 5G43A 3CTBA 4A2JA 4N73A 2GPPA 3FXVA 1YINA 1S0XA 3OLSA 4PWLA 5GICA 3ADXA 5DMFA 3OMKA 2AO6A 3FUGA 4XI3A 1UHLA 5DXKA 3W5PA 4R6SA 5DUEA 5APJA 4OFUA 1XV9B 4POHA 1FCYA 2QGWA 3CS8A 3FEJA 4WVDA 5DY8A 3WFGA 3P88A 5KCCA 2V0VA 2QZOA 4MGDA 3D5FA 5JJMA 1M2ZA 1XPCA 3GYUA 1PDUA 3R8DA 3BQDA 5G5WA 3T03A 2J7YA 1XLSA 1K7LA 3GYTA 1EREA 4ZNSA 4OEYA 2OZ7A 5DXEA 2AWHA 4OKXA 2ZK1A 2PIXA 5DZ3A 3AFRA 4NB6A 5DZHA 4DK7A 2Q59A 1E3GA 1NHZA 2YATA 1A28A 5AYGA 4J5XC 5G3JA 1R1KD 4XHDA 3KMRA 1X76A 2POBA 3A9EB 2AA7A 4IA2A 1NQ2A 5ACCA 5KCEA 1OVLA 4ZNUA 5KCUA 3A78A 2PIVA 2VV2A 2OCFA 3KPZA 3R2AA 4ZNVA 4ZJWA 5KRMA 1RK3A 3ADTA 2ZK4A 4FN9A 4IW8A 4LNXA 3TY0A 2F4BA 3HODA 5E1CA 5C4SA 4JAZA 2P7GA 4L96A 3R8IA 1FM9D 4RE8A 2AM9A 3B0TA 5DXMA 5EC9A 3OZ0A 3WT5A 3WFFA 1L2JA 1YJEA 3H52A 2Q5SA 5AAVB 4E4KA 5AWJA 3DT3A 4XUHA 4OJ9A 3OS8C 3FALA 2QNVA 2JFAB 2GP7A 3K22A 2Q6SA 1XVPB 3V3QA 3AZ2A 1RDTA 3TKMA 4J26A 4J5WC 2YLOA 4R2UA 2ZK3A 3DZUD 3VHUA 3KWYA 4OHAA 4IW6A 3HC6A 3ET3A 1S0ZA 3CS6A 4PF3A 4X1FA 1OSHA 2Q7IA 4ITEA 3W5RA 2Z4BA 5AAUA 2AXAA 2P1TA 4YT1A 1ILHA 2FSZA 2HWQA 3F5CB 4HEEX 4M8HA 5C4TA 4OGHA 2ZMIA 3UUDB 3IA6A 3VSOA 1X7RA 5L11A 2ZMHA 4OC7A 4PP3A 1ZKYA 3KDUA 4IA7A 4O8FA 2HAMA 3OSWA 2ZK0A 3UU7A 4CI5A 2P1VA 2GWXA 2R6WA 1I37A 3Q95B 2AX8A 3KMGA 4MG5A 1PQ6A 3B3KA 2HFPA 2NPAA 1R20A 1DKFA 1ZDTA 2GPVA 2I4PA 2PNUA 4WQPA 3SP9A 1K74D 4REFA 4QE6A 3VTBA 1UPWA 2QMVA 1G2NA 4RZEA 1ZEOA 3OZJA 4DORA 2YJDA 4PLEA 3OLFA 1R1KA 3X36A 3LBDA 3KFCA 5DWEA 3GN8A 3V3EA 4DOSA 3B66A 3AX8A 4RUJA 4X1GA 5DZ1A 5DZ0A 3VT3A 3B1MA 3HM1A 1YY4A 2AA5A 2Q60A 4RUOX 4RZGA 3VT8A 5B41A 3G0WA 4G21A 5KR9A 4TV1A 5HYRA 4RMDA 5E19A 4PP6A 4S15A 2G44A 1FM9A 5JI0D 2Q7KA 3QT0A 3L0EA 3X31A 2FVJA 2AA6A 4K6IA 5EGVA 1MV9A 4LBDA 1P8DA 3G9EA 4UDAA 4PPSA 1X7JA 2XYXA 3N00A 1YUCA 4OKWA 1OSVA 1UHLB 5H1EA 3MNOA 3GWSX 2Q3YA 4IVWA 4YNKA 5DVCA 3OKIA 4XAOA 5DP0A 5E14A 4DM6A 2QZOB 3P0UA 1T7MA 2PIPL 4MGDB 4DK8A 1NAXA 2G5OA 1L2IA 2I0GA 3B65A 4FHIA 4XUMA 4F9MA 5JJMB 1NQ7A 5AK2A 3W0AA 2HC4A 3DCTA 2H77A 1XZXX 1RKGA 2ZFXA 2QXSA 1RDTD 3RUTA 1FCZA 1S9QA 5GIEA 3ZR7A 2HB7A 2XYJA 3ZRAA 4ZN7A 4FGYA 5E0XA 3VRWA 4FNEA 3KBAA 5GT4A 1YA3A 2QA6A 3IPSA 3VJTA 1T7RA 3TX7B 1HG4A 1OVLB 5DYDA 1EXAA 3A2IA 1XIUA 5A86A 2QE4A 1XNNA 3SP6A 3HVLA 3V4AA 1TFCA 5E15A 1YYEA 3W0HA 3GWXA 4IS8A 2P4YA 5DWGA 1M7WA 1K74A 3VTCA 3V9TA 1KV6A 4IUIA 2PIOA 4CSJA 1U3QA 3AZ3A 2POGA 5HZCA 3GBKA 4UDBA 5DKEA 2QA8A 4QE8A 2Q5GA 1R20D 2QR9A 2VV4A 3CWDA 3PEQA 4PLDA 3VRVA 3FALB 3G8OA 4BCRA 1X7BA 1YMTA 1ZGYA 2ZNQA 3VT5A 1ZAFA 5DWJA 1BSXA 1Z95A 4OH6A 4ZO1X 5DVSA 1UPVA 3PRGA 1I38A 4PXMA 4A4VA 3R5NA 4G20A 2OVMA 4K4JA 2HARA 3RLJA 2R6YA 5DIGA 2GPOA 5DXGA 3VT9A 2PRGA 4N1YA 1XP9A 5KCWA 5F9BA 1E3KA 1LV2A 1PCGA 2QPYA 5DV6A 5FQPA 4ZNHA 3DR1A 4P6XA 1XP1A 4TUZA 3X1HA 1QKMA 5K13A 5EI1A 3HC5A 4QM0A 4HLWA 5C4OA 2AX6A 3MNPA 2YLPA 3UU7B 2JJ3A 4POJA 3AN3A 3WJ5A 2VV3A 2ZNOA 5DRMA 2Q1VA 4MGCA 5KRAA 2Q7LA 1DKFB 2FAIA 2Q1HA 4FHHA 5AWKA 3RVFA 4A4WA 1XNXA 1U3RA 5LWPA 3K8SA 2ATHA 4MGAA 1FD0A 2PIUA 4ZI1A 1PRGA 4LTWA 3PBAA 3B68A 2AA2A 4IQRA 3O1EA 1P93A 2P15A 2PIWA 3B0QA 3CS4A 3OMMA 4KZJA 4KZIA 1SJ0A 2G0HA 5E0WA 5ETHA 5KCFA 4J24A 5G42A 4WLBA 3ADWA 4NUFA 3WTQA 3K6PA 4TV1B 5DI7A 3VSPA 5DIDA 2Q61A 3OAPA 3ZQTA 1T76A 4ZO1B 2P54A 2ZBSA 1YOKA 2ZNNA 3IXPD 2Q6RA 1WM0X 1UOMA 4IV2A 5B5BA 2VV1A 2E2RA 3KDTA 3FC6A 1NDEA 1LBDA 3VJSA 3HO0A 3H0AD 3X1IA 3S9SA 3AUQA 3ILZA 1X7EA 4OKBA 4WHFA 5DKSA 1T5ZA 1R6GA 4MG8A 3WWRA 5FQSA 3WJ4A 3P89A 5KROA 1T63A 4G2HA 3TKCA 3A40X 4NIEA 5FQRA 4KZMA 4OK1A 3V9YA 5DWLA 4PP5A 5ICKA 2Q6JA 4P6WA 1PK5A 5L7EA 3W0GA 3WGPA 4OEZA 4ZNTA 4OEDA 2ABIA 3V49A 1QKTA 4OFRA 5AZVA 2YJAB 4MG9A 1T7FA 2PIQA 3OLLA 1I7GA 4RMEA 2QGTA 5FQTA 1DB1A 1S9PA 1ZUCA 2HVCA 3DCUA 5KRJA 4ITFA 3IPUA 3A2HA 1S19A 3E94A 3VHWA 2EWPA 2W8YA 2A3IA 4E4QA 2QW4A 5L7GA 1N4HA 2BJ4A 1KNUA 1NUOA 2B1ZA 1XDKA 2OVHA 4IWCA 4CI4A 3OGTA 5DKGA 2O4JA 3L0LA 1FCXA 1K4WA 4R06A 3OKHA 4WPFA 2ZKCA 5DU5A 4G1DA 1Q4XA 2I4JA 1NYXA 3ZRBA 2H79A 3W0CA 4Q0AC 3PO9A 1U3SA 2PITA 2QA8B 5DUHA 5GIDA 4ZNWA 2VV4B 3L3XA 4RZFA 4J5XA 5APKA 3OS9A 5DXQA 1ILGA 5AZTA 3FEIA 1T73A 2AMAA 2YLQA 3L3ZA 3NSPA 1PQ9A 4UDCA 3VJHA 5KYJA 1R5KA 1RJKA 1T7TA 4RMCA 4OLMA 1XJ7A 2P1UA 2ACLA 3IPQA 3K23A 5DYBA 5DL4A 5DX3A 2ZLCA 1G5YA 3VRUA 2NV7A 3VT6A 4RWVA 5DXRA 3R29A 3WT6A 2ZNPA 3VJIA 3B0WA 2LBDA 3ET0A 3IXPA 4UDDA 5DUGA 1X78A 1FM6A 2QABA 3VT4A 3AN4A 2OUZA 1NRLA 3VI8A 5DMCA 5KRLA 5AVLA 4TUZB 4DQMA 3AZ1A 2PIRA 4N8RA 3ET1A 3H0AA 4Y29A 5DZIA 3L03A 4M8EA 2AB2A 3D24A 2AX7A 3FLIA 3OS8A 4MGBA 3ADVA 4JYGA 2I4ZA 3RY9A 3UP3A 2IOKA 4EMAA 2YFEA 3OOFA 4N5GA 2I0JA 3UP0A 3OSAA 2Q70A 3JZBA 2PINA 5DTVA 2XKWA 5DVVA 4NQAB 1GWXA 5G45A 4MGAB 5L7HA 5EJVA 5IXKA 3R8AA 2ZK5A 4JGVA 2Q5PA 3A2JA 3D57A 4Q50A 4QK4A 1U9EA 1VJBA 1QKUA 3W5TA 2B50A 2BAWA 2HB8A 1HJ1A 3UVVA 4G1ZA 3ADSA 3HZFA 3GD2A 2ZL9A 1XOWA 4XTAA 5DXBA 3VT7A 4RFWA 2Q7JA 4B7WA 3W5QA 3VRTA 2B23A 5KCDA 4OZRU 3W0JA 3KYTA 1T74A 1PQCA 4ZJRA 3JZCA 4L98A 2IOGA 3CQVA 5DSHA 5DKBA 1G50A 1I7IA 3CLDA 4IA1A 1YOWA 5C4UA 3RLLA 1NQ0A 4RAKA 1Z5XU 1IE9A 2VV1B 3FC6B 4MG7A 1A52A 3DZYA 2NW4A 5DRJA 3G8IA 4G2IA 1G1UA 4MG8B 2HWRA 5DIEA 5E7VA 3E00D 5EITA 3NOAA 3UUCA 3DY6A 1QKNA 5KRCA 2Q8SA 3D6DA 3OMPA 1N83A 1NQ1A 1GWRA 1XV9A 2O4RA 3F7DA 4QL8A 2PKLA 4OKTA 4OJ4A 4JYIA 2XYWA 5KRFA 5JY3A 4MG9B 3FURA 5KRKA 3PCUA 2ZY0A 1ZDUA 2AAXA 3V9VA 1TXIA 2JF9A 1XB7A 1MZNA 1PZLA 3U9QA 3W0YA 3VTDA 1GS4A 1XAPA 1EXXA 2REWA 3B0RA 2QSEA 1Y0SA 2ZXNA 2HBHA 3WT7A 5I4VA 5KRHA 2YLYA 1ZH7A 1SR7A 2NXXE 2J7XA 2VSRA 3OMQA 4OILA 5M96A 2R40A 1T79A 2PJLA 1FM6D 2J4AA 3HLVA 4S0SA 2BJ4B 5AVIA 4E2JA 5HJPB 1XDKB 2ZLAA 5HCVA 1N46A 1OT7A 2B1VA 3IMYA 3VHVA 3B67A 2VV0A 4JYHA 5KD9A 3A9EA 2ZXMA 4ZOMA 4OZTE 4JL4A 3CJWA 3CDPA
chains in the Genus database with same CATH superfamily
