2AX6A

Crystal structure of the androgen receptor ligand binding domain t877a mutant in complex with hydroxyflutamide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
247
structure length
242
Chain Sequence
PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIAPTSCSRRFYQLTKLLDSVQPIARELHQFAFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Accommodation of Nonsteroidal Ligands in the Androgen Receptor
pubmed doi rcsb
molecule keywords Androgen receptor
molecule tags Transcription
source organism Homo sapiens
total genus 98
structure length 242
sequence length 247
ec nomenclature
pdb deposition date 2005-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2ax6A00
3B5RA 4XTAA 2BJ4B 3GBKA 2Z4JA 5DV3A 5EC9A 3OSAA 4MGDB 2ZMIA 4TUZB 3WJ5A 2QPYA 1LV2A 2NW4A 1OSVA 4MGBB 3CTBA 2LBDA 1XV9A 2PIPL 2I0JA 2YLQA 3GYUA 1ILHA 4IW6A 3VRUA 2QXMA 1I38A 2Q8SA 1GWXA 4O8FA 3OS9A 1PCGA 4KZJA 3IXPD 3PLZA 4OZTU 3W0AA 3RUUA 5HYRA 3E7CA 4J26A 3G8IA 1DKFB 1T79A 1UPWA 2HCDA 4RZEA 1GS4A 2AMAA 5ETHA 2PITA 5KCWA 3BQDA 3H0AD 3WT6A 4DK8A 2QXSA 2YJAB 5KRIA 2J7XA 3DCUA 3DT3A 1X76A 1K7LA 1H9UA 3ADVA 4OILA 4E4KA 2W8YA 4IV2A 1NQ1A 4J24A 1LBDA 3W0YA 3QT0A 1PQ9A 1XP9A 3D90A 4OH6A 1S0XA 2XYWA 1FCYA 1YMTA 4IWFA 2YLYA 3R5NA 5AAVB 5EHJA 2P54A 2VV0A 2AA6A 3RVFA 3HZFA 1G2NA 2Q6SA 3R8AA 4XLDA 1ZAFA 5AAVA 1DB1A 4RE8A 4J5XA 2JFAB 5DWGA 2ZNOA 4PLDA 2J7YA 2AX9A 2ZK3A 3OLLA 1ZDTA 4OARA 3VT6A 1S0ZA 2ZXZA 5DKBA 2PIQA 1PK5A 2B23A 1XNXA 1ZEOA 3ADUA 5LGAA 3KBAA 3TKMA 3E00A 3V3QA 4OLMA 4IVYA 3BEJA 5EI1A 4DK7A 2Z4BA 5F9BA 3OSWA 5A86A 5KCUA 4MG5A 1L2JA 2B1VA 2HAMA 2ACLA 2AWHA 4LNWA 4K6IA 5DTVA 3V4AA 1R20D 3HLVA 4QL8A 5ICKA 3K22A 1T74A 4ONIA 2Q7LA 3FC6B 4G2HA 4Q0AC 2P7GA 1OVLB 2G5OA 3ADTA 3WT5A 3FC6A 2G44A 1OVLA 2AA5A 3FALB 2QH6A 4PWLA 2IHQA 5DVVA 2ZK1A 5DXRA 4OFRA 3FALA 5DZ3A 1NQ7A 5KCTA 3D6DA 3KDTA 2ABIA 1HJ1A 2JF9A 3A9EA 4JYGA 3PO9A 4M8EA 4XAOA 4DORA 2AO6A 2GTKA 5KRHA 3WT7A 5EITA 2ZY0A 3D24A 1YUCA 3FURA 2B50A 3AZ2A 3VSOA 3VT4A 4EM9A 5H1EA 1XAPA 2VV4B 3ZR7A 4OK1A 1NUOA 1YINA 4YNKA 2H79A 3ET0A 2PINA 2VV4A 3X36A 5APJA 4POJA 4OEZA 5DXMA 3WJ4A 5KR9A 2I0GA 2ZLAA 5DY8A 1YA3A 2GPOA 2ATHA 4RFWA 2PIXA 3IMYA 4RUJA 5DK9A 3S9SA 2OAXA 1Z95A 4S0SA 5SYZA 5KROA 1XDKA 4K7AA 5G3JA 1XVPB 3H52A 3KPZA 5DXBB 5AYGA 4CSJA 3A78A 5DXQA 3B3KA 3CS6A 5DXBA 4OH5A 1FM9D 1YY4A 4PRGA 3RY9A 4PXMA 5KCCA 2PRGA 2H77A 4J5WA 3W5RA 1ZGYA 1GWRA 4MGAB 1M2ZA 5AAUA 1NQ2A 1NQ0A 3JZBA 4OJ4A 3FXVA 4N1YA 5G43A 1WM0X 2ZNQA 1I7IA 3B68A 3UUAB 5E0WA 5GT4A 3UUAA 4N8RA 3ZRAA 4CI5A 5DMCA 3X1IA 2GPVA 4ZNTA 4ZNUA 2QE4A 5KCEA 3N00A 1M7WA 1UHLA 1Y0XX 3HO0A 2XYXA 1E3KA 1EREA 2VSTA 3GWSX 4N73A 5M96A 2PIUA 4Q50A 1PDUA 2HVCA 5DV6A 3OKIA 3UUCA 4XI3A 1QKNA 1S19A 4G20A 5APHA 2VV1B 5L7HA 3TX7B 2PJLA 2GWXA 3FEJA 2GP7A 4S14A 5AVIA 4DQMA 2OVHA 2R40D 3ADWA 3B65A 3UUDB 3B67A 4IA3A 3L03A 5DKGA 5KRLA 1R5KA 3OLFA 3R2AA 