3BC5A

X-ray crystal structure of human ppar gamma with 2-(5-(3-(2-(5-methyl-2-phenyloxazol-4-yl)ethoxy)benzyl)-2-phenyl-2h-1,2,3-triazol-4-yl)acetic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
276
structure length
263
Chain Sequence
MQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTSPFVIYDMNSLMMGEDKIKFKHKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTEMSLHPLLQEIYKDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, synthesis and structure-activity relationships of azole acids as novel, potent dual PPAR alpha/gamma agonists.
pubmed doi rcsb
molecule keywords Peroxisome proliferator-activated receptor gamma
molecule tags Transcription
source organism Homo sapiens
total genus 99
structure length 263
sequence length 276
ec nomenclature
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3bc5A00
2Q70A 5C4TA 2GPOA 5KRCA 1YINA 4FHHA 3K8SA 3O1DA 4N8RA 5DIDA 3VTBA 3B0TA 4DK8A 5HYKA 2OZ7A 3WFGA 3ZRAA 4QE6A 2QSEA 1KKQA 4PP6A 1Y0XX 1G2NA 5APHA 3ADSA 2POGA 4RUJA 1U3QA 1T79A 5DYBA 3W0GA 2QGTA 2NXXA 2ZXMA 4J26A 2Q5GA 3F5CB 1KV6A 3ADVA 4OH5A 1X7RA 1XV9B 3GWXA 3OS8A 4PWLA 5DZ0A 3FS1A 3R8DA 3W5TA 3B68A 1P93A 3R8AA 2QNVA 3UVVB 3VT6A 2NW4A 5G45A 2PIQA 4OEYA 2QZOB 3JZCA 3G8OA 4OFRA 4XT9A 5AYGA 5K13A 1T63A 4MGBA 4NQAB 1XLSA 3HVLA 5KRIA 3Q95B 3E94A 5GICA 1K7LA 4KZIA 4DORA 5CJ6A 2YJDA 5C4UA 5DIEA 3OMPA 4ITFA 1NDEA 2ZK2A 1EREA 2XHSA 4DOSA 3VHVA 5JJMA 5KRJA 3DZUA 2NV7A 4G21A 4OGHA 4RAKA 5DY8A 4TV1B 2YFEA 3GD2A 4L96A 3LMPA 5DUHA 2IHQA 3QT0A 1NUOA 3ADTA 3OOKA 2ZNQA 2H79A 3A2IA 2A3IA 2Q8SA 4XI3A 5F9BA 2Q7JA 4IA1A 4DK7A 5KCCA 3BQDA 5EI1A 3PLZA 1YUCA 1E3GA 5E0XA 4APUA 3JZBA 5DU5A 3FC6B 3VTDA 1BSXA 3ERDA 4Q50A 1IE8A 4X1FA 1NQ1A 3VT9A 5DX3A 5KYJA 3SZ1A 3OKHA 2Q1VA 3X1HA 4XLDA 3VJIA 1X7JA 2AYRA 4P6WA 1FCYA 4OZRU 4RE8A 3WTQA 5HJPA 2YHDA 2O4RA 4ZNUA 3X31A 3SP6A 1T5ZA 5EITA 3OSWA 5AAVB 4J5WA 3HZFA 3SP9A 4ZI1A 1UPVA 3HODA 5DXBB 3OLFA 2OUZA 4Q0AC 5DK9A 3HQ5A 5B5BA 3PRGA 3ADWA 1R20A 1OSHA 4G1YA 2ZXZA 4RWVA 4PRGA 4PLDA 4RMEA 2XYJA 3DCUA 4OIVA 5AWJA 4TUZB 4OLMA 4YMQA 2HAMA 1P8DA 3B1MA 4LNXA 2QA8B 4ONIA 1RKGA 2Q5SA 3P89A 2G0HA 1IE9A 1L2IA 4IVWA 4JYIA 4DMAA 1MZNA 2Q60A 4IA2A 4RMDA 3S9SA 5DXQA 1I7GA 5FQSA 1UHLA 3KPZA 1I37A 3A9EA 1ZGYA 2ZK4A 2AX9A 2I0GA 4LNWA 5DI7A 4A4WA 4LSJA 1E3KA 3IMYA 4MGAA 3FEJA 5DV8A 3AZ1A 2BAWA 3OAPA 3HM1A 3PBAA 1Y0SA 2LBDA 1X7EA 1GWXA 3V4AA 4JAZA 2AMAA 5AVIA 3B5RA 4RFWA 1XNNA 3WGPA 4OJBA 1A28A 3K23A 3OLLA 1XVPB 2AA7A 3L0LA 4JL4A 1N4HA 5AVLA 1WM0X 2GPPA 2G5OA 3PEQA 4P6XA 3FXVA 4IV2A 4G2HA 4WHFA 4MGBB 3W5QA 1PZLA 5AWKA 4M8EA 3UUDB 3AFRA 5KRHA 5KCWA 3HO0A 4MG5A 4WVDA 1LBDA 3VRUA 3KDUA 4EM9A 3K6PA 3D5FA 4BCRA 4YT1A 1RDTD 3FUGA 2I4PA 2ATHA 1YYEA 2Q5PA 4OC7A 4RUPA 4S0SA 2HWRA 2QGWA 2Q7IA 3IXPA 3RLLA 2OVHA 4NUFA 1T7FA 3L0EA 2G44A 4OILA 1UOMA 3IA6A 1YJEA 1YP0A 2IOGA 3CTBA 4OHAA 5DVCA 4EMAA 5HZCA 1KNUA 3B65A 1NQ7A 3VT7A 3CDPA 3E00D 1G50A 1GS4A 2QE4A 3FALB 4J5XC 3OZ0A 4OZTU 4ZOMA 5DXMA 4JGVA 2HWQA 2R6YA 3NSQA 1NQ0A 5L7HA 5JY3A 3CJWA 4IWCA 5HJSA 5KRMA 3NSPA 1FBYA 5DX3B 4YPQA 1XB7A 2PNUA 3HLVA 5DSHA 2OVMA 2PIWA 4NIEA 1OVLB 4PF3A 5DWEA 5KRAA 5DRMA 3CQVA 2HCDA 5G42A 1R1KD 5HJPB 2ZMIA 2XYXA 3OOFA 2O9IA 1TFCA 4NY9A 5EJVA 1NYXA 2ZK3A 5APJA 4RZFA 3KBAA 1S0XA 5H1EA 5KR9A 2AWHA 2ZFXA 3OLSA 5ETHA 5EGVA 3UUAB 2QXSA 2Z4JA 4F9MA 5KRLA 4OKXA 1MV9A 2GIUA 5G3JA 5DWJA 3VTCA 1DKFA 1ILGA 1RDTA 3W0HA 3P88A 3DCTA 3DZYA 5DTVA 4ZJRA 4QM0A 4MG6A 1SR7A 3M7RA 3ADUA 1LV2A 3R8IA 3G8IA 3RY9A 3E00A 3A40X 3TKMA 4IUIA 5G46A 2ZNNA 4ITEA 4B7WA 4ZNTA 3UU7B 3WT6A 3B66A 4MG9A 4OJ4A 4MGDB 2PJLA 4IW8A 1XJ7A 4IWFA 2PIVA 2PIPL 5AK2A 2ACLB 3ET3A 4OFUA 2Q3YA 2XKWA 5DWLA 3V9YA 3KDTA 2YLQA 3ET0A 5LWPA 2OAXA 2ZLCA 1X78A 1FM6D 2AMBA 3EYBA 1U3RA 2YLYA 3AUQA 1N46A 3LBDA 4G2IA 3W0IA 2P4YA 3L3ZA 5FQTA 3A78A 3WJ5A 5I4VA 1M13A 3AURA 1ILHA 1HG4A 2GP7A 1YMTA 4IU7A 5GIDA 2AB2A 4S15A 3L1BA 4UDCA 1XP6A 2E2RA 2H77A 3K22A 4UDAA 2VV1B 2OCFA 1G1UA 1PDUA 3KMZA 5KCTA 1XDKB 2R40D 5FQRA 1EXXA 3L03A 4Q13A 4LTWA 4J24A 4XUHA 3VJTA 3X36A 3D24A 3ET1A 3IPSA 3KFCA 5EC9A 3TKCA 4PLEA 2HB7A 3V3QA 3B67A 3OSIA 4S0TA 4R6SA 1SQNA 3KYTA 2HFPA 1S19A 5DMCA 1XQCA 5G5WA 3TY0A 2NXXE 5AZVA 4K6IA 1Z5XE 1K74D 3MNPA 4E4KA 1S0ZA 2B50A 1U3SA 3AZ2A 2VV0A 3CDSA 3KMRA 4KZJA 4OEAA 5KRFA 3P0UA 1YOKA 4XHDA 1S9QA 1PK5A 2QH6A 5GIEA 2OM9A 3VT8A 2J14A 3DR1A 4ZNVA 2PKLA 1XLSE 5HCVA 3KMGA 3HC6A 4WHGA 2VV4B 2YLOA 1DB1A 1FM6A 5DP0A 4MG8B 2JJ3A 1RJKA 1U9EA 3OZJA 1NAXA 5DKBA 5DXEA 3D57A 2ZNPA 4PP5A 2ZXNA 3VN2A 2JF9A 1ZH7A 3VJSA 5DV6A 5KROA 3RVFA 5DXGA 3GZ9A 2XYWA 3VSPA 1M7WA 1PQ9A 3BC5A 1NHZA 2Q1HA 1GWQA 2YJAB 3X1IA 3GBKA 3A2HA 1PQ6A 2YATA 1ZEOA 4RUOX 4ZO1X 4RZEA 2HARA 2I0JA 1XP1A 2Q61A 4FN9A 1R5KA 4K4JA 1T7MA 3VHWA 5KCFA 5DWGA 1XV9A 1K74A 4REEA 4MDDA 1I38A 1X7BA 4HEEX 3VHUA 2PIOA 3GYUA 2PIXA 5JI0D 3UVVA 1ZUCA 4IVYA 1S9PA 4K7AA 2QZOA 3H0AD 3DY6A 2ZK6A 4UDDA 2JFAA 5DZHA 1RKHA 2EWPA 4PXMA 3OSAA 2P1UA 4ZN7A 5IXKA 2W8YA 4XAOA 3BEJA 3CS4A 1QKMA 2P7GA 3AN4A 4S14A 3O1EA 4ZNHA 1ZKYA 1T74A 4OEDA 5JJMB 1UPWA 3A3ZX 3VSOA 1XNXA 4ZJWA 4CI4A 5KRKA 4TV1A 5SYZA 5DKEA 4G1ZA 4FHIA 4OJ9A 4OKBA 4DM6A 5DZIA 2AA5A 5DUEA 4MG7A 5DXRA 1PRGA 4N5GA 5E15A 2ZK0A 5DZ3A 3UP3A 1MVCA 4PPPA 1L2JA 1SKXA 4ZNSA 4M8HA 4R2UA 2B1ZA 2ZBSA 2QA6A 3OKIA 3PCUA 1NAVA 1H9UA 5E7VA 2I4JA 1YIMA 3ILZA 2ZNOA 5E14A 2NPAA 1XIUA 3WT5A 1YOWA 2ZMJA 3AN3A 4IA3A 2FVJA 3W5PA 2ABIA 3OS8C 5DWIA 5G43A 5DMFA 5G44A 1XPCA 1NRLA 4OZRE 4E4QA 3OMQA 3VT5A 2BJ4A 3D90A 4TUZA 4CSJA 4XTAA 5DIGA 5KD9A 3DZUD 2QA8A 3WWRA 4J5XA 2QPYA 3OMKA 4IV4A 2FSZA 1XAPA 3G9EA 2POBA 5DL4A 2V0VA 1UHLB 3ZRBA 3A9EB 5E1CA 2GPUA 3R5NA 3GWSX 1VJBA 2O4JA 4MGAB 2ZK1A 1XOWA 3FEIA 3PO9A 5DUGA 3ET2A 4QJRA 5DVVA 3OMOA 3V9TA 2AX6A 3VRTA 2PIUA 3WFFA 4ZNWA 2IOKA 2Q59A 4POJA 2HC4A 1PCGA 3W0YA 3B0QA 2QMVA 3MNOA 5KYAA 4NB6A 4UDBA 2REWA 1I7IA 4N73A 5DXPA 1ZAFA 5DV3A 4IA7A 1R1KA 3G0WA 4OIUA 1XVPA 1YY4A 4PP3A 2J7XA 5ICKA 2Q6SA 5DLRA 4A4VA 3CLDA 2AAXA 4OKTA 2JFAB 3UUCA 2VV2A 4L98A 3UUDA 1R20D 3ZQTA 4DQMA 2GPVA 3A2JA 2G0GA 3B3KA 5EHJA 1GWRA 3W0AA 4IQRA 1T7TA 4J5WC 4RMCA 1Y9RA 1ZDTA 4OARA 1X76A 4ZN9A 3OMMA 5L7GA 3V49A 4OKWA 2P1VA 4LBDA 3B0RA 4FGYA 3DT3A 2AX8A 2ZY0A 5IAWA 5KCEA 1A52A 1ERRA 3D6DA 2P1TA 3CS8A 1TXIA 4G1DA 4MG7B 4Y29A 3FALA 2PIRA 3WJ4A 5FQVA 2Q7LA 2ZK5A 4QL8A 3R2AA 5ACCA 3TX7B 1XP9A 1OVLA 3N00A 3U9QA 1FM9D 4CI5A 4YNKA 5M96A 3FURA 2HASA 4OZTE 2AX7A 2AA2A 1N83A 2HBHA 3ERTA 2AM9A 4O8FA 1FCXA 3ZR7A 1T65A 5KCUA 3R29A 3IPQA 3V3EA 3CWDA 3WT7A 2R40A 3W0CA 1NQ2A 3AX8A 