4DM8A 2ZVTA 3UUAB 1Y9RA 3BC5A 4S14A 1XQ3A 5HJSA 1YP0A 4OH5A 2OAXA 3E7CA 3P8XA 5KYAA 2J14A 1FBYA 3NSQA 3VN2A 4RUPA 4S0TA 2GIUA 2HCDA 4APUA 2ACLB 3HQ5A 5DX3B 5AAVA 2OM9A 4PPPA 2HASA 1H9UA 1XQCA 3ADUA 4IU7A 3MNEA 2JFAA 4ONIA 4IV4A 5SYZA 1XVPA 4XT9A 3PLZA 4LNWA 5HJPA 3M7RA 4OZRE 4PRGA 5DV3A 5EHJA 1GWQA 2P7AA 2GL8A 3AUNA 4Q13A 4XLDA 4DMAA 1RKHA 2O9IA 2AX9A 4MGBB 4IA3A 3EYBA 5FQVA 3WMHA 3E00A 1Z5XE 3UUAA 1XLSE 2P7ZA 3F5CA 1Y0XX 1XP6A 3FS1A 2YHDA 3L0JA 4LSJA 5APHA 5G44A 3ERDA 3UUDA 3GZ9A 4ZN9A 3DZYD 3CDSA 3ERTA 1SKXA 3LMPA 5DK9A 2QH6A 2NXXA 3OSIA 4OEAA 4REEA 5DWIA 3R5MA 3W0IA 1KKQA 5KCTA 5KRIA 2VSTA 5CJ6A 2V7CA 2ZXZA 3A3ZX 4IVYA 5LGAA 4IWFA 3KMZA 1NAVA 2QXMA 3Q95A 4OJBA 5DV8A 4MDDA 5HYKA 5IAWA 3B5RA 4EM9A 1T65A 3O1DA 4YMQA 1YIMA 4WHGA 4MG6A 2ZMJA 4OIVA 3UVVB 2ZASA 5DXPA 4OIUA 5G46A 2GTKA 2G0GA 4OARA 2QTUA 5IZ0A 4YPQA 5DXBB 5DLRA 2ZK6A 3DZUA 3AURA 2IHQA 3SZ1A 3ET2A 3OOKA 3RUUA 2AMBA 2ZK2A 2AYRA 1IE8A 1ERRA 1M13A 2R40D 4NY9A 4OZTU 4PVUA 2Q59B 3BEJA 4K7AA 1SQNA 2Z4JA 4QJRA 3L1BA 3D90A 4J5WA 2XHSA 4MG7B 1MVCA 3OMOA 4G1YA 2GPUA 5G43A 3CTBA 4A2JA 4N73A 2GPPA 3FXVA 1YINA 1S0XA 3OLSA 4PWLA 5GICA 3ADXA 5DMFA 3OMKA 2AO6A 3FUGA 4XI3A 1UHLA 5DXKA 3W5PA 4R6SA 5DUEA 5APJA 4OFUA 1XV9B 4POHA 1FCYA 2QGWA 3CS8A 3FEJA 4WVDA 5DY8A 3WFGA 3P88A 5KCCA 2V0VA 2QZOA 4MGDA 3D5FA 5JJMA 1M2ZA 1XPCA 3GYUA 1PDUA 3R8DA 3BQDA 5G5WA 3T03A 2J7YA 1XLSA 1K7LA 3GYTA 1EREA 4ZNSA 4OEYA 2OZ7A 5DXEA 2AWHA 4OKXA 2ZK1A 2PIXA 5DZ3A 3AFRA 4NB6A 5DZHA 4DK7A 2Q59A 1E3GA 1NHZA 2YATA 1A28A 5AYGA 4J5XC 5G3JA 1R1KD 4XHDA 3KMRA 1X76A 2POBA 3A9EB 2AA7A 4IA2A 1NQ2A 5ACCA 5KCEA 1OVLA 4ZNUA 5KCUA 3A78A 2PIVA 2VV2A 2OCFA 3KPZA 3R2AA 4ZNVA 4ZJWA 5KRMA 1RK3A 3ADTA 2ZK4A 4FN9A 4IW8A 4LNXA 3TY0A 2F4BA 3HODA 5E1CA 5C4SA 4JAZA 2P7GA 4L96A 3R8IA 1FM9D 4RE8A 2AM9A 3B0TA 5DXMA 5EC9A 3OZ0A 3WT5A 3WFFA 1L2JA 1YJEA 3H52A 2Q5SA 5AAVB 4E4KA 5AWJA 3DT3A 4XUHA 4OJ9A 3OS8C 3FALA 2QNVA 2JFAB 2GP7A 3K22A 2Q6SA 1XVPB 3V3QA 3AZ2A 1RDTA 3TKMA 4J26A 4J5WC 2YLOA 4R2UA 2ZK3A 3DZUD 3VHUA 3KWYA 4OHAA 4IW6A 3HC6A 3ET3A 1S0ZA 3CS6A 4PF3A 4X1FA 1OSHA 2Q7IA 4ITEA 3W5RA 2Z4BA 5AAUA 2AXAA 2P1TA 4YT1A 1ILHA 2FSZA 2HWQA 3F5CB 4HEEX 4M8HA 5C4TA 4OGHA 2ZMIA 3UUDB 3IA6A 3VSOA 1X7RA 5L11A 2ZMHA 4OC7A 4PP3A 1ZKYA 3KDUA 4IA7A 4O8FA 2HAMA 3OSWA 2ZK0A 3UU7A 4CI5A 2P1VA 2GWXA 2R6WA 1I37A 3Q95B 2AX8A 3KMGA 4MG5A 1PQ6A 3B3KA 2HFPA 2NPAA 1R20A 1DKFA 1ZDTA 2GPVA 2I4PA 2PNUA 4WQPA 3SP9A 1K74D 4REFA 4QE6A 3VTBA 1UPWA 2QMVA 1G2NA 4RZEA 1ZEOA 3OZJA 4DORA 2YJDA 4PLEA 3OLFA 1R1KA 3X36A 3LBDA 3KFCA 5DWEA 3GN8A 3V3EA 4DOSA 3B66A 3AX8A 4RUJA 4X1GA 5DZ1A 5DZ0A 3VT3A 3B1MA 3HM1A 1YY4A 2AA5A 2Q60A 4RUOX 4RZGA 3VT8A 5B41A 3G0WA 4G21A 5KR9A 4TV1A 5HYRA 4RMDA 5E19A 4PP6A 4S15A 2G44A 1FM9A 5JI0D 2Q7KA 3QT0A 3L0EA 3X31A 2FVJA 2AA6A 4K6IA 5EGVA 1MV9A 4LBDA 1P8DA 3G9EA 4UDAA 4PPSA 1X7JA 2XYXA 3N00A 1YUCA 4OKWA 1OSVA 1UHLB 5H1EA 3MNOA 3GWSX 2Q3YA 4IVWA 4YNKA 5DVCA 3OKIA 4XAOA 5DP0A 5E14A 4DM6A 2QZOB 3P0UA 1T7MA 2PIPL 4MGDB 4DK8A 1NAXA 2G5OA 1L2IA 2I0GA 3B65A 4FHIA 4XUMA 4F9MA 5JJMB 1NQ7A 5AK2A 3W0AA 2HC4A 3DCTA 2H77A 1XZXX 1RKGA 2ZFXA 2QXSA 1RDTD 3RUTA 1FCZA 1S9QA 5GIEA 3ZR7A 2HB7A 2XYJA 3ZRAA 4ZN7A 4FGYA 5E0XA 3VRWA 4FNEA 3KBAA 5GT4A 1YA3A 2QA6A 3IPSA 3VJTA 1T7RA 3TX7B 1HG4A 1OVLB 5DYDA 1EXAA 3A2IA 1XIUA 5A86A 2QE4A 1XNNA 3SP6A 3HVLA 3V4AA 1TFCA 5E15A 1YYEA 3W0HA 3GWXA 4IS8A 2P4YA 5DWGA 1M7WA 1K74A 3VTCA 3V9TA 1KV6A 4IUIA 2PIOA 4CSJA 1U3QA 3AZ3A 2POGA 5HZCA 3GBKA 4UDBA 5DKEA 2QA8A 4QE8A 2Q5GA 1R20D 2QR9A 2VV4A 3CWDA 3PEQA 4PLDA 3VRVA 3FALB 3G8OA 4BCRA 1X7BA 1YMTA 1ZGYA 2ZNQA 3VT5A 1ZAFA 5DWJA 1BSXA 1Z95A 4OH6A 4ZO1X 5DVSA 1UPVA 3PRGA 1I38A 4PXMA 4A4VA 3R5NA 4G20A 2OVMA 4K4JA 2HARA 3RLJA 2R6YA 5DIGA 2GPOA 5DXGA 3VT9A 2PRGA 4N1YA 1XP9A 5KCWA 5F9BA 1E3KA 1LV2A 1PCGA 2QPYA 5DV6A 5FQPA 4ZNHA 3DR1A 4P6XA 1XP1A 4TUZA 3X1HA 1QKMA 5K13A 5EI1A 3HC5A 4QM0A 4HLWA 5C4OA 2AX6A 3MNPA 2YLPA 3UU7B 2JJ3A 4POJA 3AN3A 3WJ5A 2VV3A 2ZNOA 5DRMA 2Q1VA 4MGCA 5KRAA 2Q7LA 1DKFB 2FAIA 2Q1HA 4FHHA 5AWKA 3RVFA 4A4WA 1XNXA 1U3RA 5LWPA 3K8SA 2ATHA 4MGAA 1FD0A 2PIUA 4ZI1A 1PRGA 4LTWA 3PBAA 3B68A 2AA2A 4IQRA 3O1EA 1P93A 2P15A 2PIWA 3B0QA 3CS4A 3OMMA 4KZJA 4KZIA 1SJ0A 2G0HA 5E0WA 5ETHA 5KCFA 4J24A 5G42A 4WLBA 3ADWA 4NUFA 3WTQA 3K6PA 4TV1B 5DI7A 3VSPA 5DIDA 2Q61A 3OAPA 3ZQTA 1T76A 4ZO1B 2P54A 2ZBSA 1YOKA 2ZNNA 3IXPD 2Q6RA 1WM0X 1UOMA 4IV2A 5B5BA 2VV1A 2E2RA 3KDTA 3FC6A 1NDEA 1LBDA 3VJSA 3HO0A 3H0AD 3X1IA 3S9SA 3AUQA 3ILZA 1X7EA 4OKBA 4WHFA 5DKSA 1T5ZA 1R6GA 4MG8A 3WWRA 5FQSA 3WJ4A 3P89A 5KROA 1T63A 4G2HA 3TKCA 3A40X 4NIEA 5FQRA 4KZMA 4OK1A 3V9YA 5DWLA 4PP5A 5ICKA 2Q6JA 4P6WA 1PK5A 5L7EA 3W0GA 3WGPA 4OEZA 4ZNTA 4OEDA 2ABIA 3V49A 1QKTA 4OFRA 5AZVA 2YJAB 4MG9A 1T7FA 2PIQA 3OLLA 1I7GA 4RMEA 2QGTA 5FQTA 1DB1A 1S9PA 1ZUCA 2HVCA 3DCUA 5KRJA 4ITFA 3IPUA 3A2HA 1S19A 3E94A 3VHWA 2EWPA 2W8YA 2A3IA 4E4QA 2QW4A 5L7GA 1N4HA 2BJ4A 1KNUA 1NUOA 2B1ZA 1XDKA 2OVHA 4IWCA 4CI4A 3OGTA 5DKGA 2O4JA 3L0LA 1FCXA 1K4WA 4R06A 3OKHA 4WPFA 2ZKCA 5DU5A 4G1DA 1Q4XA 2I4JA 1NYXA 3ZRBA 2H79A 3W0CA 4Q0AC 3PO9A 1U3SA 2PITA 2QA8B 5DUHA 5GIDA 4ZNWA 2VV4B 3L3XA 4RZFA 4J5XA 5APKA 3OS9A 5DXQA 1ILGA 5AZTA 3FEIA 1T73A 2AMAA 2YLQA 3L3ZA 3NSPA 1PQ9A 4UDCA 3VJHA 5KYJA 1R5KA 1RJKA 1T7TA 4RMCA 4OLMA 1XJ7A 2P1UA 2ACLA 3IPQA 3K23A 5DYBA 5DL4A 5DX3A 2ZLCA 1G5YA 3VRUA 2NV7A 3VT6A 4RWVA 5DXRA 3R29A 3WT6A 2ZNPA 3VJIA 3B0WA 2LBDA 3ET0A 3IXPA 4UDDA 5DUGA 1X78A 1FM6A 2QABA 3VT4A 3AN4A 2OUZA 1NRLA 3VI8A 5DMCA 5KRLA 5AVLA 4TUZB 4DQMA 3AZ1A 2PIRA 4N8RA 3ET1A 3H0AA 4Y29A 5DZIA 3L03A 4M8EA 2AB2A 3D24A 2AX7A 3FLIA 3OS8A 4MGBA 3ADVA 4JYGA 2I4ZA 3RY9A 3UP3A 2IOKA 4EMAA 2YFEA 3OOFA 4N5GA 2I0JA 3UP0A 3OSAA 2Q70A 3JZBA 2PINA 5DTVA 2XKWA 5DVVA 4NQAB 1GWXA 5G45A 4MGAB 5L7HA 5EJVA 5IXKA 3R8AA 2ZK5A 4JGVA 2Q5PA 3A2JA 3D57A 4Q50A 4QK4A 1U9EA 1VJBA 1QKUA 3W5TA 2B50A 2BAWA 2HB8A 1HJ1A 3UVVA 4G1ZA 3ADSA 3HZFA 3GD2A 2ZL9A 1XOWA 4XTAA 5DXBA 3VT7A 4RFWA 2Q7JA 4B7WA 3W5QA 3VRTA 2B23A 5KCDA 4OZRU 3W0JA 3KYTA 1T74A 1PQCA 4ZJRA 3JZCA 4L98A 2IOGA 3CQVA 5DSHA 5DKBA 1G50A 1I7IA 3CLDA 4IA1A 1YOWA 5C4UA 3RLLA 1NQ0A 4RAKA 1Z5XU 1IE9A 2VV1B 3FC6B 4MG7A 1A52A 3DZYA 2NW4A 5DRJA 3G8IA 4G2IA 1G1UA 4MG8B 2HWRA 5DIEA 5E7VA 3E00D 5EITA 3NOAA 3UUCA 3DY6A 1QKNA 5KRCA 2Q8SA 3D6DA 3OMPA 1N83A 1NQ1A 1GWRA 1XV9A 2O4RA 3F7DA 4QL8A 2PKLA 4OKTA 4OJ4A 4JYIA 2XYWA 5KRFA 5JY3A 4MG9B 3FURA 5KRKA 3PCUA 2ZY0A 1ZDUA 2AAXA 3V9VA 1TXIA 2JF9A 1XB7A 1MZNA 1PZLA 3U9QA 3W0YA 3VTDA 1GS4A 1XAPA 1EXXA 2REWA 3B0RA 2QSEA 1Y0SA 2ZXNA 2HBHA 3WT7A 5I4VA 5KRHA 2YLYA 1ZH7A 1SR7A 2NXXE 2J7XA 2VSRA 3OMQA 4OILA 5M96A 2R40A 1T79A 2PJLA 1FM6D 2J4AA 3HLVA 4S0SA 2BJ4B 5AVIA 4E2JA 5HJPB 1XDKB 2ZLAA 5HCVA 1N46A 1OT7A 2B1VA 3IMYA 3VHVA 3B67A 2VV0A 4JYHA 5KD9A 3A9EA 2ZXMA 4ZOMA 4OZTE 4JL4A 3CJWA 3CDPA