1X7EA 3VSPA 1FD0A 3W5PA 3ERTA 2IOGA 3AN4A 3LBDA 1T76A 2HB8A 5KD9A 3D57A 3ET3A 5DXGA 1ILGA 5DYDA 3V3EA 1U3RA 3OMPA 1XP6A 3NSPA 5KRMA 3V9YA 3R5MA 1P8DA 4EMAA 3X1HA 1OT7A 3HM1A 3MNPA 3DZUA 3G0WA 4WHFA 5DWIA 4YPQA 5K13A 1T7RA 1YOKA 2ZKCA 4HLWA 2BJ4A 4WHGA 2EWPA 2QR9A 3AUNA 1XIUA 3P8XA 3D5FA 4LBDA 4IA2A 4MGDA 4TUZA 5G45A 1R20A 1FBYA 4MGBA 2ZL9A 4DM6A 3OGTA 2AMBA 3OS8A 5G44A 4PP3A 1S9PA 1FM6A 1X7RA 3IA6A 4ITFA 4E2JA 4L98A 2Q59B 3VT5A 5DLRA 1DKFA 3GD2A 2PIRA 4J5XC 2Q1HA 1QKTA 2Q59A 1HG4A 4OGHA 1KKQA 1T7FA 5E1CA 5E14A 1R6GA 2PIOA 1S9QA 3A2HA 2QGTA 3K8SA 1T7TA 3B0RA 3PEQA 5GIEA 4XUHA 3CJWA 5HCVA 5DIGA 2Q5SA 5KCDA 5IAWA 5LWPA 4UDDA 1A28A 1T65A 3WFGA 3HODA 4G2IA 4NQAB 2ZNPA 2JFAA 4RAKA 2QA6A 4P6XA 4G1ZA 2AX8A 2NV7A 4KZMA 4S15A 4OZRE 3OSIA 2NPAA 2Q3YA 4OKWA 4PP6A 3UP3A 4ZO1X 4LSJA 3DZUD 4UDBA 3VN2A 1K4WA 3FEIA 5DKEA 2Q60A 2ZXMA 1FM9A 2PKLA 2IOKA 4ZNWA 1T7MA 4WVDA 4QE8A 1VJBA 3X31A 1PRGA 4NUFA 2QA8B 2REWA 1NAXA 1TXIA 5C4SA 2ZMJA 2GL8A 2ZXNA 3R8DA 5EGVA 4FHHA 4YMQA 1N46A 2ZVTA 4RZGA 4WLBA 4X1GA 3L1BA 5DVCA 3VJHA 4IW8A 4QE6A 1FM6D 1KV6A 4CI4A 2HWRA 1NAVA 3CS8A 3VT9A 3ADSA 4R2UA 4NY9A 3W0CA 4DOSA 3A40X 4JGVA 3W5QA 3GZ9A 4FHIA 3ZRBA 2POBA 2BAWA 1GWQA 1YJEA 4XHDA 3T03A 1ERRA 1U9EA 2Q5GA 1T63A 4MDDA 1YIMA 1A52A 2YATA 5DWEA 3VT7A 3F5CB 5G46A 1YYEA 3F5CA 2F4BA 3A3ZX 2R40A 1E3GA 3AZ1A 1SJ0A 3KDUA 2HWQA 2QW4A 2OUZA 3L0JA 5DMFA 4APUA 4MGCA 1RK3A 5DKSA 4G21A 3VTDA 4J5WC 2ZLCA 4XT9A 5AWJA 4PF3A 4DMAA 5C4OA 4KZIA 4QM0A 5AZTA 2A3IA 4IWCA 3DZYA 1PZLA 5DRMA 5FQSA 4OKTA 3GWXA 1XOWA 1NRLA 3VHUA 4PPPA 1XVPA 1G5YA 5L7GA 2ZK6A 1XP1A 5DUEA 3ILZA 4OC7A 1SQNA 3RLJA 3PCUA 3V49A 5KCFA 3WTQA 5C4UA 1RDTD 4PVUA 1X78A 5FQPA 4MGAA 3UVVB 3VJTA 5HYKA 5L11A 2AA2A 2YJDA 2QZOB 3VRVA 1XZXX 3ERDA 2B1ZA 3OZJA 5DX3B 4ZN7A 1Z5XE 2QZOA 2ZNNA 4LNXA 3VRTA 3OMKA 1NYXA 1PQCA 2O4RA 4REFA 2O9IA 3VTCA 2P15A 5FQTA 2YLPA 2AA7A 3F7DA 1QKMA 3AN3A 3WGPA 1L2IA 5JI0D 4P6WA 3HC6A 2VV1A 5JJMB 3ZQTA 5DV8A 1G50A 3W0JA 2O4JA 5DSHA 3UUDA 4POHA 3VHVA 1R1KD 2Q5PA 3CDSA 3L0EA 3V9TA 4MG8B 4OZTE 3R29A 4K4JA 4MG6A 3ET1A 3DZYD 1XQ3A 3L0LA 4REEA 5DUGA 3B0WA 3KWYA 3OOFA 5DXEA 2FSZA 3PRGA 5EJVA 3OS8C 4G1YA 3L3ZA 2I4PA 1I7GA 2NXXE 3JZCA 3PBAA 2GPPA 2HBHA 1XLSE 3UP0A 2QABA 5DVSA 4ZNHA 2V0VA 2Q1VA 4XUMA 1YP0A 1XB7A 3MNEA 2Q7IA 4A4WA 1T73A 5KYJA 1XPCA 4OHAA 1K74A 3B0QA 3W0IA 4YT1A 2AX7A 3RLLA 5AZVA 1RKHA 3VRWA 5I4VA 3CQVA 3DY6A 2PIWA 3OKHA 4OKXA 5DZ1A 1EXAA 1Z5XU 4X1FA 3WFFA 4A2JA 2J14A 4PLEA 5HJSA 4R06A 1MZNA 1QKUA 4BCRA 4OFUA 4OKBA 4RUPA 4OEDA 3O1DA 3K6PA 1U3SA 3L3XA 4IA1A 5DRJA 1N83A 3CLDA 3CWDA 3M7RA 4ZO1B 4IA7A 5G5WA 5GICA 5KRKA 2GPUA 4RZFA 5KRAA 3O1EA 4S0TA 1XNNA 1YOWA 3OOKA 2P1TA 3AUQA 1XV9B 5DZIA 2QMVA 4OIVA 2P7AA 4R6SA 5DXKA 5DL4A 5KYAA 3B66A 3VT8A 1X7JA 4UDCA 3HC5A 5E19A 4ZJRA 2P1VA 5APKA 2OM9A 1IE8A 1FCZA 3LMPA 5C4TA 4ZN9A 3K23A 5DWJA 1N4HA 3A2JA 3SP6A 2P4YA 4OIUA 1UOMA 4B7WA 