1Z95A 3UUAA 1DKFB 1XQ3A 3L0JA 4A2JA 5APKA 3W0JA 2BJ4B 1EXAA 3VI8A 1Q4XA 1G5YA 2R6WA 3GYTA 3L3XA 4IS8A 5HYRA 3F5CA 3IXPD 5KCDA 1QKTA 2GWXA 4OH6A 2Q7KA 4QE8A 5L7EA 2P7AA 3ADXA 4XUMA 3AUNA 5LGAA 3B0WA 1PQCA 3VJHA 4FNEA 2QABA 2VSRA 3GN8A 2AO6A 3MNEA 4MG9B 4WLBA 3NOAA 5A86A 1K4WA 3UU7A 2J7YA 2QR9A 1XZXX 3Q95A 3IPUA 4MGDA 5AAUA 2VSTA 2GL8A 2ACLA 4JYHA 5B41A 2VV3A 4ZO1B 2Q59B 2ZLAA 5DKSA 1OT7A 2B23A 2PRGA 5DKGA 3WMHA 1HJ1A 3F7DA 5L11A 2ZL9A 4PVUA 2HB8A 2QXMA 1FM9A 5DXKA 1FCZA 4OK1A 3RUUA 1M2ZA 2QW4A 3KWYA 2P54A 4IW6A 4QK4A 3E7CA 2AXAA 2Q6JA 2ZKCA 3H52A 3T03A 5IZ0A 1Z5XU 2VV1A 5GT4A 3VRWA 1XDKA 4DM8A 3FC6A 2F4BA 1QKNA 5FQPA 5C4SA 4E2JA 3OS9A 4REFA 3UP0A 4POHA 2FAIA 1OSVA 4WQPA 3OGTA 1FD0A 5DZ1A 2ZASA 3DZYD 3FLIA 4R06A 2ZVTA 3R5MA 4X1GA 3V9VA 2B1VA 2PINA 1R6GA 3HC5A 2V7CA 2ZMHA 4JYGA 5DYDA 2I4ZA 2P7ZA 4OEZA 5DRJA 2Q6RA 4G20A 1T7RA 2HVCA 3H0AA 5AAVA 1RK3A 3AZ3A 1T76A 5DXBA 2P15A 2Z4BA 3VT3A 3CS6A 1SJ0A 4PPSA 2J4AA 1YA3A 5DVSA 4KZMA 2YLPA 2VV4A 4HLWA 5E0WA 5AZTA 3RLJA 3VT4A 1T73A 2GTKA 3P8XA 4MG8A 3RUTA 1QKUA 4MGCA 4WPFA 4RZGA 2AA6A 4N1YA 3VRVA 2QTUA 1ZDUA 5C4OA 3W5RA 5E19A 2PITA
chains in the Genus database with same CATH superfamily
2Q70A 5C4TA 2GPOA 5KRCA 1YINA 4FHHA 3K8SA 3O1DA 4N8RA 5DIDA 3VTBA 3B0TA 4DK8A 5HYKA 2OZ7A 3WFGA 3ZRAA 4QE6A 2QSEA 1KKQA 4PP6A 1Y0XX 1G2NA 5APHA 3ADSA 2POGA 4RUJA 1U3QA 1T79A 5DYBA 3W0GA 2QGTA 2NXXA 2ZXMA 4J26A 2Q5GA 3F5CB 1KV6A 3ADVA 4OH5A 1X7RA 1XV9B 3GWXA 3OS8A 4PWLA 5DZ0A 3FS1A 3R8DA 3W5TA 3B68A 1P93A 3R8AA 2QNVA 3UVVB 3VT6A 2NW4A 5G45A 2PIQA 4OEYA 2QZOB 3JZCA 3G8OA 4OFRA 4XT9A 5AYGA 5K13A 1T63A 4MGBA 4NQAB 1XLSA 3HVLA 5KRIA 3Q95B 3E94A 5GICA 1K7LA 4KZIA 4DORA 5CJ6A 2YJDA 5C4UA 5DIEA 3OMPA 4ITFA 1NDEA 2ZK2A 1EREA 2XHSA 4DOSA 3VHVA 5JJMA 5KRJA 3DZUA 2NV7A 4G21A 4OGHA 4RAKA 5DY8A 4TV1B 2YFEA 3GD2A 4L96A 3LMPA 5DUHA 2IHQA 3QT0A 1NUOA 3ADTA 3OOKA 2ZNQA 2H79A 3A2IA 2A3IA 2Q8SA 4XI3A 5F9BA 2Q7JA 4IA1A 4DK7A 5KCCA 3BQDA 5EI1A 3PLZA 1YUCA 1E3GA 5E0XA 4APUA 3JZBA 5DU5A 3FC6B 3VTDA 1BSXA 3ERDA 4Q50A 1IE8A 4X1FA 1NQ1A 3VT9A 5DX3A 5KYJA 3SZ1A 3OKHA 2Q1VA 3X1HA 4XLDA 3VJIA 1X7JA 2AYRA 4P6WA 1FCYA 4OZRU 4RE8A 3WTQA 5HJPA 2YHDA 2O4RA 4ZNUA 3X31A 3SP6A 1T5ZA 5EITA 3OSWA 5AAVB 4J5WA 3HZFA 3SP9A 4ZI1A 1UPVA 3HODA 5DXBB 3OLFA 2OUZA 4Q0AC 5DK9A 3HQ5A 5B5BA 3PRGA 3ADWA 1R20A 1OSHA 4G1YA 2ZXZA 4RWVA 4PRGA 4PLDA 4RMEA 2XYJA 3DCUA 4OIVA 5AWJA 4TUZB 4OLMA 4YMQA 2HAMA 1P8DA 3B1MA 4LNXA 2QA8B 4ONIA 1RKGA 2Q5SA 3P89A 2G0HA 1IE9A 1L2IA 4IVWA 4JYIA 4DMAA 1MZNA 2Q60A 4IA2A 4RMDA 3S9SA 5DXQA 1I7GA 5FQSA 1UHLA 3KPZA 1I37A 3A9EA 1ZGYA 2ZK4A 2AX9A 2I0GA 4LNWA 5DI7A 4A4WA 4LSJA 1E3KA 3IMYA 4MGAA 3FEJA 5DV8A 3AZ1A 2BAWA 3OAPA 3HM1A 3PBAA 1Y0SA 2LBDA 1X7EA 1GWXA 3V4AA 4JAZA 2AMAA 5AVIA 3B5RA 4RFWA 1XNNA 3WGPA 4OJBA 1A28A 3K23A 3OLLA 1XVPB 2AA7A 3L0LA 4JL4A 1N4HA 5AVLA 1WM0X 2GPPA 2G5OA 3PEQA 4P6XA 3FXVA 4IV2A 4G2HA 4WHFA 4MGBB 3W5QA 1PZLA 5AWKA 4M8EA 3UUDB 3AFRA 5KRHA 5KCWA 3HO0A 4MG5A 4WVDA 1LBDA 3VRUA 3KDUA 4EM9A 3K6PA 3D5FA 4BCRA 4YT1A 1RDTD 3FUGA 2I4PA 2ATHA 1YYEA 2Q5PA 4OC7A 4RUPA 4S0SA 2HWRA 2QGWA 2Q7IA 3IXPA 3RLLA 2OVHA 4NUFA 1T7FA 3L0EA 2G44A 4OILA 1UOMA 3IA6A 1YJEA 1YP0A 2IOGA 3CTBA 4OHAA 5DVCA 4EMAA 5HZCA 1KNUA 3B65A 1NQ7A 3VT7A 3CDPA 3E00D 1G50A 1GS4A 2QE4A 3FALB 4J5XC 3OZ0A 4OZTU 4ZOMA 5DXMA 4JGVA 2HWQA 2R6YA 3NSQA 1NQ0A 5L7HA 5JY3A 3CJWA 4IWCA 5HJSA 5KRMA 3NSPA 1FBYA 5DX3B 4YPQA 1XB7A 2PNUA 3HLVA 5DSHA 2OVMA 2PIWA 4NIEA 1OVLB 4PF3A 5DWEA 5KRAA 5DRMA 3CQVA 2HCDA 5G42A 1R1KD 5HJPB 2ZMIA 2XYXA 3OOFA 2O9IA 1TFCA 4NY9A 5EJVA 1NYXA 2ZK3A 5APJA 4RZFA 3KBAA 1S0XA 5H1EA 5KR9A 2AWHA 2ZFXA 3OLSA 5ETHA 5EGVA 3UUAB 2QXSA 2Z4JA 4F9MA 5KRLA 4OKXA 1MV9A 2GIUA 5G3JA 5DWJA 3VTCA 1DKFA 1ILGA 1RDTA 3W0HA 3P88A 3DCTA 3DZYA 5DTVA 4ZJRA 4QM0A 4MG6A 1SR7A 3M7RA 3ADUA 1LV2A 3R8IA 3G8IA 3RY9A 3E00A 3A40X 3TKMA 4IUIA 5G46A 2ZNNA 4ITEA 4B7WA 4ZNTA 3UU7B 3WT6A 3B66A 4MG9A 4OJ4A 4MGDB 2PJLA 4IW8A 1XJ7A 4IWFA 2PIVA 2PIPL 5AK2A 2ACLB 3ET3A 4OFUA 2Q3YA 2XKWA 5DWLA 3V9YA 3KDTA 2YLQA 3ET0A 5LWPA 2OAXA 2ZLCA 1X78A 1FM6D 2AMBA 3EYBA 1U3RA 2YLYA 3AUQA 1N46A 3LBDA 4G2IA 3W0IA 2P4YA 3L3ZA 5FQTA 3A78A 3WJ5A 5I4VA 1M13A 3AURA 1ILHA 1HG4A 2GP7A 1YMTA 4IU7A 5GIDA 2AB2A 4S15A 3L1BA 4UDCA 1XP6A 2E2RA 2H77A 3K22A 4UDAA 2VV1B 2OCFA 1G1UA 1PDUA 3KMZA 5KCTA 1XDKB 2R40D 5FQRA 1EXXA 3L03A 4Q13A 4LTWA 4J24A 4XUHA 3VJTA 3X36A 3D24A 3ET1A 3IPSA 3KFCA 5EC9A 3TKCA 4PLEA 2HB7A 3V3QA 3B67A 3OSIA 4S0TA 4R6SA 1SQNA 3KYTA 2HFPA 1S19A 5DMCA 1XQCA 5G5WA 3TY0A 2NXXE 5AZVA 4K6IA 1Z5XE 1K74D 3MNPA 4E4KA 1S0ZA 2B50A 1U3SA 3AZ2A 2VV0A 3CDSA 3KMRA 4KZJA 4OEAA 5KRFA 3P0UA 1YOKA 4XHDA 1S9QA 1PK5A 2QH6A 5GIEA 2OM9A 3VT8A 2J14A 3DR1A 4ZNVA 2PKLA 1XLSE 5HCVA 3KMGA 3HC6A 4WHGA 2VV4B 2YLOA 1DB1A 1FM6A 5DP0A 4MG8B 2JJ3A 1RJKA 1U9EA 3OZJA 1NAXA 5DKBA 5DXEA 3D57A 2ZNPA 4PP5A 2ZXNA 3VN2A 2JF9A 1ZH7A 3VJSA 5DV6A 5KROA 3RVFA 5DXGA 3GZ9A 2XYWA 3VSPA 1M7WA 1PQ9A 3BC5A 1NHZA 2Q1HA 1GWQA 2YJAB 3X1IA 3GBKA 3A2HA 1PQ6A 2YATA 1ZEOA 4RUOX 4ZO1X 4RZEA 2HARA 2I0JA 1XP1A 2Q61A 4FN9A 1R5KA 4K4JA 1T7MA 3VHWA 5KCFA 5DWGA 1XV9A 1K74A 4REEA 4MDDA 1I38A 1X7BA 4HEEX 3VHUA 2PIOA 3GYUA 2PIXA 5JI0D 3UVVA 1ZUCA 4IVYA 1S9PA 4K7AA 2QZOA 3H0AD 3DY6A 2ZK6A 4UDDA 2JFAA 5DZHA 1RKHA 2EWPA 4PXMA 3OSAA 2P1UA 4ZN7A 5IXKA 2W8YA 4XAOA 3BEJA 3CS4A 1QKMA 2P7GA 3AN4A 4S14A 3O1EA 4ZNHA 1ZKYA 1T74A 4OEDA 5JJMB 1UPWA 3A3ZX 3VSOA 1XNXA 4ZJWA 4CI4A 5KRKA 4TV1A 5SYZA 5DKEA 4G1ZA 4FHIA 4OJ9A 4OKBA 4DM6A 5DZIA 2AA5A 5DUEA 4MG7A 5DXRA 1PRGA 4N5GA 5E15A 2ZK0A 5DZ3A 3UP3A 1MVCA 4PPPA 1L2JA 1SKXA 4ZNSA 4M8HA 4R2UA 2B1ZA 2ZBSA 2QA6A 3OKIA 3PCUA 1NAVA 1H9UA 5E7VA 2I4JA 1YIMA 3ILZA 2ZNOA 5E14A 2NPAA 1XIUA 3WT5A 1YOWA 2ZMJA 3AN3A 4IA3A 2FVJA 3W5PA 2ABIA 3OS8C 5DWIA 5G43A 5DMFA 5G44A 1XPCA 1NRLA 4OZRE 4E4QA 3OMQA 3VT5A 2BJ4A 3D90A 4TUZA 4CSJA 4XTAA 5DIGA 5KD9A 3DZUD 2QA8A 3WWRA 4J5XA 2QPYA 3OMKA 4IV4A 2FSZA 1XAPA 3G9EA 2POBA 5DL4A 2V0VA 1UHLB 3ZRBA 3A9EB 5E1CA 2GPUA 3R5NA 3GWSX 1VJBA 2O4JA 4MGAB 2ZK1A 1XOWA 3FEIA 3PO9A 5DUGA 3ET2A 4QJRA 5DVVA 3OMOA 3V9TA 2AX6A 3VRTA 2PIUA 3WFFA 4ZNWA 2IOKA 2Q59A 4POJA 2HC4A 1PCGA 3W0YA 3B0QA 2QMVA 3MNOA 5KYAA 4NB6A 4UDBA 2REWA 1I7IA 4N73A 5DXPA 1ZAFA 5DV3A 4IA7A 1R1KA 3G0WA 4OIUA 1XVPA 1YY4A 4PP3A 2J7XA 5ICKA 2Q6SA 5DLRA 4A4VA 3CLDA 2AAXA 4OKTA 2JFAB 3UUCA 2VV2A 4L98A 3UUDA 1R20D 3ZQTA 4DQMA 2GPVA 3A2JA 2G0GA 3B3KA 5EHJA 1GWRA 3W0AA 4IQRA 1T7TA 4J5WC 4RMCA 1Y9RA 1ZDTA 4OARA 1X76A 4ZN9A 3OMMA 5L7GA 3V49A 4OKWA 2P1VA 4LBDA 3B0RA 4FGYA 3DT3A 2AX8A 2ZY0A 