chains in the Genus database with same CATH topology
4DM8A 2ZVTA 3UUAB 1Y9RA 3BC5A 4S14A 1XQ3A 5HJSA 1YP0A 4OH5A 2OAXA 3E7CA 3P8XA 5KYAA 2J14A 1FBYA 3NSQA 3VN2A 4RUPA 4S0TA 2GIUA 2HCDA 4APUA 2ACLB 3HQ5A 5DX3B 5AAVA 2OM9A 4PPPA 2HASA 1H9UA 1XQCA 3ADUA 4IU7A 3MNEA 2JFAA 4ONIA 4IV4A 5SYZA 1XVPA 4XT9A 3PLZA 4LNWA 5HJPA 3M7RA 4OZRE 4PRGA 5DV3A 5EHJA 1GWQA 2P7AA 2GL8A 3AUNA 4Q13A 4XLDA 4DMAA 1RKHA 2O9IA 2AX9A 4MGBB 4IA3A 3EYBA 5FQVA 3WMHA 3E00A 1Z5XE 3UUAA 1XLSE 2P7ZA 3F5CA 1Y0XX 1XP6A 3FS1A 2YHDA 3L0JA 4LSJA 5APHA 5G44A 3ERDA 3UUDA 3GZ9A 4ZN9A 3DZYD 3CDSA 3ERTA 1SKXA 3LMPA 5DK9A 2QH6A 2NXXA 3OSIA 4OEAA 4REEA 5DWIA 3R5MA 3W0IA 1KKQA 5KCTA 5KRIA 2VSTA 5CJ6A 2V7CA 2ZXZA 3A3ZX 4IVYA 5LGAA 4IWFA 3KMZA 1NAVA 2QXMA 3Q95A 4OJBA 5DV8A 4MDDA 5HYKA 5IAWA 3B5RA 4EM9A 1T65A 3O1DA 4YMQA 1YIMA 4WHGA 4MG6A 2ZMJA 4OIVA 3UVVB 2ZASA 5DXPA 4OIUA 5G46A 2GTKA 2G0GA 4OARA 2QTUA 5IZ0A 4YPQA 5DXBB 5DLRA 2ZK6A 3DZUA 3AURA 2IHQA 3SZ1A 3ET2A 3OOKA 3RUUA 2AMBA 2ZK2A 2AYRA 1IE8A 1ERRA 1M13A 2R40D 4NY9A 4OZTU 4PVUA 2Q59B 3BEJA 4K7AA 1SQNA 2Z4JA 4QJRA 3L1BA 3D90A 4J5WA 2XHSA 4MG7B 1MVCA 3OMOA 4G1YA 2GPUA 5G43A 3CTBA 4A2JA 4N73A 2GPPA 3FXVA 1YINA 1S0XA 3OLSA 4PWLA 5GICA 3ADXA 5DMFA 3OMKA 2AO6A 3FUGA 4XI3A 1UHLA 5DXKA 3W5PA 4R6SA 5DUEA 5APJA 4OFUA 1XV9B 4POHA 1FCYA 2QGWA 3CS8A 3FEJA 4WVDA 5DY8A 3WFGA 3P88A 5KCCA 2V0VA 2QZOA 4MGDA 3D5FA 5JJMA 1M2ZA 1XPCA 3GYUA 1PDUA 3R8DA 3BQDA 5G5WA 3T03A 2J7YA 1XLSA 1K7LA 3GYTA 1EREA 4ZNSA 4OEYA 2OZ7A 5DXEA 2AWHA 4OKXA 2ZK1A 2PIXA 5DZ3A 3AFRA 4NB6A 5DZHA 4DK7A 2Q59A 1E3GA 1NHZA 2YATA 1A28A 5AYGA 4J5XC 5G3JA 1R1KD 4XHDA 3KMRA 1X76A 2POBA 3A9EB 2AA7A 4IA2A 1NQ2A 5ACCA 5KCEA 1OVLA 4ZNUA 5KCUA 3A78A 2PIVA 2VV2A 2OCFA 3KPZA 3R2AA 4ZNVA 4ZJWA 5KRMA 1RK3A 3ADTA 2ZK4A 4FN9A 4IW8A 4LNXA 3TY0A 2F4BA 3HODA 5E1CA 5C4SA 4JAZA 2P7GA 4L96A 3R8IA 1FM9D 4RE8A 2AM9A 3B0TA 5DXMA 5EC9A 3OZ0A 3WT5A 3WFFA 1L2JA 1YJEA 3H52A 2Q5SA 5AAVB 4E4KA 5AWJA 3DT3A 4XUHA 4OJ9A 3OS8C 3FALA 2QNVA 2JFAB 2GP7A 3K22A 2Q6SA 1XVPB 3V3QA 3AZ2A 1RDTA 3TKMA 4J26A 4J5WC 2YLOA 4R2UA 2ZK3A 3DZUD 3VHUA 3KWYA 4OHAA 4IW6A 3HC6A 3ET3A 1S0ZA 3CS6A 4PF3A 4X1FA 1OSHA 2Q7IA 4ITEA 3W5RA 2Z4BA 5AAUA 2AXAA 2P1TA 4YT1A 1ILHA 2FSZA 2HWQA 3F5CB 4HEEX 4M8HA 5C4TA 4OGHA 2ZMIA 3UUDB 3IA6A 3VSOA 1X7RA 5L11A 2ZMHA 4OC7A 4PP3A 1ZKYA 3KDUA 4IA7A 4O8FA 2HAMA 3OSWA 2ZK0A 3UU7A 4CI5A 2P1VA 2GWXA 2R6WA 1I37A 3Q95B 2AX8A 3KMGA 4MG5A 1PQ6A 3B3KA 2HFPA 2NPAA 1R20A 1DKFA 1ZDTA 2GPVA 2I4PA 2PNUA 4WQPA 3SP9A 1K74D 4REFA 4QE6A 3VTBA 1UPWA 2QMVA 1G2NA 4RZEA 1ZEOA 3OZJA 4DORA 2YJDA 4PLEA 3OLFA 1R1KA 3X36A 3LBDA 3KFCA 5DWEA 3GN8A 3V3EA 4DOSA 3B66A 3AX8A 4RUJA 4X1GA 5DZ1A 5DZ0A 3VT3A 3B1MA 3HM1A 1YY4A 2AA5A 2Q60A 4RUOX 4RZGA 3VT8A 5B41A 3G0WA 4G21A 5KR9A 4TV1A 5HYRA 4RMDA 5E19A 4PP6A 4S15A 2G44A 1FM9A 5JI0D 2Q7KA 3QT0A 3L0EA 3X31A 2FVJA 2AA6A 4K6IA 5EGVA 1MV9A 4LBDA 1P8DA 3G9EA 4UDAA 4PPSA 1X7JA 2XYXA 3N00A 1YUCA 4OKWA 1OSVA 1UHLB 5H1EA 3MNOA 3GWSX 2Q3YA 4IVWA 4YNKA 5DVCA 3OKIA 4XAOA 5DP0A 5E14A 4DM6A 2QZOB 3P0UA 1T7MA 2PIPL 4MGDB 4DK8A 1NAXA 2G5OA 1L2IA 2I0GA 3B65A 4FHIA 4XUMA 4F9MA 5JJMB 1NQ7A 5AK2A 3W0AA 2HC4A 3DCTA 2H77A 1XZXX 1RKGA 2ZFXA 2QXSA 1RDTD 3RUTA 1FCZA 1S9QA 5GIEA 3ZR7A 2HB7A 2XYJA 3ZRAA 4ZN7A 4FGYA 5E0XA 3VRWA 4FNEA 3KBAA 5GT4A 1YA3A 2QA6A 3IPSA 3VJTA 1T7RA 3TX7B 1HG4A 1OVLB 5DYDA 1EXAA 3A2IA 1XIUA 5A86A 2QE4A 1XNNA 3SP6A 3HVLA 3V4AA 1TFCA 5E15A 1YYEA 3W0HA 3GWXA 4IS8A 2P4YA 5DWGA 1M7WA 1K74A 3VTCA 3V9TA 1KV6A 4IUIA 2PIOA 4CSJA 1U3QA 3AZ3A 2POGA 5HZCA 3GBKA 4UDBA 5DKEA 2QA8A 4QE8A 2Q5GA 1R20D 2QR9A 2VV4A 3CWDA 3PEQA 4PLDA 3VRVA 3FALB 3G8OA 4BCRA 1X7BA 1YMTA 1ZGYA 2ZNQA 3VT5A 1ZAFA 5DWJA 1BSXA 1Z95A 4OH6A 4ZO1X 5DVSA 1UPVA 3PRGA 1I38A 4PXMA 4A4VA 3R5NA 4G20A 2OVMA 4K4JA 2HARA 3RLJA 2R6YA 5DIGA 2GPOA 5DXGA 3VT9A 2PRGA 4N1YA 1XP9A 5KCWA 5F9BA 1E3KA 1LV2A 1PCGA 2QPYA 5DV6A 5FQPA 4ZNHA 3DR1A 4P6XA 1XP1A 4TUZA 3X1HA 1QKMA 5K13A 5EI1A 3HC5A 4QM0A 4HLWA 5C4OA 2AX6A 3MNPA 2YLPA 3UU7B 2JJ3A 4POJA 3AN3A 3WJ5A 2VV3A 2ZNOA 5DRMA 2Q1VA 4MGCA 5KRAA 2Q7LA 1DKFB 2FAIA 2Q1HA 4FHHA 5AWKA 3RVFA 4A4WA 1XNXA 1U3RA 5LWPA 3K8SA 2ATHA 4MGAA 1FD0A 2PIUA 4ZI1A 1PRGA 4LTWA 3PBAA 3B68A 2AA2A 4IQRA 3O1EA 1P93A 2P15A 2PIWA 3B0QA 3CS4A 3OMMA 4KZJA 4KZIA 1SJ0A 2G0HA 5E0WA 5ETHA 5KCFA 4J24A 5G42A 4WLBA 3ADWA 4NUFA 3WTQA 3K6PA 4TV1B 5DI7A 3VSPA 5DIDA 2Q61A 3OAPA 3ZQTA 1T76A 4ZO1B 2P54A 2ZBSA 1YOKA 2ZNNA 3IXPD 2Q6RA 1WM0X 1UOMA 4IV2A 5B5BA 2VV1A 2E2RA 3KDTA 3FC6A 1NDEA 1LBDA 3VJSA 3HO0A 3H0AD 3X1IA 3S9SA 3AUQA 3ILZA 1X7EA 4OKBA 4WHFA 5DKSA 1T5ZA 1R6GA 4MG8A 3WWRA 5FQSA 3WJ4A 3P89A 5KROA 1T63A 4G2HA 3TKCA 3A40X 4NIEA 5FQRA 4KZMA 4OK1A 3V9YA 5DWLA 4PP5A 5ICKA 2Q6JA 4P6WA 1PK5A 5L7EA 3W0GA 3WGPA 4OEZA 4ZNTA 4OEDA 2ABIA 3V49A 1QKTA 4OFRA 5AZVA 2YJAB 4MG9A 1T7FA 2PIQA 3OLLA 1I7GA 4RMEA 2QGTA 5FQTA 1DB1A 1S9PA 1ZUCA 2HVCA 3DCUA 5KRJA 4ITFA 3IPUA 3A2HA 1S19A 3E94A 3VHWA 2EWPA 2W8YA 2A3IA 4E4QA 2QW4A 5L7GA 1N4HA 2BJ4A 1KNUA 1NUOA 2B1ZA 1XDKA 2OVHA 4IWCA 4CI4A 3OGTA 5DKGA 2O4JA 3L0LA 1FCXA 1K4WA 4R06A 3OKHA 4WPFA 2ZKCA 5DU5A 4G1DA 1Q4XA 2I4JA 1NYXA 3ZRBA 2H79A 3W0CA 4Q0AC 3PO9A 1U3SA 2PITA 2QA8B 5DUHA 5GIDA 4ZNWA 2VV4B 3L3XA 4RZFA 4J5XA 5APKA 3OS9A 5DXQA 1ILGA 5AZTA 3FEIA 1T73A 2AMAA 2YLQA 3L3ZA 3NSPA 1PQ9A 4UDCA 3VJHA 5KYJA 1R5KA 1RJKA 1T7TA 4RMCA 4OLMA 1XJ7A 2P1UA 2ACLA 3IPQA 3K23A 5DYBA 5DL4A 5DX3A 2ZLCA 1G5YA 3VRUA 2NV7A 3VT6A 4RWVA 5DXRA 3R29A 3WT6A 2ZNPA 3VJIA 3B0WA 2LBDA 3ET0A 3IXPA 4UDDA 5DUGA 1X78A 1FM6A 2QABA 3VT4A 3AN4A 2OUZA 1NRLA 3VI8A 5DMCA 5KRLA 5AVLA 4TUZB 4DQMA 3AZ1A 2PIRA 4N8RA 3ET1A 3H0AA 4Y29A 5DZIA 3L03A 4M8EA 2AB2A 3D24A 2AX7A 3FLIA 3OS8A 4MGBA 3ADVA 4JYGA 2I4ZA 3RY9A 3UP3A 2IOKA 4EMAA 2YFEA 3OOFA 4N5GA 2I0JA 3UP0A 3OSAA 2Q70A 3JZBA 2PINA 5DTVA 2XKWA 5DVVA 4NQAB 1GWXA 5G45A 4MGAB 5L7HA 5EJVA 5IXKA 3R8AA 2ZK5A 4JGVA 2Q5PA 3A2JA 3D57A 4Q50A 4QK4A 1U9EA 1VJBA 1QKUA 3W5TA 2B50A 2BAWA 2HB8A 1HJ1A 3UVVA 4G1ZA 3ADSA 3HZFA 3GD2A 2ZL9A 1XOWA 4XTAA 5DXBA 3VT7A 4RFWA 2Q7JA 4B7WA 3W5QA 3VRTA 2B23A 5KCDA 4OZRU 3W0JA 3KYTA 1T74A 1PQCA 4ZJRA 3JZCA 4L98A 2IOGA 3CQVA 5DSHA 5DKBA 1G50A 1I7IA 3CLDA 4IA1A 1YOWA 5C4UA 3RLLA 1NQ0A 4RAKA 1Z5XU 1IE9A 2VV1B 3FC6B 4MG7A 1A52A 3DZYA 2NW4A 5DRJA 3G8IA 4G2IA 1G1UA 4MG8B 2HWRA 5DIEA 