1FCXA 5AWKA 5DYBA 4RUOX 4E4QA 2I4ZA 2ZASA 4ZI1A 4Y29A 5DUHA 5JY3A 1NHZA 4HEEX 5CJ6A 3TKCA 3W0GA 2VV3A 1K74D 1KNUA 4FGYA 4IUIA 2QGWA 4JAZA 5DXPA 2P1UA 2QA8A 3WMHA 5FQVA 1PQ6A 1RDTA 4IVWA 5FQRA 2Q6RA 2ZBSA 3VJIA 3UU7B 1UPVA 3W5TA 4QJRA 2AM9A 3B0TA 1XJ7A 2POGA 2ZK2A 3UU7A 1XQCA 3NOAA 3HVLA 2AAXA 3CS4A 1SKXA 2ZMHA 2Q7KA 4N5GA 1M13A 4IU7A 4PP5A 2ACLB 2VV2A 3GN8A 4IQRA 1SR7A 5GIDA 1ZDUA 2PNUA 2ZK5A 2ZK0A 3AURA 4QK4A 5DU5A 3W0HA 4DM8A 2HASA 2AX6A 5IZ0A 1ZKYA 1MVCA 2R6WA 4ZJWA 5HJPB 3NSQA 4JL4A 1R1KA 3AFRA 3HQ5A 3A2IA 3ADXA 2AYRA 3KFCA 3OZ0A 3OLSA 2J4AA 1IE9A 4OJBA 4UDAA 4ZNVA 5HJPA 1P93A 2AB2A 2ZK4A 3AZ3A 2OZ7A 5DZ0A 3FUGA 3A9EB 3RUTA 3BC5A 3E94A 2HFPA 2YFEA 1TFCA 4RMCA 2FAIA 3G8OA 4OZRU 5DIEA 2FVJA 4ITEA 2Q7JA 2Q70A 3VHWA 1I37A 2I4JA 1OSHA 2GIUA 2OVMA 3EYBA 2Q61A 4Q13A 4RMDA 1U3QA 2R6YA 3KMRA 1Q4XA 4G1DA 5E7VA 3DR1A 5DI7A 3V9VA 3VT3A 3AX8A 2NXXA 5DIDA 4M8HA 1XLSA 4JYHA 3UVVA 5G42A 2QNVA 1RJKA 3P0UA 4MG9B 4FN9A 1XDKB 5DX3A 3SZ1A 1NDEA 2XKWA 3MNOA 5HZCA 3DCTA 4OEYA 2XHSA 3E00D 4MG9A 5E0XA 4WQPA 3SP9A 3R8IA 5L7EA 4IS8A 1RKGA 3IPQA 4PPSA 4WPFA 5AK2A 3OMMA 1T5ZA 4NB6A 5B5BA 4TV1B 2AXAA 1ZUCA 2ZFXA 4TV1A 4F9MA 4OEAA 3B1MA 5KRJA 2VSRA 5JJMA 3IPUA 2HARA 2QSEA 1MV9A 2V7CA 1EXXA 3TY0A 3G9EA 2OCFA 4JYIA 4MG8A 5KRFA 4A4VA 3IXPA 1ZH7A 1UHLB 3FS1A 5KRCA 3VJSA 3KYTA 3OAPA 3H0AA 4MG7B 1BSXA 5AVLA 4NIEA 5E15A 3VI8A 4ZOMA 4MG7A 2XYJA 3ET2A 1G1UA 2P7ZA 3FLIA 3GYTA 2PIVA 3KMZA 4IV4A 1Y9RA 3Q95B 5IXKA 1X7BA 3CDPA 3IPSA 3P88A 3Q95A 3KMGA 4RWVA 5DP0A 1Y0SA 3VTBA 2QTUA 2YLOA 2G0HA 4L96A 2JJ3A 5ACCA 4OJ9A 4ZNSA 3P89A 3U9QA 3WWRA 3OMOA 4FNEA 2Q6JA 2G0GA 3OMQA 2HC4A 4RMEA 2E2RA 5DZHA 5B41A 2YHDA 4LTWA 2HB7A 5DWLA
chains in the Genus database with same CATH superfamily
3B5RA 4XTAA 2BJ4B 3GBKA 2Z4JA 5DV3A 5EC9A 3OSAA 4MGDB 2ZMIA 4TUZB 3WJ5A 2QPYA 1LV2A 2NW4A 1OSVA 4MGBB 3CTBA 2LBDA 1XV9A 2PIPL 2I0JA 2YLQA 3GYUA 1ILHA 4IW6A 3VRUA 2QXMA 1I38A 2Q8SA 1GWXA 4O8FA 3OS9A 1PCGA 4KZJA 3IXPD 3PLZA 4OZTU 3W0AA 3RUUA 5HYRA 3E7CA 4J26A 3G8IA 1DKFB 1T79A 1UPWA 2HCDA 4RZEA 1GS4A 2AMAA 5ETHA 2PITA 5KCWA 3BQDA 3H0AD 3WT6A 4DK8A 2QXSA 2YJAB 5KRIA 2J7XA 3DCUA 3DT3A 1X76A 1K7LA 1H9UA 3ADVA 4OILA 4E4KA 2W8YA 4IV2A 1NQ1A 4J24A 1LBDA 3W0YA 3QT0A 1PQ9A 1XP9A 3D90A 4OH6A 1S0XA 2XYWA 1FCYA 1YMTA 4IWFA 2YLYA 3R5NA 5AAVB 5EHJA 2P54A 2VV0A 2AA6A 3RVFA 3HZFA 1G2NA 2Q6SA 3R8AA 4XLDA 1ZAFA 5AAVA 1DB1A 4RE8A 4J5XA 2JFAB 5DWGA 2ZNOA 4PLDA 2J7YA 2AX9A 2ZK3A 3OLLA 1ZDTA 4OARA 3VT6A 1S0ZA 2ZXZA 5DKBA 2PIQA 1PK5A 2B23A 1XNXA 1ZEOA 3ADUA 5LGAA 3KBAA 3TKMA 3E00A 3V3QA 4OLMA 4IVYA 3BEJA 5EI1A 4DK7A 2Z4BA 5F9BA 3OSWA 5A86A 5KCUA 4MG5A 1L2JA 2B1VA 2HAMA 2ACLA 2AWHA 4LNWA 4K6IA 5DTVA 3V4AA 1R20D 3HLVA 4QL8A 5ICKA 3K22A 1T74A 4ONIA 2Q7LA 3FC6B 4G2HA 4Q0AC 2P7GA 1OVLB 2G5OA 3ADTA 3WT5A 3FC6A 2G44A 1OVLA 2AA5A 3FALB 2QH6A 4PWLA 2IHQA 5DVVA 2ZK1A 5DXRA 4OFRA 3FALA 5DZ3A 1NQ7A 