5IAWA 5KCEA 1A52A 1ERRA 3D6DA 2P1TA 3CS8A 1TXIA 4G1DA 4MG7B 4Y29A 3FALA 2PIRA 3WJ4A 5FQVA 2Q7LA 2ZK5A 4QL8A 3R2AA 5ACCA 3TX7B 1XP9A 1OVLA 3N00A 3U9QA 1FM9D 4CI5A 4YNKA 5M96A 3FURA 2HASA 4OZTE 2AX7A 2AA2A 1N83A 2HBHA 3ERTA 2AM9A 4O8FA 1FCXA 3ZR7A 1T65A 5KCUA 3R29A 3IPQA 3V3EA 3CWDA 3WT7A 2R40A 3W0CA 1NQ2A 3AX8A 1Z95A 3UUAA 1DKFB 1XQ3A 3L0JA 4A2JA 5APKA 3W0JA 2BJ4B 1EXAA 3VI8A 1Q4XA 1G5YA 2R6WA 3GYTA 3L3XA 4IS8A 5HYRA 3F5CA 3IXPD 5KCDA 1QKTA 2GWXA 4OH6A 2Q7KA 4QE8A 5L7EA 2P7AA 3ADXA 4XUMA 3AUNA 5LGAA 3B0WA 1PQCA 3VJHA 4FNEA 2QABA 2VSRA 3GN8A 2AO6A 3MNEA 4MG9B 4WLBA 3NOAA 5A86A 1K4WA 3UU7A 2J7YA 2QR9A 1XZXX 3Q95A 3IPUA 4MGDA 5AAUA 2VSTA 2GL8A 2ACLA 4JYHA 5B41A 2VV3A 4ZO1B 2Q59B 2ZLAA 5DKSA 1OT7A 2B23A 2PRGA 5DKGA 3WMHA 1HJ1A 3F7DA 5L11A 2ZL9A 4PVUA 2HB8A 2QXMA 1FM9A 5DXKA 1FCZA 4OK1A 3RUUA 1M2ZA 2QW4A 3KWYA 2P54A 4IW6A 4QK4A 3E7CA 2AXAA 2Q6JA 2ZKCA 3H52A 3T03A 5IZ0A 1Z5XU 2VV1A 5GT4A 3VRWA 1XDKA 4DM8A 3FC6A 2F4BA 1QKNA 5FQPA 5C4SA 4E2JA 3OS9A 4REFA 3UP0A 4POHA 2FAIA 1OSVA 4WQPA 3OGTA 1FD0A 5DZ1A 2ZASA 3DZYD 3FLIA 4R06A 2ZVTA 3R5MA 4X1GA 3V9VA 2B1VA 2PINA 1R6GA 3HC5A 2V7CA 2ZMHA 4JYGA 5DYDA 2I4ZA 2P7ZA 4OEZA 5DRJA 2Q6RA 4G20A 1T7RA 2HVCA 3H0AA 5AAVA 1RK3A 3AZ3A 1T76A 5DXBA 2P15A 2Z4BA 3VT3A 3CS6A 1SJ0A 4PPSA 2J4AA 1YA3A 5DVSA 4KZMA 2YLPA 2VV4A 4HLWA 5E0WA 5AZTA 3RLJA 3VT4A 1T73A 2GTKA 3P8XA 4MG8A 3RUTA 1QKUA 4MGCA 4WPFA 4RZGA 2AA6A 4N1YA 3VRVA 2QTUA 1ZDUA 5C4OA 3W5RA 5E19A 2PITA
chains in the Genus database with same CATH topology
2Q70A 5C4TA 2GPOA 5KRCA 1YINA 4FHHA 3K8SA 3O1DA 4N8RA 5DIDA 3VTBA 3B0TA 4DK8A 5HYKA 2OZ7A 3WFGA 3ZRAA 4QE6A 2QSEA 1KKQA 4PP6A 1Y0XX 1G2NA 5APHA 3ADSA 2POGA 4RUJA 1U3QA 1T79A 5DYBA 3W0GA 2QGTA 2NXXA 2ZXMA 4J26A 2Q5GA 3F5CB 1KV6A 3ADVA 4OH5A 1X7RA 1XV9B 3GWXA 3OS8A 4PWLA 5DZ0A 3FS1A 3R8DA 3W5TA 3B68A 1P93A 3R8AA 2QNVA 3UVVB 3VT6A 2NW4A 5G45A 2PIQA 4OEYA 2QZOB 3JZCA 3G8OA 4OFRA 4XT9A 5AYGA 5K13A 1T63A 4MGBA 4NQAB 1XLSA 3HVLA 5KRIA 3Q95B 3E94A 5GICA 1K7LA 4KZIA 4DORA 5CJ6A 2YJDA 5C4UA 5DIEA 3OMPA 4ITFA 1NDEA 2ZK2A 1EREA 2XHSA 4DOSA 3VHVA 5JJMA 5KRJA 3DZUA 2NV7A 4G21A 4OGHA 4RAKA 5DY8A 4TV1B 2YFEA 3GD2A 4L96A 3LMPA 5DUHA 2IHQA 3QT0A 1NUOA 3ADTA 3OOKA 2ZNQA 2H79A 3A2IA 2A3IA 2Q8SA 4XI3A 5F9BA 2Q7JA 4IA1A 4DK7A 5KCCA 3BQDA 5EI1A 3PLZA 1YUCA 1E3GA 5E0XA 4APUA 3JZBA 5DU5A 3FC6B 3VTDA 1BSXA 3ERDA 4Q50A 1IE8A 4X1FA 1NQ1A 3VT9A 5DX3A 5KYJA 3SZ1A 3OKHA 2Q1VA 3X1HA 4XLDA 3VJIA 1X7JA 2AYRA 4P6WA 1FCYA 4OZRU 4RE8A 3WTQA 5HJPA 2YHDA 2O4RA 4ZNUA 3X31A 3SP6A 1T5ZA 5EITA 3OSWA 5AAVB 4J5WA 3HZFA 3SP9A 4ZI1A 1UPVA 3HODA 5DXBB 3OLFA 2OUZA 4Q0AC 5DK9A 3HQ5A 5B5BA 3PRGA 3ADWA 1R20A 1OSHA 4G1YA 2ZXZA 4RWVA 4PRGA 4PLDA 4RMEA 2XYJA 3DCUA 4OIVA 5AWJA 4TUZB 4OLMA 4YMQA 2HAMA 1P8DA 3B1MA 4LNXA 2QA8B 4ONIA 1RKGA 2Q5SA 3P89A 2G0HA 1IE9A 1L2IA 4IVWA 4JYIA 4DMAA 1MZNA 2Q60A 4IA2A 4RMDA 3S9SA 5DXQA 1I7GA 5FQSA 1UHLA 3KPZA 1I37A 3A9EA 1ZGYA 2ZK4A 2AX9A 2I0GA 4LNWA 5DI7A 4A4WA 4LSJA 1E3KA 3IMYA 4MGAA 3FEJA 5DV8A 3AZ1A 2BAWA 3OAPA 3HM1A 3PBAA 1Y0SA 2LBDA 1X7EA 1GWXA 3V4AA 4JAZA 2AMAA 5AVIA 3B5RA 4RFWA 1XNNA 3WGPA 4OJBA 1A28A 3K23A 3OLLA 1XVPB 2AA7A 3L0LA 4JL4A 1N4HA 5AVLA 1WM0X 2GPPA 2G5OA 3PEQA 4P6XA 3FXVA 4IV2A 4G2HA 4WHFA 4MGBB 3W5QA 1PZLA 5AWKA 4M8EA 3UUDB 3AFRA 5KRHA 5KCWA 3HO0A 4MG5A 4WVDA 1LBDA 3VRUA 3KDUA 4EM9A 3K6PA 3D5FA 4BCRA 4YT1A 1RDTD 3FUGA 2I4PA 2ATHA 1YYEA 2Q5PA 4OC7A 4RUPA 4S0SA 2HWRA 2QGWA 2Q7IA 3IXPA 3RLLA 2OVHA 4NUFA 1T7FA 3L0EA 2G44A 4OILA 1UOMA 3IA6A 1YJEA 1YP0A 2IOGA 3CTBA 4OHAA 5DVCA 4EMAA 5HZCA 1KNUA 3B65A 1NQ7A 3VT7A 3CDPA 3E00D 1G50A 1GS4A 2QE4A 3FALB 4J5XC 3OZ0A 4OZTU 4ZOMA 5DXMA 4JGVA 2HWQA 2R6YA 3NSQA 1NQ0A 5L7HA 5JY3A 3CJWA 4IWCA 5HJSA 5KRMA 3NSPA 1FBYA 5DX3B 4YPQA 1XB7A 2PNUA 3HLVA 5DSHA 2OVMA 2PIWA 4NIEA 1OVLB 4PF3A 5DWEA 5KRAA 5DRMA 3CQVA 2HCDA 5G42A 1R1KD 5HJPB 2ZMIA 2XYXA 3OOFA 2O9IA 1TFCA 4NY9A 5EJVA 1NYXA 2ZK3A 5APJA 4RZFA 3KBAA 1S0XA 5H1EA 5KR9A 2AWHA 2ZFXA 3OLSA 5ETHA 5EGVA 3UUAB 2QXSA 2Z4JA 4F9MA 5KRLA 4OKXA 1MV9A 2GIUA 5G3JA 5DWJA 3VTCA 1DKFA 1ILGA 1RDTA 3W0HA 3P88A 3DCTA 3DZYA 5DTVA 4ZJRA 4QM0A 4MG6A 1SR7A 3M7RA 3ADUA 1LV2A 3R8IA 3G8IA 3RY9A 3E00A 3A40X 3TKMA 4IUIA 5G46A 2ZNNA 4ITEA 4B7WA 4ZNTA 3UU7B 3WT6A 3B66A 4MG9A 4OJ4A 4MGDB 2PJLA 4IW8A 1XJ7A 4IWFA 2PIVA 2PIPL 5AK2A 2ACLB 3ET3A 4OFUA 2Q3YA 2XKWA 5DWLA 3V9YA 3KDTA 2YLQA 3ET0A 5LWPA 2OAXA 2ZLCA 1X78A 1FM6D 2AMBA 3EYBA 1U3RA 2YLYA 3AUQA 1N46A 3LBDA 4G2IA 3W0IA 2P4YA 3L3ZA 5FQTA 3A78A 3WJ5A 5I4VA 1M13A 3AURA 1ILHA 1HG4A 2GP7A 1YMTA 4IU7A 5GIDA 2AB2A 4S15A 3L1BA 4UDCA 1XP6A 2E2RA 2H77A 3K22A 4UDAA 2VV1B 2OCFA 1G1UA 1PDUA 3KMZA 5KCTA 1XDKB 2R40D 5FQRA 1EXXA 3L03A 4Q13A 4LTWA 4J24A 4XUHA 3VJTA 3X36A 3D24A 3ET1A 3IPSA 3KFCA 5EC9A 3TKCA 4PLEA 2HB7A 3V3QA 3B67A 3OSIA 4S0TA 4R6SA 1SQNA 3KYTA 2HFPA 1S19A 5DMCA 1XQCA 5G5WA 3TY0A 2NXXE 5AZVA 4K6IA 1Z5XE 1K74D 3MNPA 4E4KA 1S0ZA 2B50A 1U3SA 3AZ2A 2VV0A 3CDSA 3KMRA 4KZJA 4OEAA 5KRFA 3P0UA 1YOKA 4XHDA 1S9QA 1PK5A 2QH6A 5GIEA 2OM9A 3VT8A 2J14A 3DR1A 4ZNVA 2PKLA 1XLSE 5HCVA 3KMGA 3HC6A 4WHGA 2VV4B 2YLOA 1DB1A 1FM6A 5DP0A 4MG8B 2JJ3A 1RJKA 1U9EA 3OZJA 1NAXA 5DKBA 5DXEA 3D57A 2ZNPA 4PP5A 2ZXNA 3VN2A 2JF9A 1ZH7A 3VJSA 5DV6A 5KROA 3RVFA 5DXGA 3GZ9A 2XYWA 3VSPA 1M7WA 1PQ9A 3BC5A 1NHZA 2Q1HA 1GWQA 2YJAB 3X1IA 3GBKA 3A2HA 1PQ6A 2YATA 1ZEOA 4RUOX 4ZO1X 4RZEA 2HARA 2I0JA 1XP1A 2Q61A 4FN9A 1R5KA 4K4JA 1T7MA 3VHWA 5KCFA 5DWGA 1XV9A 1K74A 4REEA 4MDDA 1I38A 1X7BA 4HEEX 3VHUA 2PIOA 3GYUA 2PIXA 5JI0D 3UVVA 1ZUCA 4IVYA 1S9PA 4K7AA 2QZOA 3H0AD 3DY6A 2ZK6A 4UDDA 2JFAA 5DZHA 1RKHA 2EWPA 4PXMA 3OSAA 2P1UA 4ZN7A 5IXKA 2W8YA 4XAOA 3BEJA 3CS4A 1QKMA 2P7GA 3AN4A 4S14A 3O1EA 4ZNHA 1ZKYA 1T74A 4OEDA 5JJMB 1UPWA 3A3ZX 3VSOA 1XNXA 4ZJWA 4CI4A 5KRKA 4TV1A 5SYZA 5DKEA 4G1ZA 4FHIA 4OJ9A 4OKBA 4DM6A 5DZIA 2AA5A 5DUEA 4MG7A 5DXRA 1PRGA 4N5GA 5E15A 2ZK0A 5DZ3A 3UP3A 1MVCA 4PPPA 1L2JA 1SKXA 4ZNSA 4M8HA 4R2UA 2B1ZA 2ZBSA 2QA6A 3OKIA 3PCUA 1NAVA 1H9UA 5E7VA 2I4JA 1YIMA 3ILZA 2ZNOA 5E14A 2NPAA 1XIUA 3WT5A 1YOWA 2ZMJA 3AN3A 4IA3A 2FVJA 3W5PA 2ABIA 3OS8C 5DWIA 5G43A 5DMFA 5G44A 1XPCA 1NRLA 4OZRE 4E4QA 3OMQA 3VT5A 2BJ4A 3D90A 4TUZA 4CSJA 4XTAA 5DIGA 5KD9A 3DZUD 2QA8A 3WWRA 4J5XA 2QPYA 3OMKA 4IV4A 2FSZA 1XAPA 3G9EA 2POBA 5DL4A 2V0VA 1UHLB 3ZRBA 3A9EB 5E1CA 2GPUA 3R5NA 3GWSX 1VJBA 2O4JA 4MGAB 2ZK1A 1XOWA 3FEIA 3PO9A 5DUGA 3ET2A 4QJRA 5DVVA 3OMOA 3V9TA 2AX6A 3VRTA 2PIUA 3WFFA 4ZNWA 2IOKA 2Q59A 4POJA 2HC4A 1PCGA 3W0YA 3B0QA 2QMVA 3MNOA 5KYAA 4NB6A 4UDBA 2REWA 1I7IA 4N73A 5DXPA 