5E7VA 3E00D 5EITA 3NOAA 3UUCA 3DY6A 1QKNA 5KRCA 2Q8SA 3D6DA 3OMPA 1N83A 1NQ1A 1GWRA 1XV9A 2O4RA 3F7DA 4QL8A 2PKLA 4OKTA 4OJ4A 4JYIA 2XYWA 5KRFA 5JY3A 4MG9B 3FURA 5KRKA 3PCUA 2ZY0A 1ZDUA 2AAXA 3V9VA 1TXIA 2JF9A 1XB7A 1MZNA 1PZLA 3U9QA 3W0YA 3VTDA 1GS4A 1XAPA 1EXXA 2REWA 3B0RA 2QSEA 1Y0SA 2ZXNA 2HBHA 3WT7A 5I4VA 5KRHA 2YLYA 1ZH7A 1SR7A 2NXXE 2J7XA 2VSRA 3OMQA 4OILA 5M96A 2R40A 1T79A 2PJLA 1FM6D 2J4AA 3HLVA 4S0SA 2BJ4B 5AVIA 4E2JA 5HJPB 1XDKB 2ZLAA 5HCVA 1N46A 1OT7A 2B1VA 3IMYA 3VHVA 3B67A 2VV0A 4JYHA 5KD9A 3A9EA 2ZXMA 4ZOMA 4OZTE 4JL4A 3CJWA 3CDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DM8 A;  2ZVT A;  3UUA B;  1Y9R A;  3BC5 A;  4S14 A;  1XQ3 A;  5HJS A;  1YP0 A;  4OH5 A;  2OAX A;  3E7C A;  3P8X A;  5KYA A;  2J14 A;  1FBY A;  3NSQ A;  3VN2 A;  4RUP A;  4S0T A;  2GIU A;  2HCD A;  4APU A;  2ACL B;  3HQ5 A;  5DX3 B;  5AAV A;  2OM9 A;  4PPP A;  2HAS A;  1H9U A;  1XQC A;  3ADU A;  4IU7 A;  3MNE A;  2JFA A;  4ONI A;  4IV4 A;  5SYZ A;  1XVP A;  4XT9 A;  3PLZ A;  4LNW A;  5HJP A;  3M7R A;  4OZR E;  4PRG A;  5DV3 A;  5EHJ A;  1GWQ A;  2P7A A;  2GL8 A;  3AUN A;  4Q13 A;  4XLD A;  4DMA A;  1RKH A;  2O9I A;  2AX9 A;  4MGB B;  4IA3 A;  3EYB A;  5FQV A;  3WMH A;  3E00 A;  1Z5X E;  3UUA A;  1XLS E;  2P7Z A;  3F5C A;  1Y0X X;  1XP6 A;  3FS1 A;  2YHD A;  3L0J A;  4LSJ A;  5APH A;  5G44 A;  3ERD A;  3UUD A;  3GZ9 A;  4ZN9 A;  3DZY D;  3CDS A;  3ERT A;  1SKX A;  3LMP A;  5DK9 A;  2QH6 A;  2NXX A;  3OSI A;  4OEA A;  4REE A;  5DWI A;  3R5M A;  3W0I A;  1KKQ A;  5KCT A;  5KRI A;  2VST A;  5CJ6 A;  2V7C A;  2ZXZ A;  3A3Z X;  4IVY A;  5LGA A;  4IWF A;  3KMZ A;  1NAV A;  2QXM A;  3Q95 A;  4OJB A;  5DV8 A;  4MDD A;  5HYK A;  5IAW A;  3B5R A;  4EM9 A;  1T65 A;  3O1D A;  4YMQ A;  1YIM A;  4WHG A;  4MG6 A;  2ZMJ A;  4OIV A;  3UVV B;  2ZAS A;  5DXP A;  4OIU A;  5G46 A;  2GTK A;  2G0G A;  4OAR A;  2QTU A;  5IZ0 A;  4YPQ A;  5DXB B;  5DLR A;  2ZK6 A;  3DZU A;  3AUR A;  2IHQ A;  3SZ1 A;  3ET2 A;  3OOK A;  3RUU A;  2AMB A;  2ZK2 A;  2AYR A;  1IE8 A;  1ERR A;  1M13 A;  2R40 D;  4NY9 A;  4OZT U;  4PVU A;  2Q59 B;  3BEJ A;  4K7A A;  1SQN A;  2Z4J A;  4QJR A;  3L1B A;  3D90 A;  4J5W A;  2XHS A;  4MG7 B;  1MVC A;  3OMO A;  4G1Y A;  2GPU A;  5G43 A;  3CTB A;  4A2J A;  4N73 A;  2GPP A;  3FXV A;  1YIN A;  1S0X A;  3OLS A;  4PWL A;  5GIC A;  3ADX A;  5DMF A;  3OMK A;  2AO6 A;  3FUG A;  4XI3 A;  1UHL A;  5DXK A;  3W5P A;  4R6S A;  5DUE A;  5APJ A;  4OFU A;  1XV9 B;  4POH A;  1FCY A;  2QGW A;  3CS8 A;  3FEJ A;  4WVD A;  5DY8 A;  3WFG A;  3P88 A;  5KCC A;  2V0V A;  2QZO A;  4MGD A;  3D5F A;  5JJM A;  1M2Z A;  1XPC A;  3GYU A;  1PDU A;  3R8D A;  3BQD A;  5G5W A;  3T03 A;  2J7Y A;  1XLS A;  1K7L A;  3GYT A;  1ERE A;  4ZNS A;  4OEY A;  2OZ7 A;  5DXE A;  2AWH A;  4OKX A;  2ZK1 A;  2PIX A;  5DZ3 A;  3AFR A;  4NB6 A;  5DZH A;  4DK7 A;  2Q59 A;  1E3G A;  1NHZ A;  2YAT A;  1A28 A;  5AYG A;  4J5X C;  5G3J A;  1R1K D;  4XHD A;  3KMR A;  1X76 A;  2POB A;  3A9E B;  2AA7 A;  4IA2 A;  1NQ2 A;  5ACC A;  5KCE A;  1OVL A;  4ZNU A;  5KCU A;  3A78 A;  2PIV A;  2VV2 A;  2OCF A;  3KPZ A;  3R2A A;  4ZNV A;  4ZJW A;  5KRM A;  1RK3 A;  3ADT A;  2ZK4 A;  4FN9 A;  4IW8 A;  4LNX A;  3TY0 A;  2F4B A;  3HOD A;  5E1C A;  5C4S A;  4JAZ A;  2P7G A;  4L96 A;  3R8I A;  1FM9 D;  4RE8 A;  2AM9 A;  3B0T A;  5DXM A;  5EC9 A;  3OZ0 A;  3WT5 A;  3WFF A;  1L2J A;  1YJE A;  3H52 A;  2Q5S A;  5AAV B;  4E4K A;  5AWJ A;  3DT3 A;  4XUH A;  4OJ9 A;  3OS8 C;  3FAL A;  2QNV A;  2JFA B;  2GP7 A;  3K22 A;  2Q6S A;  1XVP B;  3V3Q A;  3AZ2 A;  1RDT A;  3TKM A;  4J26 A;  4J5W C;  2YLO A;  4R2U A;  2ZK3 A;  3DZU D;  3VHU A;  3KWY A;  4OHA A;  4IW6 A;  3HC6 A;  3ET3 A;  1S0Z A;  3CS6 A;  4PF3 A;  4X1F A;  1OSH A;  2Q7I A;  4ITE A;  3W5R A;  2Z4B A;  5AAU A;  2AXA A;  2P1T A;  4YT1 A;  1ILH A;  2FSZ A;  2HWQ A;  3F5C B;  4HEE X;  4M8H A;  5C4T A;  4OGH A;  2ZMI A;  3UUD B;  3IA6 A;  3VSO A;  1X7R A;  5L11 A;  2ZMH A;  4OC7 A;  4PP3 A;  1ZKY A;  3KDU A;  4IA7 A;  4O8F A;  2HAM A;  3OSW A;  2ZK0 A;  3UU7 A;  4CI5 A;  2P1V A;  2GWX A;  2R6W A;  1I37 A;  3Q95 B;  2AX8 A;  3KMG A;  4MG5 A;  1PQ6 A;  3B3K A;  2HFP A;  2NPA A;  1R20 A;  1DKF A;  1ZDT A;  2GPV A;  2I4P A;  2PNU A;  4WQP A;  3SP9 A;  1K74 D;  4REF A;  4QE6 A;  3VTB A;  1UPW A;  2QMV A;  1G2N A;  4RZE A;  1ZEO A;  3OZJ A;  4DOR A;  2YJD A;  4PLE A;  3OLF A;  1R1K A;  3X36 A;  3LBD A;  3KFC A;  5DWE A;  3GN8 A;  3V3E A;  4DOS A;  3B66 A;  3AX8 A;  4RUJ A;  4X1G A;  5DZ1 A;  5DZ0 A;  3VT3 A;  3B1M A;  3HM1 A;  1YY4 A;  2AA5 A;  2Q60 A;  4RUO X;  4RZG A;  3VT8 A;  5B41 A;  3G0W A;  4G21 A;  5KR9 A;  4TV1 A;  5HYR A;  4RMD A;  5E19 A;  4PP6 A;  4S15 A;  2G44 A;  1FM9 A;  5JI0 D;  2Q7K A;  3QT0 A;  3L0E A;  3X31 A;  2FVJ A;  2AA6 A;  4K6I A;  5EGV A;  1MV9 A;  4LBD A;  1P8D A;  3G9E A;  4UDA A;  4PPS A;  1X7J A;  2XYX A;  3N00 A;  1YUC A;  4OKW A;  1OSV A;  1UHL B;  5H1E A;  3MNO A;  3GWS X;  2Q3Y A;  4IVW A;  4YNK A;  5DVC A;  3OKI A;  4XAO A;  5DP0 A;  5E14 A;  4DM6 A;  2QZO B;  3P0U A;  1T7M A;  2PIP L;  4MGD B;  4DK8 A;  1NAX A;  2G5O A;  1L2I A;  2I0G A;  3B65 A;  4FHI A;  4XUM A;  4F9M A;  5JJM B;  1NQ7 A;  5AK2 A;  3W0A A;  2HC4 A;  3DCT A;  2H77 A;  1XZX X;  1RKG A;  2ZFX A;  2QXS A;  1RDT D;  3RUT A;  1FCZ A;  1S9Q A;  5GIE A;  3ZR7 A;  2HB7 A;  2XYJ A;  3ZRA A;  4ZN7 A;  4FGY A;  5E0X A;  3VRW A;  4FNE A;  3KBA A;  5GT4 A;  1YA3 A;  2QA6 A;  3IPS A;  3VJT A;  1T7R A;  3TX7 B;  1HG4 A;  1OVL B;  5DYD A;  1EXA A;  3A2I A;  1XIU A;  5A86 A;  2QE4 A;  1XNN A;  3SP6 A;  3HVL A;  3V4A A;  1TFC A;  5E15 A;  1YYE A;  3W0H A;  3GWX A;  4IS8 A;  2P4Y A;  5DWG A;  1M7W A;  1K74 A;  3VTC A;  3V9T A;  1KV6 A;  4IUI A;  2PIO A;  4CSJ A;  1U3Q A;  3AZ3 A;  2POG A;  5HZC A;  3GBK A;  4UDB A;  5DKE A;  2QA8 A;  4QE8 A;  2Q5G A;  1R20 D;  2QR9 A;  2VV4 A;  3CWD A;  3PEQ A;  4PLD A;  3VRV A;  3FAL B;  3G8O A;  4BCR A;  1X7B A;  1YMT A;  1ZGY A;  2ZNQ A;  3VT5 A;  1ZAF A;  5DWJ A;  1BSX A;  1Z95 A;  4OH6 A;  4ZO1 X;  5DVS A;  1UPV A;  3PRG A;  1I38 A;  4PXM A;  4A4V A;  3R5N A;  4G20 A;  2OVM A;  4K4J A;  2HAR A;  3RLJ A;  2R6Y A;  5DIG A;  2GPO A;  5DXG A;  3VT9 A;  2PRG