5KCTA 3D6DA 3KDTA 2ABIA 1HJ1A 2JF9A 3A9EA 4JYGA 3PO9A 4M8EA 4XAOA 4DORA 2AO6A 2GTKA 5KRHA 3WT7A 5EITA 2ZY0A 3D24A 1YUCA 3FURA 2B50A 3AZ2A 3VSOA 3VT4A 4EM9A 5H1EA 1XAPA 2VV4B 3ZR7A 4OK1A 1NUOA 1YINA 4YNKA 2H79A 3ET0A 2PINA 2VV4A 3X36A 5APJA 4POJA 4OEZA 5DXMA 3WJ4A 5KR9A 2I0GA 2ZLAA 5DY8A 1YA3A 2GPOA 2ATHA 4RFWA 2PIXA 3IMYA 4RUJA 5DK9A 3S9SA 2OAXA 1Z95A 4S0SA 5SYZA 5KROA 1XDKA 4K7AA 5G3JA 1XVPB 3H52A 3KPZA 5DXBB 5AYGA 4CSJA 3A78A 5DXQA 3B3KA 3CS6A 5DXBA 4OH5A 1FM9D 1YY4A 4PRGA 3RY9A 4PXMA 5KCCA 2PRGA 2H77A 4J5WA 3W5RA 1ZGYA 1GWRA 4MGAB 1M2ZA 5AAUA 1NQ2A 1NQ0A 3JZBA 4OJ4A 3FXVA 4N1YA 5G43A 1WM0X 2ZNQA 1I7IA 3B68A 3UUAB 5E0WA 5GT4A 3UUAA 4N8RA 3ZRAA 4CI5A 5DMCA 3X1IA 2GPVA 4ZNTA 4ZNUA 2QE4A 5KCEA 3N00A 1M7WA 1UHLA 1Y0XX 3HO0A 2XYXA 1E3KA 1EREA 2VSTA 3GWSX 4N73A 5M96A 2PIUA 4Q50A 1PDUA 2HVCA 5DV6A 3OKIA 3UUCA 4XI3A 1QKNA 1S19A 4G20A 5APHA 2VV1B 5L7HA 3TX7B 2PJLA 2GWXA 3FEJA 2GP7A 4S14A 5AVIA 4DQMA 2OVHA 2R40D 3ADWA 3B65A 3UUDB 3B67A 4IA3A 3L03A 5DKGA 5KRLA 1R5KA 3OLFA 3R2AA 1X7EA 3VSPA 1FD0A 3W5PA 3ERTA 2IOGA 3AN4A 3LBDA 1T76A 2HB8A 5KD9A 3D57A 3ET3A 5DXGA 1ILGA 5DYDA 3V3EA 1U3RA 3OMPA 1XP6A 3NSPA 5KRMA 3V9YA 3R5MA 1P8DA 4EMAA 3X1HA 1OT7A 3HM1A 3MNPA 3DZUA 3G0WA 4WHFA 5DWIA 4YPQA 5K13A 1T7RA 1YOKA 2ZKCA 4HLWA 2BJ4A 4WHGA 2EWPA 2QR9A 3AUNA 1XIUA 3P8XA 3D5FA 4LBDA 4IA2A 4MGDA 4TUZA 5G45A 1R20A 1FBYA 4MGBA 2ZL9A 4DM6A 3OGTA 2AMBA 3OS8A 5G44A 4PP3A 1S9PA 1FM6A 1X7RA 3IA6A 4ITFA 4E2JA 4L98A 2Q59B 3VT5A 5DLRA 1DKFA 3GD2A 2PIRA 4J5XC 2Q1HA 1QKTA 2Q59A 1HG4A 4OGHA 1KKQA 1T7FA 5E1CA 5E14A 1R6GA 2PIOA 1S9QA 3A2HA 2QGTA 3K8SA 1T7TA 3B0RA 3PEQA 5GIEA 4XUHA 3CJWA 5HCVA 5DIGA 2Q5SA 5KCDA 5IAWA 5LWPA 4UDDA 1A28A 1T65A 3WFGA 3HODA 4G2IA 4NQAB 2ZNPA 2JFAA 4RAKA 2QA6A 4P6XA 4G1ZA 2AX8A 2NV7A 4KZMA 4S15A 4OZRE 3OSIA 2NPAA 2Q3YA 4OKWA 4PP6A 3UP3A 4ZO1X 4LSJA 3DZUD 4UDBA 3VN2A 1K4WA 3FEIA 5DKEA 2Q60A 2ZXMA 1FM9A 2PKLA 2IOKA 4ZNWA 1T7MA 4WVDA 4QE8A 1VJBA 3X31A 1PRGA 4NUFA 2QA8B 2REWA 1NAXA 1TXIA 5C4SA 2ZMJA 2GL8A 2ZXNA 3R8DA 5EGVA 4FHHA 4YMQA 1N46A 2ZVTA 4RZGA 4WLBA 4X1GA 3L1BA 5DVCA 3VJHA 4IW8A 4QE6A 1FM6D 1KV6A 4CI4A 2HWRA 1NAVA 3CS8A 3VT9A 3ADSA 4R2UA 4NY9A 3W0CA 4DOSA 3A40X 4JGVA 3W5QA 3GZ9A 4FHIA 3ZRBA 2POBA 2BAWA 1GWQA 1YJEA 4XHDA 3T03A 1ERRA 1U9EA 2Q5GA 1T63A 4MDDA 1YIMA 1A52A 2YATA 5DWEA 3VT7A 3F5CB 5G46A 1YYEA 3F5CA 2F4BA 3A3ZX 2R40A 1E3GA 3AZ1A 1SJ0A 3KDUA 2HWQA 2QW4A 2OUZA 3L0JA 5DMFA 4APUA 4MGCA 1RK3A 5DKSA 4G21A 3VTDA 4J5WC 2ZLCA 4XT9A 5AWJA 4PF3A 4DMAA 5C4OA 4KZIA 4QM0A 5AZTA 2A3IA 4IWCA 3DZYA 1PZLA 5DRMA 5FQSA 4OKTA 3GWXA 1XOWA 1NRLA 3VHUA 4PPPA 1XVPA 1G5YA 5L7GA 2ZK6A 1XP1A 5DUEA 3ILZA 4OC7A 1SQNA 3RLJA 3PCUA 3V49A 5KCFA 3WTQA 5C4UA 1RDTD 4PVUA 1X78A 5FQPA 4MGAA 3UVVB 3VJTA 5HYKA 5L11A 2AA2A 2YJDA 2QZOB 3VRVA 1XZXX 3ERDA 2B1ZA 3OZJA 5DX3B 4ZN7A 1Z5XE 2QZOA 2ZNNA 4LNXA 3VRTA 3OMKA 1NYXA 1PQCA 2O4RA 4REFA 2O9IA 