1ZAFA 5DV3A 4IA7A 1R1KA 3G0WA 4OIUA 1XVPA 1YY4A 4PP3A 2J7XA 5ICKA 2Q6SA 5DLRA 4A4VA 3CLDA 2AAXA 4OKTA 2JFAB 3UUCA 2VV2A 4L98A 3UUDA 1R20D 3ZQTA 4DQMA 2GPVA 3A2JA 2G0GA 3B3KA 5EHJA 1GWRA 3W0AA 4IQRA 1T7TA 4J5WC 4RMCA 1Y9RA 1ZDTA 4OARA 1X76A 4ZN9A 3OMMA 5L7GA 3V49A 4OKWA 2P1VA 4LBDA 3B0RA 4FGYA 3DT3A 2AX8A 2ZY0A 5IAWA 5KCEA 1A52A 1ERRA 3D6DA 2P1TA 3CS8A 1TXIA 4G1DA 4MG7B 4Y29A 3FALA 2PIRA 3WJ4A 5FQVA 2Q7LA 2ZK5A 4QL8A 3R2AA 5ACCA 3TX7B 1XP9A 1OVLA 3N00A 3U9QA 1FM9D 4CI5A 4YNKA 5M96A 3FURA 2HASA 4OZTE 2AX7A 2AA2A 1N83A 2HBHA 3ERTA 2AM9A 4O8FA 1FCXA 3ZR7A 1T65A 5KCUA 3R29A 3IPQA 3V3EA 3CWDA 3WT7A 2R40A 3W0CA 1NQ2A 3AX8A 1Z95A 3UUAA 1DKFB 1XQ3A 3L0JA 4A2JA 5APKA 3W0JA 2BJ4B 1EXAA 3VI8A 1Q4XA 1G5YA 2R6WA 3GYTA 3L3XA 4IS8A 5HYRA 3F5CA 3IXPD 5KCDA 1QKTA 2GWXA 4OH6A 2Q7KA 4QE8A 5L7EA 2P7AA 3ADXA 4XUMA 3AUNA 5LGAA 3B0WA 1PQCA 3VJHA 4FNEA 2QABA 2VSRA 3GN8A 2AO6A 3MNEA 4MG9B 4WLBA 3NOAA 5A86A 1K4WA 3UU7A 2J7YA 2QR9A 1XZXX 3Q95A 3IPUA 4MGDA 5AAUA 2VSTA 2GL8A 2ACLA 4JYHA 5B41A 2VV3A 4ZO1B 2Q59B 2ZLAA 5DKSA 1OT7A 2B23A 2PRGA 5DKGA 3WMHA 1HJ1A 3F7DA 5L11A 2ZL9A 4PVUA 2HB8A 2QXMA 1FM9A 5DXKA 1FCZA 4OK1A 3RUUA 1M2ZA 2QW4A 3KWYA 2P54A 4IW6A 4QK4A 3E7CA 2AXAA 2Q6JA 2ZKCA 3H52A 3T03A 5IZ0A 1Z5XU 2VV1A 5GT4A 3VRWA 1XDKA 4DM8A 3FC6A 2F4BA 1QKNA 5FQPA 5C4SA 4E2JA 3OS9A 4REFA 3UP0A 4POHA 2FAIA 1OSVA 4WQPA 3OGTA 1FD0A 5DZ1A 2ZASA 3DZYD 3FLIA 4R06A 2ZVTA 3R5MA 4X1GA 3V9VA 2B1VA 2PINA 1R6GA 3HC5A 2V7CA 2ZMHA 4JYGA 5DYDA 2I4ZA 2P7ZA 4OEZA 5DRJA 2Q6RA 4G20A 1T7RA 2HVCA 3H0AA 5AAVA 1RK3A 3AZ3A 1T76A 5DXBA 2P15A 2Z4BA 3VT3A 3CS6A 1SJ0A 4PPSA 2J4AA 1YA3A 5DVSA 4KZMA 2YLPA 2VV4A 4HLWA 5E0WA 5AZTA 3RLJA 3VT4A 1T73A 2GTKA 3P8XA 4MG8A 3RUTA 1QKUA 4MGCA 4WPFA 4RZGA 2AA6A 4N1YA 3VRVA 2QTUA 1ZDUA 5C4OA 3W5RA 5E19A 2PITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q70 A;  5C4T A;  2GPO A;  5KRC A;  1YIN A;  4FHH A;  3K8S A;  3O1D A;  4N8R A;  5DID A;  3VTB A;  3B0T A;  4DK8 A;  5HYK A;  2OZ7 A;  3WFG A;  3ZRA A;  4QE6 A;  2QSE A;  1KKQ A;  4PP6 A;  1Y0X X;  1G2N A;  5APH A;  3ADS A;  2POG A;  4RUJ A;  1U3Q A;  1T79 A;  5DYB A;  3W0G A;  2QGT A;  2NXX A;  2ZXM A;  4J26 A;  2Q5G A;  3F5C B;  1KV6 A;  3ADV A;  4OH5 A;  1X7R A;  1XV9 B;  3GWX A;  3OS8 A;  4PWL A;  5DZ0 A;  3FS1 A;  3R8D A;  3W5T A;  3B68 A;  1P93 A;  3R8A A;  2QNV A;  3UVV B;  3VT6 A;  2NW4 A;  5G45 A;  2PIQ A;  4OEY A;  2QZO B;  3JZC A;  3G8O A;  4OFR A;  4XT9 A;  5AYG A;  5K13 A;  1T63 A;  4MGB A;  4NQA B;  1XLS A;  3HVL A;  5KRI A;  3Q95 B;  3E94 A;  5GIC A;  1K7L A;  4KZI A;  4DOR A;  5CJ6 A;  2YJD A;  5C4U A;  5DIE A;  3OMP A;  4ITF A;  1NDE A;  2ZK2 A;  1ERE A;  2XHS A;  4DOS A;  3VHV A;  5JJM A;  5KRJ A;  3DZU A;  2NV7 A;  4G21 A;  4OGH A;  4RAK A;  5DY8 A;  4TV1 B;  2YFE A;  3GD2 A;  4L96 A;  3LMP A;  5DUH A;  2IHQ A;  3QT0 A;  1NUO A;  3ADT A;  3OOK A;  2ZNQ A;  2H79 A;  3A2I A;  2A3I A;  2Q8S A;  4XI3 A;  5F9B A;  2Q7J A;  4IA1 A;  4DK7 A;  5KCC A;  3BQD A;  5EI1 A;  3PLZ A;  1YUC A;  1E3G A;  5E0X A;  4APU A;  3JZB A;  5DU5 A;  3FC6 B;  3VTD A;  1BSX A;  3ERD A;  4Q50 A;  1IE8 A;  4X1F A;  1NQ1 A;  3VT9 A;  5DX3 A;  5KYJ A;  3SZ1 A;  3OKH A;  2Q1V A;  3X1H A;  4XLD A;  3VJI A;  1X7J A;  2AYR A;  4P6W A;  1FCY A;  4OZR U;  4RE8 A;  3WTQ A;  5HJP A;  2YHD A;  2O4R A;  4ZNU A;  3X31 A;  3SP6 A;  1T5Z A;  5EIT A;  3OSW A;  5AAV B;  4J5W A;  3HZF A;  3SP9 A;  4ZI1 A;  1UPV A;  3HOD A;  5DXB B;  3OLF A;  2OUZ A;  4Q0A C;  5DK9 A;  3HQ5 A;  5B5B A;  3PRG A;  3ADW A;  1R20 A;  1OSH A;  4G1Y A;  2ZXZ A;  4RWV A;  4PRG A;  4PLD A;  4RME A;  2XYJ A;  3DCU A;  4OIV A;  5AWJ A;  4TUZ B;  4OLM A;  4YMQ A;  2HAM A;  1P8D A;  3B1M A;  4LNX A;  2QA8 B;  4ONI A;  1RKG A;  2Q5S A;  3P89 A;  2G0H A;  1IE9 A;  1L2I A;  4IVW A;  4JYI A;  4DMA A;  1MZN A;  2Q60 A;  4IA2 A;  4RMD A;  3S9S A;  5DXQ A;  1I7G A;  5FQS A;  1UHL A;  3KPZ A;  1I37 A;  3A9E A;  1ZGY A;  2ZK4 A;  2AX9 A;  2I0G A;  4LNW A;  5DI7 A;  4A4W A;  4LSJ A;  1E3K A;  3IMY A;  4MGA A;  3FEJ A;  5DV8 A;  3AZ1 A;  2BAW A;  3OAP A;  3HM1 A;  3PBA A;  1Y0S A;  2LBD A;  1X7E A;  1GWX A;  3V4A A;  4JAZ A;  2AMA A;  5AVI A;  3B5R A;  4RFW A;  1XNN A;  3WGP A;  4OJB A;  1A28 A;  3K23 A;  3OLL A;  1XVP B;  2AA7 A;  3L0L A;  4JL4 A;  1N4H A;  5AVL A;  1WM0 X;  2GPP A;  2G5O A;  3PEQ A;  4P6X A;  3FXV A;  4IV2 A;  4G2H A;  4WHF A;  4MGB B;  3W5Q A;  1PZL A;  5AWK A;  4M8E A;  3UUD B;  3AFR A;  5KRH A;  5KCW A;  3HO0 A;  4MG5 A;  4WVD A;  1LBD A;  3VRU A;  3KDU A;  4EM9 A;  3K6P A;  3D5F A;  4BCR A;  4YT1 A;  1RDT D;  3FUG A;  2I4P A;  2ATH A;  1YYE A;  2Q5P A;  4OC7 A;  4RUP A;  4S0S A;  2HWR A;  2QGW A;  2Q7I A;  3IXP A;  3RLL A;  2OVH A;  4NUF A;  1T7F A;  3L0E A;  2G44 A;  4OIL A;  1UOM A;  3IA6 A;  1YJE A;  1YP0 A;  2IOG A;  3CTB A;  4OHA A;  5DVC A;  4EMA A;  5HZC A;  1KNU A;  3B65 A;  1NQ7 A;  3VT7 A;  3CDP A;  3E00 D;  1G50 A;  1GS4 A;  2QE4 A;  3FAL B;  4J5X C;  3OZ0 A;  4OZT U;  4ZOM A;  5DXM A;  4JGV A;  2HWQ A;  2R6Y A;  3NSQ A;  1NQ0 A;  5L7H A;  5JY3 A;  3CJW A;  4IWC A;  5HJS A;  5KRM A;  3NSP A;  1FBY A;  5DX3 B;  4YPQ A;  1XB7 A;  2PNU A;  3HLV A;  5DSH A;  2OVM A;  2PIW A;  4NIE A;  1OVL B;  4PF3 A;  5DWE A;  5KRA A;  5DRM A;  3CQV A;  2HCD A;  5G42 A;  1R1K D;  5HJP B;  2ZMI A;  2XYX A;  3OOF A;  2O9I A;  1TFC A;  4NY9 A;  5EJV A;  1NYX A;  2ZK3 A;  5APJ A;  4RZF A;  3KBA A;  1S0X A;  5H1E A;  5KR9 A;  2AWH A;  2ZFX A;  3OLS A;  5ETH A;  5EGV A;  3UUA B;  2QXS A;  2Z4J A;  4F9M A;  5KRL A;  4OKX A;  1MV9 A;  2GIU A;  5G3J A;  5DWJ A;  3VTC A;  1DKF A;  1ILG A;  1RDT A;  3W0H A;  3P88 A;  3DCT A;  3DZY A;  5DTV A;  4ZJR A;  4QM0 A;  4MG6 A;  1SR7 A;  3M7R A;  3ADU A;  1LV2 A;  3R8I A;  3G8I A;  3RY9 A;  3E00 A;  3A40 X;  3TKM A;  4IUI A;  5G46 A;  2ZNN A;  4ITE A;  4B7W A;  4ZNT A;  3UU7 B;  3WT6 A;  3B66 A;  4MG9 A;  4OJ4 A;  4MGD B;  2PJL A;  4IW8 A;  1XJ7 A;  4IWF A;  2PIV A;  2PIP L;  5AK2 A;  2ACL B;  3ET3 A;  4OFU A;  2Q3Y A;  2XKW A;  5DWL A;  3V9Y A;  3KDT A;  2YLQ A;  3ET0 A;  5LWP A;  2OAX A;  2ZLC A;  1X78 A;  1FM6 D;  2AMB A;  3EYB A;  1U3R A;  2YLY A;  3AUQ A;  1N46 A;  3LBD A;  4G2I A;  3W0I A;  2P4Y A;  3L3Z A;  5FQT A;  3A78 A;  3WJ5 A;  5I4V A;  1M13 A;  3AUR A;  1ILH A;  1HG4 A;  2GP7 A;  1YMT A;  4IU7 A;  5GID A;  2AB2 A;  4S15 A;  3L1B A;  4UDC A;  1XP6 A;  2E2R A;  2H77 A;  3K22 A;  4UDA A;  2VV1 B;  2OCF A;  1G1U A;  1PDU A;  3KMZ A;  