A;  4N1Y A;  1XP9 A;  5KCW A;  5F9B A;  1E3K A;  1LV2 A;  1PCG A;  2QPY A;  5DV6 A;  5FQP A;  4ZNH A;  3DR1 A;  4P6X A;  1XP1 A;  4TUZ A;  3X1H A;  1QKM A;  5K13 A;  5EI1 A;  3HC5 A;  4QM0 A;  4HLW A;  5C4O A;  2AX6 A;  3MNP A;  2YLP A;  3UU7 B;  2JJ3 A;  4POJ A;  3AN3 A;  3WJ5 A;  2VV3 A;  2ZNO A;  5DRM A;  2Q1V A;  4MGC A;  5KRA A;  2Q7L A;  1DKF B;  2FAI A;  2Q1H A;  4FHH A;  5AWK A;  3RVF A;  4A4W A;  1XNX A;  1U3R A;  5LWP A;  3K8S A;  2ATH A;  4MGA A;  1FD0 A;  2PIU A;  4ZI1 A;  1PRG A;  4LTW A;  3PBA A;  3B68 A;  2AA2 A;  4IQR A;  3O1E A;  1P93 A;  2P15 A;  2PIW A;  3B0Q A;  3CS4 A;  3OMM A;  4KZJ A;  4KZI A;  1SJ0 A;  2G0H A;  5E0W A;  5ETH A;  5KCF A;  4J24 A;  5G42 A;  4WLB A;  3ADW A;  4NUF A;  3WTQ A;  3K6P A;  4TV1 B;  5DI7 A;  3VSP A;  5DID A;  2Q61 A;  3OAP A;  3ZQT A;  1T76 A;  4ZO1 B;  2P54 A;  2ZBS A;  1YOK A;  2ZNN A;  3IXP D;  2Q6R A;  1WM0 X;  1UOM A;  4IV2 A;  5B5B A;  2VV1 A;  2E2R A;  3KDT A;  3FC6 A;  1NDE A;  1LBD A;  3VJS A;  3HO0 A;  3H0A D;  3X1I A;  3S9S A;  3AUQ A;  3ILZ A;  1X7E A;  4OKB A;  4WHF A;  5DKS A;  1T5Z A;  1R6G A;  4MG8 A;  3WWR A;  5FQS A;  3WJ4 A;  3P89 A;  5KRO A;  1T63 A;  4G2H A;  3TKC A;  3A40 X;  4NIE A;  5FQR A;  4KZM A;  4OK1 A;  3V9Y A;  5DWL A;  4PP5 A;  5ICK A;  2Q6J A;  4P6W A;  1PK5 A;  5L7E A;  3W0G A;  3WGP A;  4OEZ A;  4ZNT A;  4OED A;  2ABI A;  3V49 A;  1QKT A;  4OFR A;  5AZV A;  2YJA B;  4MG9 A;  1T7F A;  2PIQ A;  3OLL A;  1I7G A;  4RME A;  2QGT A;  5FQT A;  1DB1 A;  1S9P A;  1ZUC A;  2HVC A;  3DCU A;  5KRJ A;  4ITF A;  3IPU A;  3A2H A;  1S19 A;  3E94 A;  3VHW A;  2EWP A;  2W8Y A;  2A3I A;  4E4Q A;  2QW4 A;  5L7G A;  1N4H A;  2BJ4 A;  1KNU A;  1NUO A;  2B1Z A;  1XDK A;  2OVH A;  4IWC A;  4CI4 A;  3OGT A;  5DKG A;  2O4J A;  3L0L A;  1FCX A;  1K4W A;  4R06 A;  3OKH A;  4WPF A;  2ZKC A;  5DU5 A;  4G1D A;  1Q4X A;  2I4J A;  1NYX A;  3ZRB A;  2H79 A;  3W0C A;  4Q0A C;  3PO9 A;  1U3S A;  2PIT A;  2QA8 B;  5DUH A;  5GID A;  4ZNW A;  2VV4 B;  3L3X A;  4RZF A;  4J5X A;  5APK A;  3OS9 A;  5DXQ A;  1ILG A;  5AZT A;  3FEI A;  1T73 A;  2AMA A;  2YLQ A;  3L3Z A;  3NSP A;  1PQ9 A;  4UDC A;  3VJH A;  5KYJ A;  1R5K A;  1RJK A;  1T7T A;  4RMC A;  4OLM A;  1XJ7 A;  2P1U A;  2ACL A;  3IPQ A;  3K23 A;  5DYB A;  5DL4 A;  5DX3 A;  2ZLC A;  1G5Y A;  3VRU A;  2NV7 A;  3VT6 A;  4RWV A;  5DXR A;  3R29 A;  3WT6 A;  2ZNP A;  3VJI A;  3B0W A;  2LBD A;  3ET0 A;  3IXP A;  4UDD A;  5DUG A;  1X78 A;  1FM6 A;  2QAB A;  3VT4 A;  3AN4 A;  2OUZ A;  1NRL A;  3VI8 A;  5DMC A;  5KRL A;  5AVL A;  4TUZ B;  4DQM A;  3AZ1 A;  2PIR A;  4N8R A;  3ET1 A;  3H0A A;  4Y29 A;  5DZI A;  3L03 A;  4M8E A;  2AB2 A;  3D24 A;  2AX7 A;  3FLI A;  3OS8 A;  4MGB A;  3ADV A;  4JYG A;  2I4Z A;  3RY9 A;  3UP3 A;  2IOK A;  4EMA A;  2YFE A;  3OOF A;  4N5G A;  2I0J A;  3UP0 A;  3OSA A;  2Q70 A;  3JZB A;  2PIN A;  5DTV A;  2XKW A;  5DVV A;  4NQA B;  1GWX A;  5G45 A;  4MGA B;  5L7H A;  5EJV A;  5IXK A;  3R8A A;  2ZK5 A;  4JGV A;  2Q5P A;  3A2J A;  3D57 A;  4Q50 A;  4QK4 A;  1U9E A;  1VJB A;  1QKU A;  3W5T A;  2B50 A;  2BAW A;  2HB8 A;  1HJ1 A;  3UVV A;  4G1Z A;  3ADS A;  3HZF A;  3GD2 A;  2ZL9 A;  1XOW A;  4XTA A;  5DXB A;  3VT7 A;  4RFW A;  2Q7J A;  4B7W A;  3W5Q A;  3VRT A;  2B23 A;  5KCD A;  4OZR U;  3W0J A;  3KYT A;  1T74 A;  1PQC A;  4ZJR A;  3JZC A;  4L98 A;  2IOG A;  3CQV A;  5DSH A;  5DKB A;  1G50 A;  1I7I A;  3CLD A;  4IA1 A;  1YOW A;  5C4U A;  3RLL A;  1NQ0 A;  4RAK A;  1Z5X U;  1IE9 A;  2VV1 B;  3FC6 B;  4MG7 A;  1A52 A;  3DZY A;  2NW4 A;  5DRJ A;  3G8I A;  4G2I A;  1G1U A;  4MG8 B;  2HWR A;  5DIE A;  5E7V A;  3E00 D;  5EIT A;  3NOA A;  3UUC A;  3DY6 A;  1QKN A;  5KRC A;  2Q8S A;  3D6D A;  3OMP A;  1N83 A;  1NQ1 A;  1GWR A;  1XV9 A;  2O4R A;  3F7D A;  4QL8 A;  2PKL A;  4OKT A;  4OJ4 A;  4JYI A;  2XYW A;  5KRF A;  5JY3 A;  4MG9 B;  3FUR A;  5KRK A;  3PCU A;  2ZY0 A;  1ZDU A;  2AAX A;  3V9V A;  1TXI A;  2JF9 A;  1XB7 A;  1MZN A;  1PZL A;  3U9Q A;  3W0Y A;  3VTD A;  1GS4 A;  1XAP A;  1EXX A;  2REW A;  3B0R A;  2QSE A;  1Y0S A;  2ZXN A;  2HBH A;  3WT7 A;  5I4V A;  5KRH A;  2YLY A;  1ZH7 A;  1SR7 A;  2NXX E;  2J7X A;  2VSR A;  3OMQ A;  4OIL A;  5M96 A;  2R40 A;  1T79 A;  2PJL A;  1FM6 D;  2J4A A;  3HLV A;  4S0S A;  2BJ4 B;  5AVI A;  4E2J A;  5HJP B;  1XDK B;  2ZLA A;  5HCV A;  1N46 A;  1OT7 A;  2B1V A;  3IMY A;  3VHV A;  3B67 A;  2VV0 A;  4JYH A;  5KD9 A;  3A9E A;  2ZXM A;  4ZOM A;  4OZT E;  4JL4 A;  3CJW A;  3CDP A; 
#chains in the Genus database with same CATH topology
 4DM8 A;  2ZVT A;  3UUA B;  1Y9R A;  3BC5 A;  4S14 A;  1XQ3 A;  5HJS A;  1YP0 A;  4OH5 A;  2OAX A;  3E7C A;  3P8X A;  5KYA A;  2J14 A;  1FBY A;  3NSQ A;  3VN2 A;  4RUP A;  4S0T A;  2GIU A;  2HCD A;  4APU A;  2ACL B;  3HQ5 A;  5DX3 B;  5AAV A;  2OM9 A;  4PPP A;  2HAS A;  1H9U A;  1XQC A;  3ADU A;  4IU7 A;  3MNE A;  2JFA A;  4ONI A;  4IV4 A;  5SYZ A;  1XVP A;  4XT9 A;  3PLZ A;  4LNW A;  5HJP A;  3M7R A;  4OZR E;  4PRG A;  5DV3 A;  5EHJ A;  1GWQ A;  2P7A A;  2GL8 A;  3AUN A;  4Q13 A;  4XLD A;  4DMA A;  1RKH A;  2O9I A;  2AX9 A;  4MGB B;  4IA3 A;  3EYB A;  5FQV A;  3WMH A;  3E00 A;  1Z5X E;  3UUA A;  1XLS E;  2P7Z A;  3F5C A;  1Y0X X;  1XP6 A;  3FS1 A;  2YHD A;  3L0J A;  4LSJ A;  5APH A;  5G44 A;  3ERD A;  3UUD A;  3GZ9 A;  4ZN9 A;  3DZY D;  3CDS A;  3ERT A;  1SKX A;  3LMP A;  5DK9 A;  2QH6 A;  2NXX A;  3OSI A;  4OEA A;  4REE A;  5DWI A;  3R5M A;  3W0I A;  1KKQ A;  5KCT A;  5KRI A;  2VST A;  5CJ6 A;  2V7C A;  2ZXZ A;  3A3Z X;  4IVY A;  5LGA A;  4IWF A;  3KMZ A;  1NAV A;  2QXM A;  3Q95 A;  4OJB A;  5DV8 A;  4MDD A;  5HYK A;  5IAW A;  3B5R A;  4EM9 A;  1T65 A;  3O1D A;  4YMQ A;  1YIM A;  4WHG A;  4MG6 A;  2ZMJ A;  4OIV A;  3UVV B;  2ZAS A;  5DXP A;  4OIU A;  5G46 A;  2GTK A;  2G0G A;  4OAR A;  2QTU A;  5IZ0 A;  4YPQ A;  5DXB B;  5DLR A;  2ZK6 A;  3DZU A;  3AUR A;  2IHQ A;  3SZ1 A;  3ET2 A;  3OOK A;  3RUU A;  2AMB A;  2ZK2 A;  2AYR A;  1IE8 A;  1ERR A;  1M13 A;  2R40 D;  4NY9 A;  4OZT U;  4PVU A;  2Q59 B;  3BEJ A;  4K7A A;  1SQN A;  2Z4J A;  4QJR A;  3L1B A;  3D90 A;  4J5W A;  2XHS A;  4MG7 B;  1MVC A;  3OMO A;  4G1Y A;  2GPU A;  5G43 A;  3CTB A;  4A2J A;  