3VTCA 2P15A 5FQTA 2YLPA 2AA7A 3F7DA 1QKMA 3AN3A 3WGPA 1L2IA 5JI0D 4P6WA 3HC6A 2VV1A 5JJMB 3ZQTA 5DV8A 1G50A 3W0JA 2O4JA 5DSHA 3UUDA 4POHA 3VHVA 1R1KD 2Q5PA 3CDSA 3L0EA 3V9TA 4MG8B 4OZTE 3R29A 4K4JA 4MG6A 3ET1A 3DZYD 1XQ3A 3L0LA 4REEA 5DUGA 3B0WA 3KWYA 3OOFA 5DXEA 2FSZA 3PRGA 5EJVA 3OS8C 4G1YA 3L3ZA 2I4PA 1I7GA 2NXXE 3JZCA 3PBAA 2GPPA 2HBHA 1XLSE 3UP0A 2QABA 5DVSA 4ZNHA 2V0VA 2Q1VA 4XUMA 1YP0A 1XB7A 3MNEA 2Q7IA 4A4WA 1T73A 5KYJA 1XPCA 4OHAA 1K74A 3B0QA 3W0IA 4YT1A 2AX7A 3RLLA 5AZVA 1RKHA 3VRWA 5I4VA 3CQVA 3DY6A 2PIWA 3OKHA 4OKXA 5DZ1A 1EXAA 1Z5XU 4X1FA 3WFFA 4A2JA 2J14A 4PLEA 5HJSA 4R06A 1MZNA 1QKUA 4BCRA 4OFUA 4OKBA 4RUPA 4OEDA 3O1DA 3K6PA 1U3SA 3L3XA 4IA1A 5DRJA 1N83A 3CLDA 3CWDA 3M7RA 4ZO1B 4IA7A 5G5WA 5GICA 5KRKA 2GPUA 4RZFA 5KRAA 3O1EA 4S0TA 1XNNA 1YOWA 3OOKA 2P1TA 3AUQA 1XV9B 5DZIA 2QMVA 4OIVA 2P7AA 4R6SA 5DXKA 5DL4A 5KYAA 3B66A 3VT8A 1X7JA 4UDCA 3HC5A 5E19A 4ZJRA 2P1VA 5APKA 2OM9A 1IE8A 1FCZA 3LMPA 5C4TA 4ZN9A 3K23A 5DWJA 1N4HA 3A2JA 3SP6A 2P4YA 4OIUA 1UOMA 4B7WA 1FCXA 5AWKA 5DYBA 4RUOX 4E4QA 2I4ZA 2ZASA 4ZI1A 4Y29A 5DUHA 5JY3A 1NHZA 4HEEX 5CJ6A 3TKCA 3W0GA 2VV3A 1K74D 1KNUA 4FGYA 4IUIA 2QGWA 4JAZA 5DXPA 2P1UA 2QA8A 3WMHA 5FQVA 1PQ6A 1RDTA 4IVWA 5FQRA 2Q6RA 2ZBSA 3VJIA 3UU7B 1UPVA 3W5TA 4QJRA 2AM9A 3B0TA 1XJ7A 2POGA 2ZK2A 3UU7A 1XQCA 3NOAA 3HVLA 2AAXA 3CS4A 1SKXA 2ZMHA 2Q7KA 4N5GA 1M13A 4IU7A 4PP5A 2ACLB 2VV2A 3GN8A 4IQRA 1SR7A 5GIDA 1ZDUA 2PNUA 2ZK5A 2ZK0A 3AURA 4QK4A 5DU5A 3W0HA 4DM8A 2HASA 2AX6A 5IZ0A 1ZKYA 1MVCA 2R6WA 4ZJWA 5HJPB 3NSQA 4JL4A 1R1KA 3AFRA 3HQ5A 3A2IA 3ADXA 2AYRA 3KFCA 3OZ0A 3OLSA 2J4AA 1IE9A 4OJBA 4UDAA 4ZNVA 5HJPA 1P93A 2AB2A 2ZK4A 3AZ3A 2OZ7A 5DZ0A 3FUGA 3A9EB 3RUTA 3BC5A 3E94A 2HFPA 2YFEA 1TFCA 4RMCA 2FAIA 3G8OA 4OZRU 5DIEA 2FVJA 4ITEA 2Q7JA 2Q70A 3VHWA 1I37A 2I4JA 1OSHA 2GIUA 2OVMA 3EYBA 2Q61A 4Q13A 4RMDA 1U3QA 2R6YA 3KMRA 1Q4XA 4G1DA 5E7VA 3DR1A 5DI7A 3V9VA 3VT3A 3AX8A 2NXXA 5DIDA 4M8HA 1XLSA 4JYHA 3UVVA 5G42A 2QNVA 1RJKA 3P0UA 4MG9B 4FN9A 1XDKB 5DX3A 3SZ1A 1NDEA 2XKWA 3MNOA 5HZCA 3DCTA 4OEYA 2XHSA 3E00D 4MG9A 5E0XA 4WQPA 3SP9A 3R8IA 5L7EA 4IS8A 1RKGA 3IPQA 4PPSA 4WPFA 5AK2A 3OMMA 1T5ZA 4NB6A 5B5BA 4TV1B 2AXAA 1ZUCA 2ZFXA 4TV1A 4F9MA 4OEAA 3B1MA 5KRJA 2VSRA 5JJMA 3IPUA 2HARA 2QSEA 1MV9A 2V7CA 1EXXA 3TY0A 3G9EA 2OCFA 4JYIA 4MG8A 5KRFA 4A4VA 3IXPA 1ZH7A 1UHLB 3FS1A 5KRCA 3VJSA 3KYTA 3OAPA 3H0AA 4MG7B 1BSXA 5AVLA 4NIEA 5E15A 3VI8A 4ZOMA 4MG7A 2XYJA 3ET2A 1G1UA 2P7ZA 3FLIA 3GYTA 2PIVA 3KMZA 4IV4A 1Y9RA 3Q95B 5IXKA 1X7BA 3CDPA 3IPSA 3P88A 3Q95A 3KMGA 4RWVA 5DP0A 1Y0SA 3VTBA 2QTUA 2YLOA 2G0HA 4L96A 2JJ3A 5ACCA 4OJ9A 4ZNSA 3P89A 3U9QA 3WWRA 3OMOA 4FNEA 2Q6JA 2G0GA 3OMQA 2HC4A 4RMEA 2E2RA 5DZHA 5B41A 2YHDA 4LTWA 2HB7A 5DWLA
chains in the Genus database with same CATH topology