5KCT A;  1XDK B;  2R40 D;  5FQR A;  1EXX A;  3L03 A;  4Q13 A;  4LTW A;  4J24 A;  4XUH A;  3VJT A;  3X36 A;  3D24 A;  3ET1 A;  3IPS A;  3KFC A;  5EC9 A;  3TKC A;  4PLE A;  2HB7 A;  3V3Q A;  3B67 A;  3OSI A;  4S0T A;  4R6S A;  1SQN A;  3KYT A;  2HFP A;  1S19 A;  5DMC A;  1XQC A;  5G5W A;  3TY0 A;  2NXX E;  5AZV A;  4K6I A;  1Z5X E;  1K74 D;  3MNP A;  4E4K A;  1S0Z A;  2B50 A;  1U3S A;  3AZ2 A;  2VV0 A;  3CDS A;  3KMR A;  4KZJ A;  4OEA A;  5KRF A;  3P0U A;  1YOK A;  4XHD A;  1S9Q A;  1PK5 A;  2QH6 A;  5GIE A;  2OM9 A;  3VT8 A;  2J14 A;  3DR1 A;  4ZNV A;  2PKL A;  1XLS E;  5HCV A;  3KMG A;  3HC6 A;  4WHG A;  2VV4 B;  2YLO A;  1DB1 A;  1FM6 A;  5DP0 A;  4MG8 B;  2JJ3 A;  1RJK A;  1U9E A;  3OZJ A;  1NAX A;  5DKB A;  5DXE A;  3D57 A;  2ZNP A;  4PP5 A;  2ZXN A;  3VN2 A;  2JF9 A;  1ZH7 A;  3VJS A;  5DV6 A;  5KRO A;  3RVF A;  5DXG A;  3GZ9 A;  2XYW A;  3VSP A;  1M7W A;  1PQ9 A;  3BC5 A;  1NHZ A;  2Q1H A;  1GWQ A;  2YJA B;  3X1I A;  3GBK A;  3A2H A;  1PQ6 A;  2YAT A;  1ZEO A;  4RUO X;  4ZO1 X;  4RZE A;  2HAR A;  2I0J A;  1XP1 A;  2Q61 A;  4FN9 A;  1R5K A;  4K4J A;  1T7M A;  3VHW A;  5KCF A;  5DWG A;  1XV9 A;  1K74 A;  4REE A;  4MDD A;  1I38 A;  1X7B A;  4HEE X;  3VHU A;  2PIO A;  3GYU A;  2PIX A;  5JI0 D;  3UVV A;  1ZUC A;  4IVY A;  1S9P A;  4K7A A;  2QZO A;  3H0A D;  3DY6 A;  2ZK6 A;  4UDD A;  2JFA A;  5DZH A;  1RKH A;  2EWP A;  4PXM A;  3OSA A;  2P1U A;  4ZN7 A;  5IXK A;  2W8Y A;  4XAO A;  3BEJ A;  3CS4 A;  1QKM A;  2P7G A;  3AN4 A;  4S14 A;  3O1E A;  4ZNH A;  1ZKY A;  1T74 A;  4OED A;  5JJM B;  1UPW A;  3A3Z X;  3VSO A;  1XNX A;  4ZJW A;  4CI4 A;  5KRK A;  4TV1 A;  5SYZ A;  5DKE A;  4G1Z A;  4FHI A;  4OJ9 A;  4OKB A;  4DM6 A;  5DZI A;  2AA5 A;  5DUE A;  4MG7 A;  5DXR A;  1PRG A;  4N5G A;  5E15 A;  2ZK0 A;  5DZ3 A;  3UP3 A;  1MVC A;  4PPP A;  1L2J A;  1SKX A;  4ZNS A;  4M8H A;  4R2U A;  2B1Z A;  2ZBS A;  2QA6 A;  3OKI A;  3PCU A;  1NAV A;  1H9U A;  5E7V A;  2I4J A;  1YIM A;  3ILZ A;  2ZNO A;  5E14 A;  2NPA A;  1XIU A;  3WT5 A;  1YOW A;  2ZMJ A;  3AN3 A;  4IA3 A;  2FVJ A;  3W5P A;  2ABI A;  3OS8 C;  5DWI A;  5G43 A;  5DMF A;  5G44 A;  1XPC A;  1NRL A;  4OZR E;  4E4Q A;  3OMQ A;  3VT5 A;  2BJ4 A;  3D90 A;  4TUZ A;  4CSJ A;  4XTA A;  5DIG A;  5KD9 A;  3DZU D;  2QA8 A;  3WWR A;  4J5X A;  2QPY A;  3OMK A;  4IV4 A;  2FSZ A;  1XAP A;  3G9E A;  2POB A;  5DL4 A;  2V0V A;  1UHL B;  3ZRB A;  3A9E B;  5E1C A;  2GPU A;  3R5N A;  3GWS X;  1VJB A;  2O4J A;  4MGA B;  2ZK1 A;  1XOW A;  3FEI A;  3PO9 A;  5DUG A;  3ET2 A;  4QJR A;  5DVV A;  3OMO A;  3V9T A;  2AX6 A;  3VRT A;  2PIU A;  3WFF A;  4ZNW A;  2IOK A;  2Q59 A;  4POJ A;  2HC4 A;  1PCG A;  3W0Y A;  3B0Q A;  2QMV A;  3MNO A;  5KYA A;  4NB6 A;  4UDB A;  2REW A;  1I7I A;  4N73 A;  5DXP A;  1ZAF A;  5DV3 A;  4IA7 A;  1R1K A;  3G0W A;  4OIU A;  1XVP A;  1YY4 A;  4PP3 A;  2J7X A;  5ICK A;  2Q6S A;  5DLR A;  4A4V A;  3CLD A;  2AAX A;  4OKT A;  2JFA B;  3UUC A;  2VV2 A;  4L98 A;  3UUD A;  1R20 D;  3ZQT A;  4DQM A;  2GPV A;  3A2J A;  2G0G A;  3B3K A;  5EHJ A;  1GWR A;  3W0A A;  4IQR A;  1T7T A;  4J5W C;  4RMC A;  1Y9R A;  1ZDT A;  4OAR A;  1X76 A;  4ZN9 A;  3OMM A;  5L7G A;  3V49 A;  4OKW A;  2P1V A;  4LBD A;  3B0R A;  4FGY A;  3DT3 A;  2AX8 A;  2ZY0 A;  5IAW A;  5KCE A;  1A52 A;  1ERR A;  3D6D A;  2P1T A;  3CS8 A;  1TXI A;  4G1D A;  4MG7 B;  4Y29 A;  3FAL A;  2PIR A;  3WJ4 A;  5FQV A;  2Q7L A;  2ZK5 A;  4QL8 A;  3R2A A;  5ACC A;  3TX7 B;  1XP9 A;  1OVL A;  3N00 A;  3U9Q A;  1FM9 D;  4CI5 A;  4YNK A;  5M96 A;  3FUR A;  2HAS A;  4OZT E;  2AX7 A;  2AA2 A;  1N83 A;  2HBH A;  3ERT A;  2AM9 A;  4O8F A;  1FCX A;  3ZR7 A;  1T65 A;  5KCU A;  3R29 A;  3IPQ A;  3V3E A;  3CWD A;  3WT7 A;  2R40 A;  3W0C A;  1NQ2 A;  3AX8 A;  1Z95 A;  3UUA A;  1DKF B;  1XQ3 A;  3L0J A;  4A2J A;  5APK A;  3W0J A;  2BJ4 B;  1EXA A;  3VI8 A;  1Q4X A;  1G5Y A;  2R6W A;  3GYT A;  3L3X A;  4IS8 A;  5HYR A;  3F5C A;  3IXP D;  5KCD A;  1QKT A;  2GWX A;  4OH6 A;  2Q7K A;  4QE8 A;  5L7E A;  2P7A A;  3ADX A;  4XUM A;  3AUN A;  5LGA A;  3B0W A;  1PQC A;  3VJH A;  4FNE A;  2QAB A;  2VSR A;  3GN8 A;  2AO6 A;  3MNE A;  4MG9 B;  4WLB A;  3NOA A;  5A86 A;  1K4W A;  3UU7 A;  2J7Y A;  2QR9 A;  1XZX X;  3Q95 A;  3IPU A;  4MGD A;  5AAU A;  2VST A;  2GL8 A;  2ACL A;  4JYH A;  5B41 A;  2VV3 A;  4ZO1 B;  2Q59 B;  2ZLA A;  5DKS A;  1OT7 A;  2B23 A;  2PRG A;  5DKG A;  3WMH A;  1HJ1 A;  3F7D A;  5L11 A;  2ZL9 A;  4PVU A;  2HB8 A;  2QXM A;  1FM9 A;  5DXK A;  1FCZ A;  4OK1 A;  3RUU A;  1M2Z A;  2QW4 A;  3KWY A;  2P54 A;  4IW6 A;  4QK4 A;  3E7C A;  2AXA A;  2Q6J A;  2ZKC A;  3H52 A;  3T03 A;  5IZ0 A;  1Z5X U;  2VV1 A;  5GT4 A;  3VRW A;  1XDK A;  4DM8 A;  3FC6 A;  2F4B A;  1QKN A;  5FQP A;  5C4S A;  4E2J A;  3OS9 A;  4REF A;  3UP0 A;  4POH A;  2FAI A;  1OSV A;  4WQP A;  3OGT A;  1FD0 A;  5DZ1 A;  2ZAS A;  3DZY D;  3FLI A;  4R06 A;  2ZVT A;  3R5M A;  4X1G A;  3V9V A;  2B1V A;  2PIN A;  1R6G A;  3HC5 A;  2V7C A;  2ZMH A;  4JYG A;  5DYD A;  2I4Z A;  2P7Z A;  4OEZ A;  5DRJ A;  2Q6R A;  4G20 A;  1T7R A;  2HVC A;  3H0A A;  5AAV A;  1RK3 A;  3AZ3 A;  1T76 A;  5DXB A;  2P15 A;  2Z4B A;  3VT3 A;  3CS6 A;  1SJ0 A;  4PPS A;  2J4A A;  1YA3 A;  5DVS A;  4KZM A;  2YLP A;  2VV4 A;  4HLW A;  5E0W A;  5AZT A;  3RLJ A;  3VT4 A;  1T73 A;  2GTK A;  3P8X A;  4MG8 A;  3RUT A;  1QKU A;  4MGC A;  4WPF A;  4RZG A;  2AA6 A;  4N1Y A;  3VRV A;  2QTU A;  1ZDU A;  5C4O A;  3W5R A;  5E19 A;  2PIT A; 
#chains in the Genus database with same CATH topology