4N73 A;  2GPP A;  3FXV A;  1YIN A;  1S0X A;  3OLS A;  4PWL A;  5GIC A;  3ADX A;  5DMF A;  3OMK A;  2AO6 A;  3FUG A;  4XI3 A;  1UHL A;  5DXK A;  3W5P A;  4R6S A;  5DUE A;  5APJ A;  4OFU A;  1XV9 B;  4POH A;  1FCY A;  2QGW A;  3CS8 A;  3FEJ A;  4WVD A;  5DY8 A;  3WFG A;  3P88 A;  5KCC A;  2V0V A;  2QZO A;  4MGD A;  3D5F A;  5JJM A;  1M2Z A;  1XPC A;  3GYU A;  1PDU A;  3R8D A;  3BQD A;  5G5W A;  3T03 A;  2J7Y A;  1XLS A;  1K7L A;  3GYT A;  1ERE A;  4ZNS A;  4OEY A;  2OZ7 A;  5DXE A;  2AWH A;  4OKX A;  2ZK1 A;  2PIX A;  5DZ3 A;  3AFR A;  4NB6 A;  5DZH A;  4DK7 A;  2Q59 A;  1E3G A;  1NHZ A;  2YAT A;  1A28 A;  5AYG A;  4J5X C;  5G3J A;  1R1K D;  4XHD A;  3KMR A;  1X76 A;  2POB A;  3A9E B;  2AA7 A;  4IA2 A;  1NQ2 A;  5ACC A;  5KCE A;  1OVL A;  4ZNU A;  5KCU A;  3A78 A;  2PIV A;  2VV2 A;  2OCF A;  3KPZ A;  3R2A A;  4ZNV A;  4ZJW A;  5KRM A;  1RK3 A;  3ADT A;  2ZK4 A;  4FN9 A;  4IW8 A;  4LNX A;  3TY0 A;  2F4B A;  3HOD A;  5E1C A;  5C4S A;  4JAZ A;  2P7G A;  4L96 A;  3R8I A;  1FM9 D;  4RE8 A;  2AM9 A;  3B0T A;  5DXM A;  5EC9 A;  3OZ0 A;  3WT5 A;  3WFF A;  1L2J A;  1YJE A;  3H52 A;  2Q5S A;  5AAV B;  4E4K A;  5AWJ A;  3DT3 A;  4XUH A;  4OJ9 A;  3OS8 C;  3FAL A;  2QNV A;  2JFA B;  2GP7 A;  3K22 A;  2Q6S A;  1XVP B;  3V3Q A;  3AZ2 A;  1RDT A;  3TKM A;  4J26 A;  4J5W C;  2YLO A;  4R2U A;  2ZK3 A;  3DZU D;  3VHU A;  3KWY A;  4OHA A;  4IW6 A;  3HC6 A;  3ET3 A;  1S0Z A;  3CS6 A;  4PF3 A;  4X1F A;  1OSH A;  2Q7I A;  4ITE A;  3W5R A;  2Z4B A;  5AAU A;  2AXA A;  2P1T A;  4YT1 A;  1ILH A;  2FSZ A;  2HWQ A;  3F5C B;  4HEE X;  4M8H A;  5C4T A;  4OGH A;  2ZMI A;  3UUD B;  3IA6 A;  3VSO A;  1X7R A;  5L11 A;  2ZMH A;  4OC7 A;  4PP3 A;  1ZKY A;  3KDU A;  4IA7 A;  4O8F A;  2HAM A;  3OSW A;  2ZK0 A;  3UU7 A;  4CI5 A;  2P1V A;  2GWX A;  2R6W A;  1I37 A;  3Q95 B;  2AX8 A;  3KMG A;  4MG5 A;  1PQ6 A;  3B3K A;  2HFP A;  2NPA A;  1R20 A;  1DKF A;  1ZDT A;  2GPV A;  2I4P A;  2PNU A;  4WQP A;  3SP9 A;  1K74 D;  4REF A;  4QE6 A;  3VTB A;  1UPW A;  2QMV A;  1G2N A;  4RZE A;  1ZEO A;  3OZJ A;  4DOR A;  2YJD A;  4PLE A;  3OLF A;  1R1K A;  3X36 A;  3LBD A;  3KFC A;  5DWE A;  3GN8 A;  3V3E A;  4DOS A;  3B66 A;  3AX8 A;  4RUJ A;  4X1G A;  5DZ1 A;  5DZ0 A;  3VT3 A;  3B1M A;  3HM1 A;  1YY4 A;  2AA5 A;  2Q60 A;  4RUO X;  4RZG A;  3VT8 A;  5B41 A;  3G0W A;  4G21 A;  5KR9 A;  4TV1 A;  5HYR A;  4RMD A;  5E19 A;  4PP6 A;  4S15 A;  2G44 A;  1FM9 A;  5JI0 D;  2Q7K A;  3QT0 A;  3L0E A;  3X31 A;  2FVJ A;  2AA6 A;  4K6I A;  5EGV A;  1MV9 A;  4LBD A;  1P8D A;  3G9E A;  4UDA A;  4PPS A;  1X7J A;  2XYX A;  3N00 A;  1YUC A;  4OKW A;  1OSV A;  1UHL B;  5H1E A;  3MNO A;  3GWS X;  2Q3Y A;  4IVW A;  4YNK A;  5DVC A;  3OKI A;  4XAO A;  5DP0 A;  5E14 A;  4DM6 A;  2QZO B;  3P0U A;  1T7M A;  2PIP L;  4MGD B;  4DK8 A;  1NAX A;  2G5O A;  1L2I A;  2I0G A;  3B65 A;  4FHI A;  4XUM A;  4F9M A;  5JJM B;  1NQ7 A;  5AK2 A;  3W0A A;  2HC4 A;  3DCT A;  2H77 A;  1XZX X;  1RKG A;  2ZFX A;  2QXS A;  1RDT D;  3RUT A;  1FCZ A;  1S9Q A;  5GIE A;  3ZR7 A;  2HB7 A;  2XYJ A;  3ZRA A;  4ZN7 A;  4FGY A;  5E0X A;  3VRW A;  4FNE A;  3KBA A;  5GT4 A;  1YA3 A;  2QA6 A;  3IPS A;  3VJT A;  1T7R A;  3TX7 B;  1HG4 A;  1OVL B;  5DYD A;  1EXA A;  3A2I A;  1XIU A;  5A86 A;  2QE4 A;  1XNN A;  3SP6 A;  3HVL A;  3V4A A;  1TFC A;  5E15 A;  1YYE A;  3W0H A;  3GWX A;  4IS8 A;  2P4Y A;  5DWG A;  1M7W A;  1K74 A;  3VTC A;  3V9T A;  1KV6 A;  4IUI A;  2PIO A;  4CSJ A;  1U3Q A;  3AZ3 A;  2POG A;  5HZC A;  3GBK A;  4UDB A;  5DKE A;  2QA8 A;  4QE8 A;  2Q5G A;  1R20 D;  2QR9 A;  2VV4 A;  3CWD A;  3PEQ A;  4PLD A;  3VRV A;  3FAL B;  3G8O A;  4BCR A;  1X7B A;  1YMT A;  1ZGY A;  2ZNQ A;  3VT5 A;  1ZAF A;  5DWJ A;  1BSX A;  1Z95 A;  4OH6 A;  4ZO1 X;  5DVS A;  1UPV A;  3PRG A;  1I38 A;  4PXM A;  4A4V A;  3R5N A;  4G20 A;  2OVM A;  4K4J A;  2HAR A;  3RLJ A;  2R6Y A;  5DIG A;  2GPO A;  5DXG A;  3VT9 A;  2PRG A;  4N1Y A;  1XP9 A;  5KCW A;  5F9B A;  1E3K A;  1LV2 A;  1PCG A;  2QPY A;  5DV6 A;  5FQP A;  4ZNH A;  3DR1 A;  4P6X A;  1XP1 A;  4TUZ A;  3X1H A;  1QKM A;  5K13 A;  5EI1 A;  3HC5 A;  4QM0 A;  4HLW A;  5C4O A;  2AX6 A;  3MNP A;  2YLP A;  3UU7 B;  2JJ3 A;  4POJ A;  3AN3 A;  3WJ5 A;  2VV3 A;  2ZNO A;  5DRM A;  2Q1V A;  4MGC A;  5KRA A;  2Q7L A;  1DKF B;  2FAI A;  2Q1H A;  4FHH A;  5AWK A;  3RVF A;  4A4W A;  1XNX A;  1U3R A;  5LWP A;  3K8S A;  2ATH A;  4MGA A;  1FD0 A;  2PIU A;  4ZI1 A;  1PRG A;  4LTW A;  3PBA A;  3B68 A;  2AA2 A;  4IQR A;  3O1E A;  1P93 A;  2P15 A;  2PIW A;  3B0Q A;  3CS4 A;  3OMM A;  4KZJ A;  4KZI A;  1SJ0 A;  2G0H A;  5E0W A;  5ETH A;  5KCF A;  4J24 A;  5G42 A;  4WLB A;  3ADW A;  4NUF A;  3WTQ A;  3K6P A;  4TV1 B;  5DI7 A;  3VSP A;  5DID A;  2Q61 A;  3OAP A;  3ZQT A;  1T76 A;  4ZO1 B;  2P54 A;  2ZBS A;  1YOK A;  2ZNN A;  3IXP D;  2Q6R A;  1WM0 X;  1UOM A;  4IV2 A;  5B5B A;  2VV1 A;  2E2R A;  3KDT A;  3FC6 A;  1NDE A;  1LBD A;  3VJS A;  3HO0 A;  3H0A D;  3X1I A;  3S9S A;  3AUQ A;  3ILZ A;  1X7E A;  4OKB A;  4WHF A;  5DKS A;  1T5Z A;  1R6G A;  4MG8 A;  3WWR A;  5FQS A;  3WJ4 A;  3P89 A;  5KRO A;  1T63 A;  4G2H A;  3TKC A;  3A40 X;  4NIE A;  5FQR A;  4KZM A;  4OK1 A;  3V9Y A;  5DWL A;  4PP5 A;  5ICK A;  2Q6J A;  4P6W A;  1PK5 A;  5L7E A;  3W0G A;  3WGP A;  4OEZ A;  4ZNT A;  4OED A;  2ABI A;  3V49 A;  1QKT A;  4OFR A;  5AZV A;  2YJA B;  4MG9 A;  1T7F A;  2PIQ A;  3OLL A;  1I7G A;  4RME A;  2QGT A;  5FQT A;  1DB1 A;  1S9P A;  1ZUC A;  2HVC A;  3DCU A;  5KRJ A;  4ITF A;  3IPU A;  3A2H A;  1S19 A;  3E94 A;  3VHW A;  2EWP A;  2W8Y A;  2A3I A;  4E4Q A;  2QW4 A;  5L7G A;  1N4H A;  2BJ4 A;  1KNU A;  1NUO A;  2B1Z A;  1XDK A;  2OVH A;  4IWC A;  4CI4 A;  3OGT A;  5DKG A;  2O4J A;  3L0L A;  1FCX A;  1K4W A;  4R06 A;  3OKH A;  4WPF A;  2ZKC A;  5DU5 A;  4G1D A;  1Q4X A;  2I4J A;  1NYX A;  3ZRB A;  2H79 A;  3W0C A;  4Q0A C;  3PO9 A;  1U3S A;  2PIT A;  2QA8 B;  5DUH A;  5GID A;  4ZNW A;  2VV4 B;  3L3X A;  4RZF A;  4J5X A;  5APK A;  3OS9 A;  5DXQ A;  1ILG A;  5AZT A;  3FEI A;  1T73 A;  2AMA A;  2YLQ A;  3L3Z A;  3NSP A;  1PQ9 A;  4UDC A;  3VJH A;  5KYJ A;  1R5K A;  1RJK A;  1T7T A;  4RMC A;  4OLM A;  1XJ7 A;  2P1U A;  2ACL A;  3IPQ A;  