3B5RA 4XTAA 2BJ4B 3GBKA 2Z4JA 5DV3A 5EC9A 3OSAA 4MGDB 2ZMIA 4TUZB 3WJ5A 2QPYA 1LV2A 2NW4A 1OSVA 4MGBB 3CTBA 2LBDA 1XV9A 2PIPL 2I0JA 2YLQA 3GYUA 1ILHA 4IW6A 3VRUA 2QXMA 1I38A 2Q8SA 1GWXA 4O8FA 3OS9A 1PCGA 4KZJA 3IXPD 3PLZA 4OZTU 3W0AA 3RUUA 5HYRA 3E7CA 4J26A 3G8IA 1DKFB 1T79A 1UPWA 2HCDA 4RZEA 1GS4A 2AMAA 5ETHA 2PITA 5KCWA 3BQDA 3H0AD 3WT6A 4DK8A 2QXSA 2YJAB 5KRIA 2J7XA 3DCUA 3DT3A 1X76A 1K7LA 1H9UA 3ADVA 4OILA 4E4KA 2W8YA 4IV2A 1NQ1A 4J24A 1LBDA 3W0YA 3QT0A 1PQ9A 1XP9A 3D90A 4OH6A 1S0XA 2XYWA 1FCYA 1YMTA 4IWFA 2YLYA 3R5NA 5AAVB 5EHJA 2P54A 2VV0A 2AA6A 3RVFA 3HZFA 1G2NA 2Q6SA 3R8AA 4XLDA 1ZAFA 5AAVA 1DB1A 4RE8A 4J5XA 2JFAB 5DWGA 2ZNOA 4PLDA 2J7YA 2AX9A 2ZK3A 3OLLA 1ZDTA 4OARA 3VT6A 1S0ZA 2ZXZA 5DKBA 2PIQA 1PK5A 2B23A 1XNXA 1ZEOA 3ADUA 5LGAA 3KBAA 3TKMA 3E00A 3V3QA 4OLMA 4IVYA 3BEJA 5EI1A 4DK7A 2Z4BA 5F9BA 3OSWA 5A86A 5KCUA 4MG5A 1L2JA 2B1VA 2HAMA 2ACLA 2AWHA 4LNWA 4K6IA 5DTVA 3V4AA 1R20D 3HLVA 4QL8A 5ICKA 3K22A 1T74A 4ONIA 2Q7LA 3FC6B 4G2HA 4Q0AC 2P7GA 1OVLB 2G5OA 3ADTA 3WT5A 3FC6A 2G44A 1OVLA 2AA5A 3FALB 2QH6A 4PWLA 2IHQA 5DVVA 2ZK1A 5DXRA 4OFRA 3FALA 5DZ3A 1NQ7A 5KCTA 3D6DA 3KDTA 2ABIA 1HJ1A 2JF9A 3A9EA 4JYGA 3PO9A 4M8EA 4XAOA 4DORA 2AO6A 2GTKA 5KRHA 3WT7A 5EITA 2ZY0A 3D24A 1YUCA 3FURA 2B50A 3AZ2A 3VSOA 3VT4A 4EM9A 5H1EA 1XAPA 2VV4B 3ZR7A 4OK1A 1NUOA 1YINA 4YNKA 2H79A 3ET0A 2PINA 2VV4A 3X36A 5APJA 4POJA 4OEZA 5DXMA 3WJ4A 5KR9A 2I0GA 2ZLAA 5DY8A 1YA3A 2GPOA 2ATHA 4RFWA 2PIXA 3IMYA 4RUJA 5DK9A 3S9SA 2OAXA 1Z95A 4S0SA 5SYZA 5KROA 1XDKA 4K7AA 5G3JA 1XVPB 3H52A 3KPZA 5DXBB 5AYGA 4CSJA 3A78A 5DXQA 3B3KA 3CS6A 5DXBA 4OH5A 1FM9D 1YY4A 4PRGA 3RY9A 4PXMA 5KCCA 2PRGA 2H77A 4J5WA 3W5RA 1ZGYA 1GWRA 4MGAB 1M2ZA 5AAUA 1NQ2A 1NQ0A 3JZBA 4OJ4A 3FXVA 4N1YA 5G43A 1WM0X 2ZNQA 1I7IA 3B68A 3UUAB 5E0WA 5GT4A 3UUAA 4N8RA 3ZRAA 4CI5A 5DMCA 3X1IA 2GPVA 4ZNTA 4ZNUA 2QE4A 5KCEA 3N00A 1M7WA 1UHLA 1Y0XX 3HO0A 2XYXA 1E3KA 1EREA 2VSTA 3GWSX 4N73A 5M96A 2PIUA 4Q50A 1PDUA 2HVCA 5DV6A 3OKIA 3UUCA 4XI3A 1QKNA 1S19A 4G20A 5APHA 2VV1B 5L7HA 3TX7B 2PJLA 2GWXA 3FEJA 2GP7A 4S14A 5AVIA 4DQMA 2OVHA 2R40D 3ADWA 3B65A 3UUDB 3B67A 4IA3A 3L03A 5DKGA 5KRLA 1R5KA 3OLFA 3R2AA 1X7EA 3VSPA 1FD0A 3W5PA 3ERTA 2IOGA 3AN4A 3LBDA 1T76A 2HB8A 5KD9A 3D57A 3ET3A 5DXGA 1ILGA 5DYDA 3V3EA 1U3RA 3OMPA 1XP6A 3NSPA 5KRMA 3V9YA 3R5MA 1P8DA 4EMAA 3X1HA 1OT7A 3HM1A 3MNPA 3DZUA 3G0WA 4WHFA 5DWIA 4YPQA 5K13A 1T7RA 1YOKA 2ZKCA 4HLWA 2BJ4A 4WHGA 2EWPA 2QR9A 3AUNA 1XIUA 3P8XA 3D5FA 4LBDA 4IA2A 4MGDA 4TUZA 5G45A 1R20A 1FBYA 4MGBA 2ZL9A 4DM6A 3OGTA 2AMBA 3OS8A 5G44A 4PP3A 1S9PA 1FM6A 1X7RA 3IA6A 4ITFA 4E2JA 4L98A 2Q59B 3VT5A 5DLRA 1DKFA 3GD2A 2PIRA 4J5XC 2Q1HA 1QKTA 2Q59A 1HG4A 4OGHA 1KKQA 1T7FA 5E1CA 5E14A 1R6GA 2PIOA 1S9QA 3A2HA 2QGTA 3K8SA 1T7TA 3B0RA 3PEQA 5GIEA 4XUHA 3CJWA 5HCVA 5DIGA 2Q5SA 5KCDA 5IAWA 5LWPA 4UDDA 1A28A 1T65A 3WFGA 3HODA 4G2IA 4NQAB 2ZNPA 2JFAA 4RAKA 2QA6A 4P6XA 4G1ZA 2AX8A 2NV7A 4KZMA 4S15A 4OZRE 3OSIA 2NPAA 2Q3YA 4OKWA 4PP6A 3UP3A 4ZO1X 4LSJA 3DZUD 