 2Q70 A;  5C4T A;  2GPO A;  5KRC A;  1YIN A;  4FHH A;  3K8S A;  3O1D A;  4N8R A;  5DID A;  3VTB A;  3B0T A;  4DK8 A;  5HYK A;  2OZ7 A;  3WFG A;  3ZRA A;  4QE6 A;  2QSE A;  1KKQ A;  4PP6 A;  1Y0X X;  1G2N A;  5APH A;  3ADS A;  2POG A;  4RUJ A;  1U3Q A;  1T79 A;  5DYB A;  3W0G A;  2QGT A;  2NXX A;  2ZXM A;  4J26 A;  2Q5G A;  3F5C B;  1KV6 A;  3ADV A;  4OH5 A;  1X7R A;  1XV9 B;  3GWX A;  3OS8 A;  4PWL A;  5DZ0 A;  3FS1 A;  3R8D A;  3W5T A;  3B68 A;  1P93 A;  3R8A A;  2QNV A;  3UVV B;  3VT6 A;  2NW4 A;  5G45 A;  2PIQ A;  4OEY A;  2QZO B;  3JZC A;  3G8O A;  4OFR A;  4XT9 A;  5AYG A;  5K13 A;  1T63 A;  4MGB A;  4NQA B;  1XLS A;  3HVL A;  5KRI A;  3Q95 B;  3E94 A;  5GIC A;  1K7L A;  4KZI A;  4DOR A;  5CJ6 A;  2YJD A;  5C4U A;  5DIE A;  3OMP A;  4ITF A;  1NDE A;  2ZK2 A;  1ERE A;  2XHS A;  4DOS A;  3VHV A;  5JJM A;  5KRJ A;  3DZU A;  2NV7 A;  4G21 A;  4OGH A;  4RAK A;  5DY8 A;  4TV1 B;  2YFE A;  3GD2 A;  4L96 A;  3LMP A;  5DUH A;  2IHQ A;  3QT0 A;  1NUO A;  3ADT A;  3OOK A;  2ZNQ A;  2H79 A;  3A2I A;  2A3I A;  2Q8S A;  4XI3 A;  5F9B A;  2Q7J A;  4IA1 A;  4DK7 A;  5KCC A;  3BQD A;  5EI1 A;  3PLZ A;  1YUC A;  1E3G A;  5E0X A;  4APU A;  3JZB A;  5DU5 A;  3FC6 B;  3VTD A;  1BSX A;  3ERD A;  4Q50 A;  1IE8 A;  4X1F A;  1NQ1 A;  3VT9 A;  5DX3 A;  5KYJ A;  3SZ1 A;  3OKH A;  2Q1V A;  3X1H A;  4XLD A;  3VJI A;  1X7J A;  2AYR A;  4P6W A;  1FCY A;  4OZR U;  4RE8 A;  3WTQ A;  5HJP A;  2YHD A;  2O4R A;  4ZNU A;  3X31 A;  3SP6 A;  1T5Z A;  5EIT A;  3OSW A;  5AAV B;  4J5W A;  3HZF A;  3SP9 A;  4ZI1 A;  1UPV A;  3HOD A;  5DXB B;  3OLF A;  2OUZ A;  4Q0A C;  5DK9 A;  3HQ5 A;  5B5B A;  3PRG A;  3ADW A;  1R20 A;  1OSH A;  4G1Y A;  2ZXZ A;  4RWV A;  4PRG A;  4PLD A;  4RME A;  2XYJ A;  3DCU A;  4OIV A;  5AWJ A;  4TUZ B;  4OLM A;  4YMQ A;  2HAM A;  1P8D A;  3B1M A;  4LNX A;  2QA8 B;  4ONI A;  1RKG A;  2Q5S A;  3P89 A;  2G0H A;  1IE9 A;  1L2I A;  4IVW A;  4JYI A;  4DMA A;  1MZN A;  2Q60 A;  4IA2 A;  4RMD A;  3S9S A;  5DXQ A;  1I7G A;  5FQS A;  1UHL A;  3KPZ A;  1I37 A;  3A9E A;  1ZGY A;  2ZK4 A;  2AX9 A;  2I0G A;  4LNW A;  5DI7 A;  4A4W A;  4LSJ A;  1E3K A;  3IMY A;  4MGA A;  3FEJ A;  5DV8 A;  3AZ1 A;  2BAW A;  3OAP A;  3HM1 A;  3PBA A;  1Y0S A;  2LBD A;  1X7E A;  1GWX A;  3V4A A;  4JAZ A;  2AMA A;  5AVI A;  3B5R A;  4RFW A;  1XNN A;  3WGP A;  4OJB A;  1A28 A;  3K23 A;  3OLL A;  1XVP B;  2AA7 A;  3L0L A;  4JL4 A;  1N4H A;  5AVL A;  1WM0 X;  2GPP A;  2G5O A;  3PEQ A;  4P6X A;  3FXV A;  4IV2 A;  4G2H A;  4WHF A;  4MGB B;  3W5Q A;  1PZL A;  5AWK A;  4M8E A;  3UUD B;  3AFR A;  5KRH A;  5KCW A;  3HO0 A;  4MG5 A;  4WVD A;  1LBD A;  3VRU A;  3KDU A;  4EM9 A;  3K6P A;  3D5F A;  4BCR A;  4YT1 A;  1RDT D;  3FUG A;  2I4P A;  2ATH A;  1YYE A;  2Q5P A;  4OC7 A;  4RUP A;  4S0S A;  2HWR A;  2QGW A;  2Q7I A;  3IXP A;  3RLL A;  2OVH A;  4NUF A;  1T7F A;  3L0E A;  2G44 A;  4OIL A;  1UOM A;  3IA6 A;  1YJE A;  1YP0 A;  2IOG A;  3CTB A;  4OHA A;  5DVC A;  4EMA A;  5HZC A;  1KNU A;  3B65 A;  1NQ7 A;  3VT7 A;  3CDP A;  3E00 D;  1G50 A;  1GS4 A;  2QE4 A;  3FAL B;  4J5X C;  3OZ0 A;  4OZT U;  4ZOM A;  5DXM A;  4JGV A;  2HWQ A;  2R6Y A;  3NSQ A;  1NQ0 A;  5L7H A;  5JY3 A;  3CJW A;  4IWC A;  5HJS A;  5KRM A;  3NSP A;  1FBY A;  5DX3 B;  4YPQ A;  1XB7 A;  2PNU A;  3HLV A;  5DSH A;  2OVM A;  2PIW A;  4NIE A;  1OVL B;  4PF3 A;  5DWE A;  5KRA A;  5DRM A;  3CQV A;  2HCD A;  5G42 A;  1R1K D;  5HJP B;  2ZMI A;  2XYX A;  3OOF A;  2O9I A;  1TFC A;  4NY9 A;  5EJV A;  1NYX A;  2ZK3 A;  5APJ A;  4RZF A;  3KBA A;  1S0X A;  5H1E A;  5KR9 A;  2AWH A;  2ZFX A;  3OLS A;  5ETH A;  5EGV A;  3UUA B;  2QXS A;  2Z4J A;  4F9M A;  5KRL A;  4OKX A;  1MV9 A;  2GIU A;  5G3J A;  5DWJ A;  3VTC A;  1DKF A;  1ILG A;  1RDT A;  3W0H A;  3P88 A;  3DCT A;  3DZY A;  5DTV A;  4ZJR A;  4QM0 A;  4MG6 A;  1SR7 A;  3M7R A;  3ADU A;  1LV2 A;  3R8I A;  3G8I A;  3RY9 A;  3E00 A;  3A40 X;  3TKM A;  4IUI A;  5G46 A;  2ZNN A;  4ITE A;  4B7W A;  4ZNT A;  3UU7 B;  3WT6 A;  3B66 A;  4MG9 A;  4OJ4 A;  4MGD B;  2PJL A;  4IW8 A;  1XJ7 A;  4IWF A;  2PIV A;  2PIP L;  5AK2 A;  2ACL B;  3ET3 A;  4OFU A;  2Q3Y A;  2XKW A;  5DWL A;  3V9Y A;  3KDT A;  2YLQ A;  3ET0 A;  5LWP A;  2OAX A;  2ZLC A;  1X78 A;  1FM6 D;  2AMB A;  3EYB A;  1U3R A;  2YLY A;  3AUQ A;  1N46 A;  3LBD A;  4G2I A;  3W0I A;  2P4Y A;  3L3Z A;  5FQT A;  3A78 A;  3WJ5 A;  5I4V A;  1M13 A;  3AUR A;  1ILH A;  1HG4 A;  2GP7 A;  1YMT A;  4IU7 A;  5GID A;  2AB2 A;  4S15 A;  3L1B A;  4UDC A;  1XP6 A;  2E2R A;  2H77 A;  3K22 A;  4UDA A;  2VV1 B;  2OCF A;  1G1U A;  1PDU A;  3KMZ A;  5KCT A;  1XDK B;  2R40 D;  5FQR A;  1EXX A;  3L03 A;  4Q13 A;  4LTW A;  4J24 A;  4XUH A;  3VJT A;  3X36 A;  3D24 A;  3ET1 A;  3IPS A;  3KFC A;  5EC9 A;  3TKC A;  4PLE A;  2HB7 A;  3V3Q A;  3B67 A;  3OSI A;  4S0T A;  4R6S A;  1SQN A;  3KYT A;  2HFP A;  1S19 A;  5DMC A;  1XQC A;  5G5W A;  3TY0 A;  2NXX E;  5AZV A;  4K6I A;  1Z5X E;  1K74 D;  3MNP A;  4E4K A;  1S0Z A;  2B50 A;  1U3S A;  3AZ2 A;  2VV0 A;  3CDS A;  3KMR A;  4KZJ A;  4OEA A;  5KRF A;  3P0U A;  1YOK A;  4XHD A;  1S9Q A;  1PK5 A;  2QH6 A;  5GIE A;  2OM9 A;  3VT8 A;  2J14 A;  3DR1 A;  4ZNV A;  2PKL A;  1XLS E;  5HCV A;  3KMG A;  3HC6 A;  4WHG A;  2VV4 B;  2YLO A;  1DB1 A;  1FM6 A;  5DP0 A;  4MG8 B;  2JJ3 A;  1RJK A;  1U9E A;  3OZJ A;  1NAX A;  5DKB A;  5DXE A;  3D57 A;  2ZNP A;  4PP5 A;  2ZXN A;  3VN2 A;  2JF9 A;  1ZH7 A;  3VJS A;  5DV6 A;  5KRO A;  3RVF A;  5DXG A;  3GZ9 A;  2XYW A;  3VSP A;  1M7W A;  1PQ9 A;  3BC5 A;  1NHZ A;  2Q1H A;  1GWQ A;  2YJA B;  3X1I A;  3GBK A;  3A2H A;  1PQ6 A;  2YAT A;  1ZEO A;  4RUO X;  4ZO1 X;  4RZE A;  2HAR A;  2I0J A;  1XP1 A;  2Q61 A;  4FN9 A;  1R5K A;  4K4J A;  1T7M A;  3VHW A;  5KCF A;  5DWG A;  1XV9 A;  1K74 A;  4REE A;  4MDD A;  1I38 A;  1X7B A;  4HEE X;  3VHU A;  2PIO A;  3GYU A;  2PIX A;  5JI0 D;  3UVV A;  1ZUC A;  4IVY A;  1S9P A;  4K7A A;  2QZO A;  3H0A D;  3DY6 A;  2ZK6 A;  4UDD A;  2JFA A;  5DZH A;  1RKH A;  2EWP A;  4PXM A;  3OSA A;  2P1U A;  4ZN7 A;  5IXK A;  2W8Y A;  4XAO A;  3BEJ A;  3CS4 A;  1QKM A;  2P7G A;  3AN4 A;  4S14 A;  3O1E A;  4ZNH A;  1ZKY A;  1T74 A;  4OED A;  5JJM B;  1UPW A;  3A3Z X;  3VSO A;  1XNX A;  4ZJW A;  4CI4 A;  5KRK A;  4TV1 A;  5SYZ A;  5DKE A;  4G1Z A;  4FHI A;  4OJ9 A;  4OKB A;  4DM6 A;  5DZI A;  2AA5 A;  5DUE A;  4MG7 A;  5DXR A;  1PRG A;  4N5G A;  5E15 A;  2ZK0 A;  5DZ3 A;  3UP3 A;  1MVC A;  4PPP A;  1L2J A;  1SKX A;  4ZNS A;  4M8H A;  4R2U A;  2B1Z A;  2ZBS A;  2QA6 A;  3OKI A;  3PCU A;  1NAV A;  1H9U A;  5E7V A;  2I4J A;  1YIM A;  3ILZ A;  2ZNO A;  5E14 A;  2NPA A;  1XIU A;  3WT5 A;  1YOW A;  2ZMJ A;  3AN3 A;  4IA3 A;  2FVJ A;  3W5P A;  2ABI A;  3OS8 C;  5DWI A;  5G43 A;  5DMF A;  5G44 A;  1XPC A;  1NRL A;  4OZR E;  4E4Q A;  3OMQ A;  3VT5 A;  2BJ4 A;  3D90 A;  4TUZ A;  4CSJ A;  4XTA A;  5DIG A;  5KD9 A;  3DZU D;  2QA8 A;  3WWR A;  4J5X A;  2QPY A;  3OMK A;  4IV4 A;  2FSZ A;  1XAP A;  3G9E A;  2POB A;  5DL4 A;  2V0V A;  1UHL B;  3ZRB A;  3A9E B;  5E1C A;  2GPU A;  3R5N A;  3GWS X;  1VJB A;  2O4J A;  4MGA B;  2ZK1 A;  1XOW A;  3FEI A;  3PO9 A;  5DUG A;  3ET2 A;  4QJR A;  5DVV A;  3OMO A;  3V9T A;  2AX6 A;  3VRT A;  2PIU A;  3WFF A;  4ZNW A;  2IOK A;  2Q59 A;  4POJ A;  2HC4 A;  1PCG A;  3W0Y A;  3B0Q A;  2QMV A;  3MNO A;  5KYA A;  4NB6 A;  4UDB A;  2REW A;  