3K23 A;  5DYB A;  5DL4 A;  5DX3 A;  2ZLC A;  1G5Y A;  3VRU A;  2NV7 A;  3VT6 A;  4RWV A;  5DXR A;  3R29 A;  3WT6 A;  2ZNP A;  3VJI A;  3B0W A;  2LBD A;  3ET0 A;  3IXP A;  4UDD A;  5DUG A;  1X78 A;  1FM6 A;  2QAB A;  3VT4 A;  3AN4 A;  2OUZ A;  1NRL A;  3VI8 A;  5DMC A;  5KRL A;  5AVL A;  4TUZ B;  4DQM A;  3AZ1 A;  2PIR A;  4N8R A;  3ET1 A;  3H0A A;  4Y29 A;  5DZI A;  3L03 A;  4M8E A;  2AB2 A;  3D24 A;  2AX7 A;  3FLI A;  3OS8 A;  4MGB A;  3ADV A;  4JYG A;  2I4Z A;  3RY9 A;  3UP3 A;  2IOK A;  4EMA A;  2YFE A;  3OOF A;  4N5G A;  2I0J A;  3UP0 A;  3OSA A;  2Q70 A;  3JZB A;  2PIN A;  5DTV A;  2XKW A;  5DVV A;  4NQA B;  1GWX A;  5G45 A;  4MGA B;  5L7H A;  5EJV A;  5IXK A;  3R8A A;  2ZK5 A;  4JGV A;  2Q5P A;  3A2J A;  3D57 A;  4Q50 A;  4QK4 A;  1U9E A;  1VJB A;  1QKU A;  3W5T A;  2B50 A;  2BAW A;  2HB8 A;  1HJ1 A;  3UVV A;  4G1Z A;  3ADS A;  3HZF A;  3GD2 A;  2ZL9 A;  1XOW A;  4XTA A;  5DXB A;  3VT7 A;  4RFW A;  2Q7J A;  4B7W A;  3W5Q A;  3VRT A;  2B23 A;  5KCD A;  4OZR U;  3W0J A;  3KYT A;  1T74 A;  1PQC A;  4ZJR A;  3JZC A;  4L98 A;  2IOG A;  3CQV A;  5DSH A;  5DKB A;  1G50 A;  1I7I A;  3CLD A;  4IA1 A;  1YOW A;  5C4U A;  3RLL A;  1NQ0 A;  4RAK A;  1Z5X U;  1IE9 A;  2VV1 B;  3FC6 B;  4MG7 A;  1A52 A;  3DZY A;  2NW4 A;  5DRJ A;  3G8I A;  4G2I A;  1G1U A;  4MG8 B;  2HWR A;  5DIE A;  5E7V A;  3E00 D;  5EIT A;  3NOA A;  3UUC A;  3DY6 A;  1QKN A;  5KRC A;  2Q8S A;  3D6D A;  3OMP A;  1N83 A;  1NQ1 A;  1GWR A;  1XV9 A;  2O4R A;  3F7D A;  4QL8 A;  2PKL A;  4OKT A;  4OJ4 A;  4JYI A;  2XYW A;  5KRF A;  5JY3 A;  4MG9 B;  3FUR A;  5KRK A;  3PCU A;  2ZY0 A;  1ZDU A;  2AAX A;  3V9V A;  1TXI A;  2JF9 A;  1XB7 A;  1MZN A;  1PZL A;  3U9Q A;  3W0Y A;  3VTD A;  1GS4 A;  1XAP A;  1EXX A;  2REW A;  3B0R A;  2QSE A;  1Y0S A;  2ZXN A;  2HBH A;  3WT7 A;  5I4V A;  5KRH A;  2YLY A;  1ZH7 A;  1SR7 A;  2NXX E;  2J7X A;  2VSR A;  3OMQ A;  4OIL A;  5M96 A;  2R40 A;  1T79 A;  2PJL A;  1FM6 D;  2J4A A;  3HLV A;  4S0S A;  2BJ4 B;  5AVI A;  4E2J A;  5HJP B;  1XDK B;  2ZLA A;  5HCV A;  1N46 A;  1OT7 A;  2B1V A;  3IMY A;  3VHV A;  3B67 A;  2VV0 A;  4JYH A;  5KD9 A;  3A9E A;  2ZXM A;  4ZOM A;  4OZT E;  4JL4 A;  3CJW A;  3CDP A; 
#chains in the Genus database with same CATH homology
 4DM8 A;  2ZVT A;  3UUA B;  1Y9R A;  3BC5 A;  4S14 A;  1XQ3 A;  5HJS A;  1YP0 A;  4OH5 A;  2OAX A;  3E7C A;  3P8X A;  5KYA A;  2J14 A;  1FBY A;  3NSQ A;  3VN2 A;  4RUP A;  4S0T A;  2GIU A;  2HCD A;  4APU A;  2ACL B;  3HQ5 A;  5DX3 B;  5AAV A;  2OM9 A;  4PPP A;  2HAS A;  1H9U A;  1XQC A;  3ADU A;  4IU7 A;  3MNE A;  2JFA A;  4ONI A;  4IV4 A;  5SYZ A;  1XVP A;  4XT9 A;  3PLZ A;  4LNW A;  5HJP A;  3M7R A;  4OZR E;  4PRG A;  5DV3 A;  5EHJ A;  1GWQ A;  2P7A A;  2GL8 A;  3AUN A;  4Q13 A;  4XLD A;  4DMA A;  1RKH A;  2O9I A;  2AX9 A;  4MGB B;  4IA3 A;  3EYB A;  5FQV A;  3WMH A;  3E00 A;  1Z5X E;  3UUA A;  1XLS E;  2P7Z A;  3F5C A;  1Y0X X;  1XP6 A;  3FS1 A;  2YHD A;  3L0J A;  4LSJ A;  5APH A;  5G44 A;  3ERD A;  3UUD A;  3GZ9 A;  4ZN9 A;  3DZY D;  3CDS A;  3ERT A;  1SKX A;  3LMP A;  5DK9 A;  2QH6 A;  2NXX A;  3OSI A;  4OEA A;  4REE A;  5DWI A;  3R5M A;  3W0I A;  1KKQ A;  5KCT A;  5KRI A;  2VST A;  5CJ6 A;  2V7C A;  2ZXZ A;  3A3Z X;  4IVY A;  5LGA A;  4IWF A;  3KMZ A;  1NAV A;  2QXM A;  3Q95 A;  4OJB A;  5DV8 A;  4MDD A;  5HYK A;  5IAW A;  3B5R A;  4EM9 A;  1T65 A;  3O1D A;  4YMQ A;  1YIM A;  4WHG A;  4MG6 A;  2ZMJ A;  4OIV A;  3UVV B;  2ZAS A;  5DXP A;  4OIU A;  5G46 A;  2GTK A;  2G0G A;  4OAR A;  2QTU A;  5IZ0 A;  4YPQ A;  5DXB B;  5DLR A;  2ZK6 A;  3DZU A;  3AUR A;  2IHQ A;  3SZ1 A;  3ET2 A;  3OOK A;  3RUU A;  2AMB A;  2ZK2 A;  2AYR A;  1IE8 A;  1ERR A;  1M13 A;  2R40 D;  4NY9 A;  4OZT U;  4PVU A;  2Q59 B;  3BEJ A;  4K7A A;  1SQN A;  2Z4J A;  4QJR A;  3L1B A;  3D90 A;  4J5W A;  2XHS A;  4MG7 B;  1MVC A;  3OMO A;  4G1Y A;  2GPU A;  5G43 A;  3CTB A;  4A2J A;  4N73 A;  2GPP A;  3FXV A;  1YIN A;  1S0X A;  3OLS A;  4PWL A;  5GIC A;  3ADX A;  5DMF A;  3OMK A;  2AO6 A;  3FUG A;  4XI3 A;  1UHL A;  5DXK A;  3W5P A;  4R6S A;  5DUE A;  5APJ A;  4OFU A;  1XV9 B;  4POH A;  1FCY A;  2QGW A;  3CS8 A;  3FEJ A;  4WVD A;  5DY8 A;  3WFG A;  3P88 A;  5KCC A;  2V0V A;  2QZO A;  4MGD A;  3D5F A;  5JJM A;  1M2Z A;  1XPC A;  3GYU A;  1PDU A;  3R8D A;  3BQD A;  5G5W A;  3T03 A;  2J7Y A;  1XLS A;  1K7L A;  3GYT A;  1ERE A;  4ZNS A;  4OEY A;  2OZ7 A;  5DXE A;  2AWH A;  4OKX A;  2ZK1 A;  2PIX A;  5DZ3 A;  3AFR A;  4NB6 A;  5DZH A;  4DK7 A;  2Q59 A;  1E3G A;  1NHZ A;  2YAT A;  1A28 A;  5AYG A;  4J5X C;  5G3J A;  1R1K D;  4XHD A;  3KMR A;  1X76 A;  2POB A;  3A9E B;  2AA7 A;  4IA2 A;  1NQ2 A;  5ACC A;  5KCE A;  1OVL A;  4ZNU A;  5KCU A;  3A78 A;  2PIV A;  2VV2 A;  2OCF A;  3KPZ A;  3R2A A;  4ZNV A;  4ZJW A;  5KRM A;  1RK3 A;  3ADT A;  2ZK4 A;  4FN9 A;  4IW8 A;  4LNX A;  3TY0 A;  2F4B A;  3HOD A;  5E1C A;  5C4S A;  4JAZ A;  2P7G A;  4L96 A;  3R8I A;  1FM9 D;  4RE8 A;  2AM9 A;  3B0T A;  5DXM A;  5EC9 A;  3OZ0 A;  3WT5 A;  3WFF A;  1L2J A;  1YJE A;  3H52 A;  2Q5S A;  5AAV B;  4E4K A;  5AWJ A;  3DT3 A;  4XUH A;  4OJ9 A;  3OS8 C;  3FAL A;  2QNV A;  2JFA B;  2GP7 A;  3K22 A;  2Q6S A;  1XVP B;  3V3Q A;  3AZ2 A;  1RDT A;  3TKM A;  4J26 A;  4J5W C;  2YLO A;  4R2U A;  2ZK3 A;  3DZU D;  3VHU A;  3KWY A;  4OHA A;  4IW6 A;  3HC6 A;  3ET3 A;  1S0Z A;  3CS6 A;  4PF3 A;  4X1F A;  1OSH A;  2Q7I A;  4ITE A;  3W5R A;  2Z4B A;  5AAU A;  2AXA A;  2P1T A;  4YT1 A;  1ILH A;  2FSZ A;  2HWQ A;  3F5C B;  4HEE X;  4M8H A;  5C4T A;  4OGH A;  2ZMI A;  3UUD B;  3IA6 A;  3VSO A;  1X7R A;  5L11 A;  2ZMH A;  4OC7 A;  4PP3 A;  1ZKY A;  3KDU A;  4IA7 A;  4O8F A;  2HAM A;  3OSW A;  2ZK0 A;  3UU7 A;  4CI5 A;  2P1V A;  2GWX A;  2R6W A;  1I37 A;  3Q95 B;  2AX8 A;  3KMG A;  4MG5 A;  1PQ6 A;  3B3K A;  2HFP A;  2NPA A;  1R20 A;  1DKF A;  1ZDT A;  2GPV A;  2I4P A;  2PNU A;  4WQP A;  3SP9 A;  1K74 D;  4REF A;  4QE6 A;  3VTB A;  1UPW A;  2QMV A;  1G2N A;  4RZE A;  1ZEO A;  3OZJ A;  4DOR A;  2YJD A;  4PLE A;  3OLF A;  1R1K A;  3X36 A;  3LBD A;  3KFC A;  5DWE A;  3GN8 A;  3V3E A;  4DOS A;  3B66 A;  3AX8 A;  4RUJ A;  4X1G A;  5DZ1 A;  5DZ0 A;  3VT3 A;  3B1M A;  3HM1 