4UDBA 3VN2A 1K4WA 3FEIA 5DKEA 2Q60A 2ZXMA 1FM9A 2PKLA 2IOKA 4ZNWA 1T7MA 4WVDA 4QE8A 1VJBA 3X31A 1PRGA 4NUFA 2QA8B 2REWA 1NAXA 1TXIA 5C4SA 2ZMJA 2GL8A 2ZXNA 3R8DA 5EGVA 4FHHA 4YMQA 1N46A 2ZVTA 4RZGA 4WLBA 4X1GA 3L1BA 5DVCA 3VJHA 4IW8A 4QE6A 1FM6D 1KV6A 4CI4A 2HWRA 1NAVA 3CS8A 3VT9A 3ADSA 4R2UA 4NY9A 3W0CA 4DOSA 3A40X 4JGVA 3W5QA 3GZ9A 4FHIA 3ZRBA 2POBA 2BAWA 1GWQA 1YJEA 4XHDA 3T03A 1ERRA 1U9EA 2Q5GA 1T63A 4MDDA 1YIMA 1A52A 2YATA 5DWEA 3VT7A 3F5CB 5G46A 1YYEA 3F5CA 2F4BA 3A3ZX 2R40A 1E3GA 3AZ1A 1SJ0A 3KDUA 2HWQA 2QW4A 2OUZA 3L0JA 5DMFA 4APUA 4MGCA 1RK3A 5DKSA 4G21A 3VTDA 4J5WC 2ZLCA 4XT9A 5AWJA 4PF3A 4DMAA 5C4OA 4KZIA 4QM0A 5AZTA 2A3IA 4IWCA 3DZYA 1PZLA 5DRMA 5FQSA 4OKTA 3GWXA 1XOWA 1NRLA 3VHUA 4PPPA 1XVPA 1G5YA 5L7GA 2ZK6A 1XP1A 5DUEA 3ILZA 4OC7A 1SQNA 3RLJA 3PCUA 3V49A 5KCFA 3WTQA 5C4UA 1RDTD 4PVUA 1X78A 5FQPA 4MGAA 3UVVB 3VJTA 5HYKA 5L11A 2AA2A 2YJDA 2QZOB 3VRVA 1XZXX 3ERDA 2B1ZA 3OZJA 5DX3B 4ZN7A 1Z5XE 2QZOA 2ZNNA 4LNXA 3VRTA 3OMKA 1NYXA 1PQCA 2O4RA 4REFA 2O9IA 3VTCA 2P15A 5FQTA 2YLPA 2AA7A 3F7DA 1QKMA 3AN3A 3WGPA 1L2IA 5JI0D 4P6WA 3HC6A 2VV1A 5JJMB 3ZQTA 5DV8A 1G50A 3W0JA 2O4JA 5DSHA 3UUDA 4POHA 3VHVA 1R1KD 2Q5PA 3CDSA 3L0EA 3V9TA 4MG8B 4OZTE 3R29A 4K4JA 4MG6A 3ET1A 3DZYD 1XQ3A 3L0LA 4REEA 5DUGA 3B0WA 3KWYA 3OOFA 5DXEA 2FSZA 3PRGA 5EJVA 3OS8C 4G1YA 3L3ZA 2I4PA 1I7GA 2NXXE 3JZCA 3PBAA 2GPPA 2HBHA 1XLSE 3UP0A 2QABA 5DVSA 4ZNHA 2V0VA 2Q1VA 4XUMA 1YP0A 1XB7A 3MNEA 2Q7IA 4A4WA 1T73A 5KYJA 1XPCA 4OHAA 1K74A 3B0QA 3W0IA 4YT1A 2AX7A 3RLLA 5AZVA 1RKHA 3VRWA 5I4VA 3CQVA 3DY6A 2PIWA 3OKHA 4OKXA 5DZ1A 1EXAA 1Z5XU 4X1FA 3WFFA 4A2JA 2J14A 4PLEA 5HJSA 4R06A 1MZNA 1QKUA 4BCRA 4OFUA 4OKBA 4RUPA 4OEDA 3O1DA 3K6PA 1U3SA 3L3XA 4IA1A 5DRJA 1N83A 3CLDA 3CWDA 3M7RA 4ZO1B 4IA7A 5G5WA 5GICA 5KRKA 2GPUA 4RZFA 5KRAA 3O1EA 4S0TA 1XNNA 1YOWA 3OOKA 2P1TA 3AUQA 1XV9B 5DZIA 2QMVA 4OIVA 2P7AA 4R6SA 5DXKA 5DL4A 5KYAA 3B66A 3VT8A 1X7JA 4UDCA 3HC5A 5E19A 4ZJRA 2P1VA 5APKA 2OM9A 1IE8A 1FCZA 3LMPA 5C4TA 4ZN9A 3K23A 5DWJA 1N4HA 3A2JA 3SP6A 2P4YA 4OIUA 1UOMA 4B7WA 1FCXA 5AWKA 5DYBA 4RUOX 4E4QA 2I4ZA 2ZASA 4ZI1A 4Y29A 5DUHA 5JY3A 1NHZA 4HEEX 5CJ6A 3TKCA 3W0GA 2VV3A 1K74D 1KNUA 4FGYA 4IUIA 2QGWA 4JAZA 5DXPA 2P1UA 2QA8A 3WMHA 5FQVA 1PQ6A 1RDTA 4IVWA 5FQRA 2Q6RA 2ZBSA 3VJIA 3UU7B 1UPVA 3W5TA 4QJRA 2AM9A 3B0TA 1XJ7A 2POGA 2ZK2A 3UU7A 1XQCA 3NOAA 3HVLA 2AAXA 3CS4A 1SKXA 2ZMHA 2Q7KA 4N5GA 1M13A 4IU7A 4PP5A 2ACLB 2VV2A 3GN8A 4IQRA 1SR7A 5GIDA 1ZDUA 2PNUA 2ZK5A 2ZK0A 3AURA 4QK4A 5DU5A 3W0HA 4DM8A 2HASA 2AX6A 5IZ0A 1ZKYA 1MVCA 2R6WA 4ZJWA 5HJPB 3NSQA 4JL4A 1R1KA 3AFRA 3HQ5A 3A2IA 3ADXA 2AYRA 3KFCA 3OZ0A 3OLSA 2J4AA 1IE9A 4OJBA 4UDAA 4ZNVA 5HJPA 1P93A 2AB2A 2ZK4A 3AZ3A 2OZ7A 5DZ0A 3FUGA 3A9EB 3RUTA 3BC5A 3E94A 2HFPA 2YFEA 1TFCA 4RMCA 2FAIA 3G8OA 4OZRU 5DIEA 2FVJA 4ITEA 2Q7JA 2Q70A 3VHWA 1I37A 2I4JA 1OSHA 2GIUA 2OVMA 3EYBA 2Q61A 4Q13A 4RMDA 