1I7I A;  4N73 A;  5DXP A;  1ZAF A;  5DV3 A;  4IA7 A;  1R1K A;  3G0W A;  4OIU A;  1XVP A;  1YY4 A;  4PP3 A;  2J7X A;  5ICK A;  2Q6S A;  5DLR A;  4A4V A;  3CLD A;  2AAX A;  4OKT A;  2JFA B;  3UUC A;  2VV2 A;  4L98 A;  3UUD A;  1R20 D;  3ZQT A;  4DQM A;  2GPV A;  3A2J A;  2G0G A;  3B3K A;  5EHJ A;  1GWR A;  3W0A A;  4IQR A;  1T7T A;  4J5W C;  4RMC A;  1Y9R A;  1ZDT A;  4OAR A;  1X76 A;  4ZN9 A;  3OMM A;  5L7G A;  3V49 A;  4OKW A;  2P1V A;  4LBD A;  3B0R A;  4FGY A;  3DT3 A;  2AX8 A;  2ZY0 A;  5IAW A;  5KCE A;  1A52 A;  1ERR A;  3D6D A;  2P1T A;  3CS8 A;  1TXI A;  4G1D A;  4MG7 B;  4Y29 A;  3FAL A;  2PIR A;  3WJ4 A;  5FQV A;  2Q7L A;  2ZK5 A;  4QL8 A;  3R2A A;  5ACC A;  3TX7 B;  1XP9 A;  1OVL A;  3N00 A;  3U9Q A;  1FM9 D;  4CI5 A;  4YNK A;  5M96 A;  3FUR A;  2HAS A;  4OZT E;  2AX7 A;  2AA2 A;  1N83 A;  2HBH A;  3ERT A;  2AM9 A;  4O8F A;  1FCX A;  3ZR7 A;  1T65 A;  5KCU A;  3R29 A;  3IPQ A;  3V3E A;  3CWD A;  3WT7 A;  2R40 A;  3W0C A;  1NQ2 A;  3AX8 A;  1Z95 A;  3UUA A;  1DKF B;  1XQ3 A;  3L0J A;  4A2J A;  5APK A;  3W0J A;  2BJ4 B;  1EXA A;  3VI8 A;  1Q4X A;  1G5Y A;  2R6W A;  3GYT A;  3L3X A;  4IS8 A;  5HYR A;  3F5C A;  3IXP D;  5KCD A;  1QKT A;  2GWX A;  4OH6 A;  2Q7K A;  4QE8 A;  5L7E A;  2P7A A;  3ADX A;  4XUM A;  3AUN A;  5LGA A;  3B0W A;  1PQC A;  3VJH A;  4FNE A;  2QAB A;  2VSR A;  3GN8 A;  2AO6 A;  3MNE A;  4MG9 B;  4WLB A;  3NOA A;  5A86 A;  1K4W A;  3UU7 A;  2J7Y A;  2QR9 A;  1XZX X;  3Q95 A;  3IPU A;  4MGD A;  5AAU A;  2VST A;  2GL8 A;  2ACL A;  4JYH A;  5B41 A;  2VV3 A;  4ZO1 B;  2Q59 B;  2ZLA A;  5DKS A;  1OT7 A;  2B23 A;  2PRG A;  5DKG A;  3WMH A;  1HJ1 A;  3F7D A;  5L11 A;  2ZL9 A;  4PVU A;  2HB8 A;  2QXM A;  1FM9 A;  5DXK A;  1FCZ A;  4OK1 A;  3RUU A;  1M2Z A;  2QW4 A;  3KWY A;  2P54 A;  4IW6 A;  4QK4 A;  3E7C A;  2AXA A;  2Q6J A;  2ZKC A;  3H52 A;  3T03 A;  5IZ0 A;  1Z5X U;  2VV1 A;  5GT4 A;  3VRW A;  1XDK A;  4DM8 A;  3FC6 A;  2F4B A;  1QKN A;  5FQP A;  5C4S A;  4E2J A;  3OS9 A;  4REF A;  3UP0 A;  4POH A;  2FAI A;  1OSV A;  4WQP A;  3OGT A;  1FD0 A;  5DZ1 A;  2ZAS A;  3DZY D;  3FLI A;  4R06 A;  2ZVT A;  3R5M A;  4X1G A;  3V9V A;  2B1V A;  2PIN A;  1R6G A;  3HC5 A;  2V7C A;  2ZMH A;  4JYG A;  5DYD A;  2I4Z A;  2P7Z A;  4OEZ A;  5DRJ A;  2Q6R A;  4G20 A;  1T7R A;  2HVC A;  3H0A A;  5AAV A;  1RK3 A;  3AZ3 A;  1T76 A;  5DXB A;  2P15 A;  2Z4B A;  3VT3 A;  3CS6 A;  1SJ0 A;  4PPS A;  2J4A A;  1YA3 A;  5DVS A;  4KZM A;  2YLP A;  2VV4 A;  4HLW A;  5E0W A;  5AZT A;  3RLJ A;  3VT4 A;  1T73 A;  2GTK A;  3P8X A;  4MG8 A;  3RUT A;  1QKU A;  4MGC A;  4WPF A;  4RZG A;  2AA6 A;  4N1Y A;  3VRV A;  2QTU A;  1ZDU A;  5C4O A;  3W5R A;  5E19 A;  2PIT A; 
#chains in the Genus database with same CATH homology
 2Q70 A;  5C4T A;  2GPO A;  5KRC A;  1YIN A;  4FHH A;  3K8S A;  3O1D A;  4N8R A;  5DID A;  3VTB A;  3B0T A;  4DK8 A;  5HYK A;  2OZ7 A;  3WFG A;  3ZRA A;  4QE6 A;  2QSE A;  1KKQ A;  4PP6 A;  1Y0X X;  1G2N A;  5APH A;  3ADS A;  2POG A;  4RUJ A;  1U3Q A;  1T79 A;  5DYB A;  3W0G A;  2QGT A;  2NXX A;  2ZXM A;  4J26 A;  2Q5G A;  3F5C B;  1KV6 A;  3ADV A;  4OH5 A;  1X7R A;  1XV9 B;  3GWX A;  3OS8 A;  4PWL A;  5DZ0 A;  3FS1 A;  3R8D A;  3W5T A;  3B68 A;  1P93 A;  3R8A A;  2QNV A;  3UVV B;  3VT6 A;  2NW4 A;  5G45 A;  2PIQ A;  4OEY A;  2QZO B;  3JZC A;  3G8O A;  4OFR A;  4XT9 A;  5AYG A;  5K13 A;  1T63 A;  4MGB A;  4NQA B;  1XLS A;  3HVL A;  5KRI A;  3Q95 B;  3E94 A;  5GIC A;  1K7L A;  4KZI A;  4DOR A;  5CJ6 A;  2YJD A;  5C4U A;  5DIE A;  3OMP A;  4ITF A;  1NDE A;  2ZK2 A;  1ERE A;  2XHS A;  4DOS A;  3VHV A;  5JJM A;  5KRJ A;  3DZU A;  2NV7 A;  4G21 A;  4OGH A;  4RAK A;  5DY8 A;  4TV1 B;  2YFE A;  3GD2 A;  4L96 A;  3LMP A;  5DUH A;  2IHQ A;  3QT0 A;  1NUO A;  3ADT A;  3OOK A;  2ZNQ A;  2H79 A;  3A2I A;  2A3I A;  2Q8S A;  4XI3 A;  5F9B A;  2Q7J A;  4IA1 A;  4DK7 A;  5KCC A;  3BQD A;  5EI1 A;  3PLZ A;  1YUC A;  1E3G A;  5E0X A;  4APU A;  3JZB A;  5DU5 A;  3FC6 B;  3VTD A;  1BSX A;  3ERD A;  4Q50 A;  1IE8 A;  4X1F A;  1NQ1 A;  3VT9 A;  5DX3 A;  5KYJ A;  3SZ1 A;  3OKH A;  2Q1V A;  3X1H A;  4XLD A;  3VJI A;  1X7J A;  2AYR A;  4P6W A;  1FCY A;  4OZR U;  4RE8 A;  3WTQ A;  5HJP A;  2YHD A;  2O4R A;  4ZNU A;  3X31 A;  3SP6 A;  1T5Z A;  5EIT A;  3OSW A;  5AAV B;  4J5W A;  3HZF A;  3SP9 A;  4ZI1 A;  1UPV A;  3HOD A;  5DXB B;  3OLF A;  2OUZ A;  4Q0A C;  5DK9 A;  3HQ5 A;  5B5B A;  3PRG A;  3ADW A;  1R20 A;  1OSH A;  4G1Y A;  2ZXZ A;  4RWV A;  4PRG A;  4PLD A;  4RME A;  2XYJ A;  3DCU A;  4OIV A;  5AWJ A;  4TUZ B;  4OLM A;  4YMQ A;  2HAM A;  1P8D A;  3B1M A;  4LNX A;  2QA8 B;  4ONI A;  1RKG A;  2Q5S A;  3P89 A;  2G0H A;  1IE9 A;  1L2I A;  4IVW A;  4JYI A;  4DMA A;  1MZN A;  2Q60 A;  4IA2 A;  4RMD A;  3S9S A;  5DXQ A;  1I7G A;  5FQS A;  1UHL A;  3KPZ A;  1I37 A;  3A9E A;  1ZGY A;  2ZK4 A;  2AX9 A;  2I0G A;  4LNW A;  5DI7 A;  4A4W A;  4LSJ A;  1E3K A;  3IMY A;  4MGA A;  3FEJ A;  5DV8 A;  3AZ1 A;  2BAW A;  3OAP A;  3HM1 A;  3PBA A;  1Y0S A;  2LBD A;  1X7E A;  1GWX A;  3V4A A;  4JAZ A;  2AMA A;  5AVI A;  3B5R A;  4RFW A;  1XNN A;  3WGP A;  4OJB A;  1A28 A;  3K23 A;  3OLL A;  1XVP B;  2AA7 A;  3L0L A;  4JL4 A;  1N4H A;  5AVL A;  1WM0 X;  2GPP A;  2G5O A;  3PEQ A;  4P6X A;  3FXV A;  4IV2 A;  4G2H A;  4WHF A;  4MGB B;  3W5Q A;  1PZL A;  5AWK A;  4M8E A;  3UUD B;  3AFR A;  5KRH A;  5KCW A;  3HO0 A;  4MG5 A;  4WVD A;  1LBD A;  3VRU A;  3KDU A;  4EM9 A;  3K6P A;  3D5F A;  4BCR A;  4YT1 A;  1RDT D;  3FUG A;  2I4P A;  2ATH A;  1YYE A;  2Q5P A;  4OC7 A;  4RUP A;  4S0S A;  2HWR A;  2QGW A;  2Q7I A;  3IXP A;  3RLL A;  2OVH A;  4NUF A;  1T7F A;  3L0E A;  2G44 A;  4OIL A;  1UOM A;  3IA6 A;  1YJE A;  1YP0 A;  2IOG A;  3CTB A;  4OHA A;  5DVC A;  4EMA A;  5HZC A;  1KNU A;  3B65 A;  1NQ7 A;  3VT7 A;  3CDP A;  3E00 D;  1G50 A;  1GS4 A;  2QE4 A;  3FAL B;  4J5X C;  3OZ0 A;  4OZT U;  4ZOM A;  5DXM A;  4JGV A;  2HWQ A;  2R6Y A;  3NSQ A;  1NQ0 A;  5L7H A;  5JY3 A;  3CJW A;  4IWC A;  5HJS A;  5KRM A;  3NSP A;  1FBY A;  5DX3 B;  4YPQ A;  1XB7 A;  2PNU A;  3HLV A;  5DSH A;  2OVM A;  2PIW A;  4NIE A;  1OVL B;  4PF3 A;  5DWE A;  5KRA A;  5DRM A;  3CQV A;  2HCD A;  5G42 A;  1R1K D;  5HJP B;  2ZMI A;  2XYX A;  3OOF A;  2O9I A;  1TFC A;  4NY9 A;  5EJV A;  1NYX A;  2ZK3 A;  5APJ A;  4RZF A;  3KBA A;  1S0X A;  5H1E A;  5KR9 A;  2AWH A;  2ZFX A;  3OLS A;  5ETH A;  5EGV A;  3UUA B;  2QXS A;  2Z4J A;  4F9M A;  5KRL A;  