A;  1YY4 A;  2AA5 A;  2Q60 A;  4RUO X;  4RZG A;  3VT8 A;  5B41 A;  3G0W A;  4G21 A;  5KR9 A;  4TV1 A;  5HYR A;  4RMD A;  5E19 A;  4PP6 A;  4S15 A;  2G44 A;  1FM9 A;  5JI0 D;  2Q7K A;  3QT0 A;  3L0E A;  3X31 A;  2FVJ A;  2AA6 A;  4K6I A;  5EGV A;  1MV9 A;  4LBD A;  1P8D A;  3G9E A;  4UDA A;  4PPS A;  1X7J A;  2XYX A;  3N00 A;  1YUC A;  4OKW A;  1OSV A;  1UHL B;  5H1E A;  3MNO A;  3GWS X;  2Q3Y A;  4IVW A;  4YNK A;  5DVC A;  3OKI A;  4XAO A;  5DP0 A;  5E14 A;  4DM6 A;  2QZO B;  3P0U A;  1T7M A;  2PIP L;  4MGD B;  4DK8 A;  1NAX A;  2G5O A;  1L2I A;  2I0G A;  3B65 A;  4FHI A;  4XUM A;  4F9M A;  5JJM B;  1NQ7 A;  5AK2 A;  3W0A A;  2HC4 A;  3DCT A;  2H77 A;  1XZX X;  1RKG A;  2ZFX A;  2QXS A;  1RDT D;  3RUT A;  1FCZ A;  1S9Q A;  5GIE A;  3ZR7 A;  2HB7 A;  2XYJ A;  3ZRA A;  4ZN7 A;  4FGY A;  5E0X A;  3VRW A;  4FNE A;  3KBA A;  5GT4 A;  1YA3 A;  2QA6 A;  3IPS A;  3VJT A;  1T7R A;  3TX7 B;  1HG4 A;  1OVL B;  5DYD A;  1EXA A;  3A2I A;  1XIU A;  5A86 A;  2QE4 A;  1XNN A;  3SP6 A;  3HVL A;  3V4A A;  1TFC A;  5E15 A;  1YYE A;  3W0H A;  3GWX A;  4IS8 A;  2P4Y A;  5DWG A;  1M7W A;  1K74 A;  3VTC A;  3V9T A;  1KV6 A;  4IUI A;  2PIO A;  4CSJ A;  1U3Q A;  3AZ3 A;  2POG A;  5HZC A;  3GBK A;  4UDB A;  5DKE A;  2QA8 A;  4QE8 A;  2Q5G A;  1R20 D;  2QR9 A;  2VV4 A;  3CWD A;  3PEQ A;  4PLD A;  3VRV A;  3FAL B;  3G8O A;  4BCR A;  1X7B A;  1YMT A;  1ZGY A;  2ZNQ A;  3VT5 A;  1ZAF A;  5DWJ A;  1BSX A;  1Z95 A;  4OH6 A;  4ZO1 X;  5DVS A;  1UPV A;  3PRG A;  1I38 A;  4PXM A;  4A4V A;  3R5N A;  4G20 A;  2OVM A;  4K4J A;  2HAR A;  3RLJ A;  2R6Y A;  5DIG A;  2GPO A;  5DXG A;  3VT9 A;  2PRG A;  4N1Y A;  1XP9 A;  5KCW A;  5F9B A;  1E3K A;  1LV2 A;  1PCG A;  2QPY A;  5DV6 A;  5FQP A;  4ZNH A;  3DR1 A;  4P6X A;  1XP1 A;  4TUZ A;  3X1H A;  1QKM A;  5K13 A;  5EI1 A;  3HC5 A;  4QM0 A;  4HLW A;  5C4O A;  2AX6 A;  3MNP A;  2YLP A;  3UU7 B;  2JJ3 A;  4POJ A;  3AN3 A;  3WJ5 A;  2VV3 A;  2ZNO A;  5DRM A;  2Q1V A;  4MGC A;  5KRA A;  2Q7L A;  1DKF B;  2FAI A;  2Q1H A;  4FHH A;  5AWK A;  3RVF A;  4A4W A;  1XNX A;  1U3R A;  5LWP A;  3K8S A;  2ATH A;  4MGA A;  1FD0 A;  2PIU A;  4ZI1 A;  1PRG A;  4LTW A;  3PBA A;  3B68 A;  2AA2 A;  4IQR A;  3O1E A;  1P93 A;  2P15 A;  2PIW A;  3B0Q A;  3CS4 A;  3OMM A;  4KZJ A;  4KZI A;  1SJ0 A;  2G0H A;  5E0W A;  5ETH A;  5KCF A;  4J24 A;  5G42 A;  4WLB A;  3ADW A;  4NUF A;  3WTQ A;  3K6P A;  4TV1 B;  5DI7 A;  3VSP A;  5DID A;  2Q61 A;  3OAP A;  3ZQT A;  1T76 A;  4ZO1 B;  2P54 A;  2ZBS A;  1YOK A;  2ZNN A;  3IXP D;  2Q6R A;  1WM0 X;  1UOM A;  4IV2 A;  5B5B A;  2VV1 A;  2E2R A;  3KDT A;  3FC6 A;  1NDE A;  1LBD A;  3VJS A;  3HO0 A;  3H0A D;  3X1I A;  3S9S A;  3AUQ A;  3ILZ A;  1X7E A;  4OKB A;  4WHF A;  5DKS A;  1T5Z A;  1R6G A;  4MG8 A;  3WWR A;  5FQS A;  3WJ4 A;  3P89 A;  5KRO A;  1T63 A;  4G2H A;  3TKC A;  3A40 X;  4NIE A;  5FQR A;  4KZM A;  4OK1 A;  3V9Y A;  5DWL A;  4PP5 A;  5ICK A;  2Q6J A;  4P6W A;  1PK5 A;  5L7E A;  3W0G A;  3WGP A;  4OEZ A;  4ZNT A;  4OED A;  2ABI A;  3V49 A;  1QKT A;  4OFR A;  5AZV A;  2YJA B;  4MG9 A;  1T7F A;  2PIQ A;  3OLL A;  1I7G A;  4RME A;  2QGT A;  5FQT A;  1DB1 A;  1S9P A;  1ZUC A;  2HVC A;  3DCU A;  5KRJ A;  4ITF A;  3IPU A;  3A2H A;  1S19 A;  3E94 A;  3VHW A;  2EWP A;  2W8Y A;  2A3I A;  4E4Q A;  2QW4 A;  5L7G A;  1N4H A;  2BJ4 A;  1KNU A;  1NUO A;  2B1Z A;  1XDK A;  2OVH A;  4IWC A;  4CI4 A;  3OGT A;  5DKG A;  2O4J A;  3L0L A;  1FCX A;  1K4W A;  4R06 A;  3OKH A;  4WPF A;  2ZKC A;  5DU5 A;  4G1D A;  1Q4X A;  2I4J A;  1NYX A;  3ZRB A;  2H79 A;  3W0C A;  4Q0A C;  3PO9 A;  1U3S A;  2PIT A;  2QA8 B;  5DUH A;  5GID A;  4ZNW A;  2VV4 B;  3L3X A;  4RZF A;  4J5X A;  5APK A;  3OS9 A;  5DXQ A;  1ILG A;  5AZT A;  3FEI A;  1T73 A;  2AMA A;  2YLQ A;  3L3Z A;  3NSP A;  1PQ9 A;  4UDC A;  3VJH A;  5KYJ A;  1R5K A;  1RJK A;  1T7T A;  4RMC A;  4OLM A;  1XJ7 A;  2P1U A;  2ACL A;  3IPQ A;  3K23 A;  5DYB A;  5DL4 A;  5DX3 A;  2ZLC A;  1G5Y A;  3VRU A;  2NV7 A;  3VT6 A;  4RWV A;  5DXR A;  3R29 A;  3WT6 A;  2ZNP A;  3VJI A;  3B0W A;  2LBD A;  3ET0 A;  3IXP A;  4UDD A;  5DUG A;  1X78 A;  1FM6 A;  2QAB A;  3VT4 A;  3AN4 A;  2OUZ A;  1NRL A;  3VI8 A;  5DMC A;  5KRL A;  5AVL A;  4TUZ B;  4DQM A;  3AZ1 A;  2PIR A;  4N8R A;  3ET1 A;  3H0A A;  4Y29 A;  5DZI A;  3L03 A;  4M8E A;  2AB2 A;  3D24 A;  2AX7 A;  3FLI A;  3OS8 A;  4MGB A;  3ADV A;  4JYG A;  2I4Z A;  3RY9 A;  3UP3 A;  2IOK A;  4EMA A;  2YFE A;  3OOF A;  4N5G A;  2I0J A;  3UP0 A;  3OSA A;  2Q70 A;  3JZB A;  2PIN A;  5DTV A;  2XKW A;  5DVV A;  4NQA B;  1GWX A;  5G45 A;  4MGA B;  5L7H A;  5EJV A;  5IXK A;  3R8A A;  2ZK5 A;  4JGV A;  2Q5P A;  3A2J A;  3D57 A;  4Q50 A;  4QK4 A;  1U9E A;  1VJB A;  1QKU A;  3W5T A;  2B50 A;  2BAW A;  2HB8 A;  1HJ1 A;  3UVV A;  4G1Z A;  3ADS A;  3HZF A;  3GD2 A;  2ZL9 A;  1XOW A;  4XTA A;  5DXB A;  3VT7 A;  4RFW A;  2Q7J A;  4B7W A;  3W5Q A;  3VRT A;  2B23 A;  5KCD A;  4OZR U;  3W0J A;  3KYT A;  1T74 A;  1PQC A;  4ZJR A;  3JZC A;  4L98 A;  2IOG A;  3CQV A;  5DSH A;  5DKB A;  1G50 A;  1I7I A;  3CLD A;  4IA1 A;  1YOW A;  5C4U A;  3RLL A;  1NQ0 A;  4RAK A;  1Z5X U;  1IE9 A;  2VV1 B;  3FC6 B;  4MG7 A;  1A52 A;  3DZY A;  2NW4 A;  5DRJ A;  3G8I A;  4G2I A;  1G1U A;  4MG8 B;  2HWR A;  5DIE A;  5E7V A;  3E00 D;  5EIT A;  3NOA A;  3UUC A;  3DY6 A;  1QKN A;  5KRC A;  2Q8S A;  3D6D A;  3OMP A;  1N83 A;  1NQ1 A;  1GWR A;  1XV9 A;  2O4R A;  3F7D A;  4QL8 A;  2PKL A;  4OKT A;  4OJ4 A;  4JYI A;  2XYW A;  5KRF A;  5JY3 A;  4MG9 B;  3FUR A;  5KRK A;  3PCU A;  2ZY0 A;  1ZDU A;  2AAX A;  3V9V A;  1TXI A;  2JF9 A;  1XB7 A;  1MZN A;  1PZL A;  3U9Q A;  3W0Y A;  3VTD A;  1GS4 A;  1XAP A;  1EXX A;  2REW A;  3B0R A;  2QSE A;  1Y0S A;  2ZXN A;  2HBH A;  3WT7 A;  5I4V A;  5KRH A;  2YLY A;  1ZH7 A;  1SR7 A;  2NXX E;  2J7X A;  2VSR A;  3OMQ A;  4OIL A;  5M96 A;  2R40 A;  1T79 A;  2PJL A;  1FM6 D;  2J4A A;  3HLV A;  4S0S A;  2BJ4 B;  5AVI A;  4E2J A;  5HJP B;  1XDK B;  2ZLA A;  5HCV A;  1N46 A;  1OT7 A;  2B1V A;  3IMY A;  3VHV A;  3B67 A;  2VV0 A;  4JYH A;  5KD9 A;  3A9E A;  2ZXM A;  4ZOM A;  4OZT E;  4JL4 A;  3CJW A;  3CDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...