4OKX A;  1MV9 A;  2GIU A;  5G3J A;  5DWJ A;  3VTC A;  1DKF A;  1ILG A;  1RDT A;  3W0H A;  3P88 A;  3DCT A;  3DZY A;  5DTV A;  4ZJR A;  4QM0 A;  4MG6 A;  1SR7 A;  3M7R A;  3ADU A;  1LV2 A;  3R8I A;  3G8I A;  3RY9 A;  3E00 A;  3A40 X;  3TKM A;  4IUI A;  5G46 A;  2ZNN A;  4ITE A;  4B7W A;  4ZNT A;  3UU7 B;  3WT6 A;  3B66 A;  4MG9 A;  4OJ4 A;  4MGD B;  2PJL A;  4IW8 A;  1XJ7 A;  4IWF A;  2PIV A;  2PIP L;  5AK2 A;  2ACL B;  3ET3 A;  4OFU A;  2Q3Y A;  2XKW A;  5DWL A;  3V9Y A;  3KDT A;  2YLQ A;  3ET0 A;  5LWP A;  2OAX A;  2ZLC A;  1X78 A;  1FM6 D;  2AMB A;  3EYB A;  1U3R A;  2YLY A;  3AUQ A;  1N46 A;  3LBD A;  4G2I A;  3W0I A;  2P4Y A;  3L3Z A;  5FQT A;  3A78 A;  3WJ5 A;  5I4V A;  1M13 A;  3AUR A;  1ILH A;  1HG4 A;  2GP7 A;  1YMT A;  4IU7 A;  5GID A;  2AB2 A;  4S15 A;  3L1B A;  4UDC A;  1XP6 A;  2E2R A;  2H77 A;  3K22 A;  4UDA A;  2VV1 B;  2OCF A;  1G1U A;  1PDU A;  3KMZ A;  5KCT A;  1XDK B;  2R40 D;  5FQR A;  1EXX A;  3L03 A;  4Q13 A;  4LTW A;  4J24 A;  4XUH A;  3VJT A;  3X36 A;  3D24 A;  3ET1 A;  3IPS A;  3KFC A;  5EC9 A;  3TKC A;  4PLE A;  2HB7 A;  3V3Q A;  3B67 A;  3OSI A;  4S0T A;  4R6S A;  1SQN A;  3KYT A;  2HFP A;  1S19 A;  5DMC A;  1XQC A;  5G5W A;  3TY0 A;  2NXX E;  5AZV A;  4K6I A;  1Z5X E;  1K74 D;  3MNP A;  4E4K A;  1S0Z A;  2B50 A;  1U3S A;  3AZ2 A;  2VV0 A;  3CDS A;  3KMR A;  4KZJ A;  4OEA A;  5KRF A;  3P0U A;  1YOK A;  4XHD A;  1S9Q A;  1PK5 A;  2QH6 A;  5GIE A;  2OM9 A;  3VT8 A;  2J14 A;  3DR1 A;  4ZNV A;  2PKL A;  1XLS E;  5HCV A;  3KMG A;  3HC6 A;  4WHG A;  2VV4 B;  2YLO A;  1DB1 A;  1FM6 A;  5DP0 A;  4MG8 B;  2JJ3 A;  1RJK A;  1U9E A;  3OZJ A;  1NAX A;  5DKB A;  5DXE A;  3D57 A;  2ZNP A;  4PP5 A;  2ZXN A;  3VN2 A;  2JF9 A;  1ZH7 A;  3VJS A;  5DV6 A;  5KRO A;  3RVF A;  5DXG A;  3GZ9 A;  2XYW A;  3VSP A;  1M7W A;  1PQ9 A;  3BC5 A;  1NHZ A;  2Q1H A;  1GWQ A;  2YJA B;  3X1I A;  3GBK A;  3A2H A;  1PQ6 A;  2YAT A;  1ZEO A;  4RUO X;  4ZO1 X;  4RZE A;  2HAR A;  2I0J A;  1XP1 A;  2Q61 A;  4FN9 A;  1R5K A;  4K4J A;  1T7M A;  3VHW A;  5KCF A;  5DWG A;  1XV9 A;  1K74 A;  4REE A;  4MDD A;  1I38 A;  1X7B A;  4HEE X;  3VHU A;  2PIO A;  3GYU A;  2PIX A;  5JI0 D;  3UVV A;  1ZUC A;  4IVY A;  1S9P A;  4K7A A;  2QZO A;  3H0A D;  3DY6 A;  2ZK6 A;  4UDD A;  2JFA A;  5DZH A;  1RKH A;  2EWP A;  4PXM A;  3OSA A;  2P1U A;  4ZN7 A;  5IXK A;  2W8Y A;  4XAO A;  3BEJ A;  3CS4 A;  1QKM A;  2P7G A;  3AN4 A;  4S14 A;  3O1E A;  4ZNH A;  1ZKY A;  1T74 A;  4OED A;  5JJM B;  1UPW A;  3A3Z X;  3VSO A;  1XNX A;  4ZJW A;  4CI4 A;  5KRK A;  4TV1 A;  5SYZ A;  5DKE A;  4G1Z A;  4FHI A;  4OJ9 A;  4OKB A;  4DM6 A;  5DZI A;  2AA5 A;  5DUE A;  4MG7 A;  5DXR A;  1PRG A;  4N5G A;  5E15 A;  2ZK0 A;  5DZ3 A;  3UP3 A;  1MVC A;  4PPP A;  1L2J A;  1SKX A;  4ZNS A;  4M8H A;  4R2U A;  2B1Z A;  2ZBS A;  2QA6 A;  3OKI A;  3PCU A;  1NAV A;  1H9U A;  5E7V A;  2I4J A;  1YIM A;  3ILZ A;  2ZNO A;  5E14 A;  2NPA A;  1XIU A;  3WT5 A;  1YOW A;  2ZMJ A;  3AN3 A;  4IA3 A;  2FVJ A;  3W5P A;  2ABI A;  3OS8 C;  5DWI A;  5G43 A;  5DMF A;  5G44 A;  1XPC A;  1NRL A;  4OZR E;  4E4Q A;  3OMQ A;  3VT5 A;  2BJ4 A;  3D90 A;  4TUZ A;  4CSJ A;  4XTA A;  5DIG A;  5KD9 A;  3DZU D;  2QA8 A;  3WWR A;  4J5X A;  2QPY A;  3OMK A;  4IV4 A;  2FSZ A;  1XAP A;  3G9E A;  2POB A;  5DL4 A;  2V0V A;  1UHL B;  3ZRB A;  3A9E B;  5E1C A;  2GPU A;  3R5N A;  3GWS X;  1VJB A;  2O4J A;  4MGA B;  2ZK1 A;  1XOW A;  3FEI A;  3PO9 A;  5DUG A;  3ET2 A;  4QJR A;  5DVV A;  3OMO A;  3V9T A;  2AX6 A;  3VRT A;  2PIU A;  3WFF A;  4ZNW A;  2IOK A;  2Q59 A;  4POJ A;  2HC4 A;  1PCG A;  3W0Y A;  3B0Q A;  2QMV A;  3MNO A;  5KYA A;  4NB6 A;  4UDB A;  2REW A;  1I7I A;  4N73 A;  5DXP A;  1ZAF A;  5DV3 A;  4IA7 A;  1R1K A;  3G0W A;  4OIU A;  1XVP A;  1YY4 A;  4PP3 A;  2J7X A;  5ICK A;  2Q6S A;  5DLR A;  4A4V A;  3CLD A;  2AAX A;  4OKT A;  2JFA B;  3UUC A;  2VV2 A;  4L98 A;  3UUD A;  1R20 D;  3ZQT A;  4DQM A;  2GPV A;  3A2J A;  2G0G A;  3B3K A;  5EHJ A;  1GWR A;  3W0A A;  4IQR A;  1T7T A;  4J5W C;  4RMC A;  1Y9R A;  1ZDT A;  4OAR A;  1X76 A;  4ZN9 A;  3OMM A;  5L7G A;  3V49 A;  4OKW A;  2P1V A;  4LBD A;  3B0R A;  4FGY A;  3DT3 A;  2AX8 A;  2ZY0 A;  5IAW A;  5KCE A;  1A52 A;  1ERR A;  3D6D A;  2P1T A;  3CS8 A;  1TXI A;  4G1D A;  4MG7 B;  4Y29 A;  3FAL A;  2PIR A;  3WJ4 A;  5FQV A;  2Q7L A;  2ZK5 A;  4QL8 A;  3R2A A;  5ACC A;  3TX7 B;  1XP9 A;  1OVL A;  3N00 A;  3U9Q A;  1FM9 D;  4CI5 A;  4YNK A;  5M96 A;  3FUR A;  2HAS A;  4OZT E;  2AX7 A;  2AA2 A;  1N83 A;  2HBH A;  3ERT A;  2AM9 A;  4O8F A;  1FCX A;  3ZR7 A;  1T65 A;  5KCU A;  3R29 A;  3IPQ A;  3V3E A;  3CWD A;  3WT7 A;  2R40 A;  3W0C A;  1NQ2 A;  3AX8 A;  1Z95 A;  3UUA A;  1DKF B;  1XQ3 A;  3L0J A;  4A2J A;  5APK A;  3W0J A;  2BJ4 B;  1EXA A;  3VI8 A;  1Q4X A;  1G5Y A;  2R6W A;  3GYT A;  3L3X A;  4IS8 A;  5HYR A;  3F5C A;  3IXP D;  5KCD A;  1QKT A;  2GWX A;  4OH6 A;  2Q7K A;  4QE8 A;  5L7E A;  2P7A A;  3ADX A;  4XUM A;  3AUN A;  5LGA A;  3B0W A;  1PQC A;  3VJH A;  4FNE A;  2QAB A;  2VSR A;  3GN8 A;  2AO6 A;  3MNE A;  4MG9 B;  4WLB A;  3NOA A;  5A86 A;  1K4W A;  3UU7 A;  2J7Y A;  2QR9 A;  1XZX X;  3Q95 A;  3IPU A;  4MGD A;  5AAU A;  2VST A;  2GL8 A;  2ACL A;  4JYH A;  5B41 A;  2VV3 A;  4ZO1 B;  2Q59 B;  2ZLA A;  5DKS A;  1OT7 A;  2B23 A;  2PRG A;  5DKG A;  3WMH A;  1HJ1 A;  3F7D A;  5L11 A;  2ZL9 A;  4PVU A;  2HB8 A;  2QXM A;  1FM9 A;  5DXK A;  1FCZ A;  4OK1 A;  3RUU A;  1M2Z A;  2QW4 A;  3KWY A;  2P54 A;  4IW6 A;  4QK4 A;  3E7C A;  2AXA A;  2Q6J A;  2ZKC A;  3H52 A;  3T03 A;  5IZ0 A;  1Z5X U;  2VV1 A;  5GT4 A;  3VRW A;  1XDK A;  4DM8 A;  3FC6 A;  2F4B A;  1QKN A;  5FQP A;  5C4S A;  4E2J A;  3OS9 A;  4REF A;  3UP0 A;  4POH A;  2FAI A;  1OSV A;  4WQP A;  3OGT A;  1FD0 A;  5DZ1 A;  2ZAS A;  3DZY D;  3FLI A;  4R06 A;  2ZVT A;  3R5M A;  4X1G A;  3V9V A;  2B1V A;  2PIN A;  1R6G A;  3HC5 A;  2V7C A;  2ZMH A;  4JYG A;  5DYD A;  2I4Z A;  2P7Z A;  4OEZ A;  5DRJ A;  2Q6R A;  4G20 A;  1T7R A;  2HVC A;  3H0A A;  5AAV A;  1RK3 A;  3AZ3 A;  1T76 A;  5DXB A;  2P15 A;  2Z4B A;  3VT3 A;  3CS6 A;  1SJ0 A;  4PPS A;  2J4A A;  1YA3 A;  5DVS A;  4KZM A;  2YLP A;  2VV4 A;  4HLW A;  5E0W A;  5AZT A;  3RLJ A;  3VT4 A;  1T73 A;  2GTK A;  3P8X A;  4MG8 A;  3RUT A;  1QKU A;  4MGC A;  4WPF A;  4RZG A;  2AA6 A;  4N1Y A;  3VRV A;  2QTU A;  1ZDU A;  5C4O A;  3W5R A;  5E19 A;  2PIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...