1U3QA 2R6YA 3KMRA 1Q4XA 4G1DA 5E7VA 3DR1A 5DI7A 3V9VA 3VT3A 3AX8A 2NXXA 5DIDA 4M8HA 1XLSA 4JYHA 3UVVA 5G42A 2QNVA 1RJKA 3P0UA 4MG9B 4FN9A 1XDKB 5DX3A 3SZ1A 1NDEA 2XKWA 3MNOA 5HZCA 3DCTA 4OEYA 2XHSA 3E00D 4MG9A 5E0XA 4WQPA 3SP9A 3R8IA 5L7EA 4IS8A 1RKGA 3IPQA 4PPSA 4WPFA 5AK2A 3OMMA 1T5ZA 4NB6A 5B5BA 4TV1B 2AXAA 1ZUCA 2ZFXA 4TV1A 4F9MA 4OEAA 3B1MA 5KRJA 2VSRA 5JJMA 3IPUA 2HARA 2QSEA 1MV9A 2V7CA 1EXXA 3TY0A 3G9EA 2OCFA 4JYIA 4MG8A 5KRFA 4A4VA 3IXPA 1ZH7A 1UHLB 3FS1A 5KRCA 3VJSA 3KYTA 3OAPA 3H0AA 4MG7B 1BSXA 5AVLA 4NIEA 5E15A 3VI8A 4ZOMA 4MG7A 2XYJA 3ET2A 1G1UA 2P7ZA 3FLIA 3GYTA 2PIVA 3KMZA 4IV4A 1Y9RA 3Q95B 5IXKA 1X7BA 3CDPA 3IPSA 3P88A 3Q95A 3KMGA 4RWVA 5DP0A 1Y0SA 3VTBA 2QTUA 2YLOA 2G0HA 4L96A 2JJ3A 5ACCA 4OJ9A 4ZNSA 3P89A 3U9QA 3WWRA 3OMOA 4FNEA 2Q6JA 2G0GA 3OMQA 2HC4A 4RMEA 2E2RA 5DZHA 5B41A 2YHDA 4LTWA 2HB7A 5DWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B5R A;  4XTA A;  2BJ4 B;  3GBK A;  2Z4J A;  5DV3 A;  5EC9 A;  3OSA A;  4MGD B;  2ZMI A;  4TUZ B;  3WJ5 A;  2QPY A;  1LV2 A;  2NW4 A;  1OSV A;  4MGB B;  3CTB A;  2LBD A;  1XV9 A;  2PIP L;  2I0J A;  2YLQ A;  3GYU A;  1ILH A;  4IW6 A;  3VRU A;  2QXM A;  1I38 A;  2Q8S A;  1GWX A;  4O8F A;  3OS9 A;  1PCG A;  4KZJ A;  3IXP D;  3PLZ A;  4OZT U;  3W0A A;  3RUU A;  5HYR A;  3E7C A;  4J26 A;  3G8I A;  1DKF B;  1T79 A;  1UPW A;  2HCD A;  4RZE A;  1GS4 A;  2AMA A;  5ETH A;  2PIT A;  5KCW A;  3BQD A;  3H0A D;  3WT6 A;  4DK8 A;  2QXS A;  2YJA B;  5KRI A;  2J7X A;  3DCU A;  3DT3 A;  1X76 A;  1K7L A;  1H9U A;  3ADV A;  4OIL A;  4E4K A;  2W8Y A;  4IV2 A;  1NQ1 A;  4J24 A;  1LBD A;  3W0Y A;  3QT0 A;  1PQ9 A;  1XP9 A;  3D90 A;  4OH6 A;  1S0X A;  2XYW A;  1FCY A;  1YMT A;  4IWF A;  2YLY A;  3R5N A;  5AAV B;  5EHJ A;  2P54 A;  2VV0 A;  2AA6 A;  3RVF A;  3HZF A;  1G2N A;  2Q6S A;  3R8A A;  4XLD A;  1ZAF A;  5AAV A;  1DB1 A;  4RE8 A;  4J5X A;  2JFA B;  5DWG A;  2ZNO A;  4PLD A;  2J7Y A;  2AX9 A;  2ZK3 A;  3OLL A;  1ZDT A;  4OAR A;  3VT6 A;  1S0Z A;  2ZXZ A;  5DKB A;  2PIQ A;  1PK5 A;  2B23 A;  1XNX A;  1ZEO A;  3ADU A;  5LGA A;  3KBA A;  3TKM A;  3E00 A;  3V3Q A;  4OLM A;  4IVY A;  3BEJ A;  5EI1 A;  4DK7 A;  2Z4B A;  5F9B A;  3OSW A;  5A86 A;  5KCU A;  4MG5 A;  1L2J A;  2B1V A;  2HAM A;  2ACL A;  2AWH A;  4LNW A;  4K6I A;  5DTV A;  3V4A A;  1R20 D;  3HLV A;  4QL8 A;  5ICK A;  3K22 A;  1T74 A;  4ONI A;  2Q7L A;  3FC6 B;  4G2H A;  4Q0A C;  2P7G A;  1OVL B;  2G5O A;  3ADT A;  3WT5 A;  3FC6 A;  2G44 A;  1OVL A;  2AA5 A;  3FAL B;  2QH6 A;  4PWL A;  2IHQ A;  5DVV A;  2ZK1 A;  5DXR A;  4OFR A;  3FAL A;  5DZ3 A;  1NQ7 A;  5KCT A;  3D6D A;  3KDT A;  2ABI A;  1HJ1 A;  2JF9 A;  3A9E A;  4JYG A;  3PO9 A;  4M8E A;  4XAO A;  4DOR A;  2AO6 A;  2GTK A;  5KRH A;  3WT7 A;  5EIT A;  2ZY0 A;  3D24 A;  1YUC A;  3FUR A;  2B50 A;  3AZ2 A;  3VSO A;  3VT4 A;  4EM9 A;  5H1E A;  1XAP A;  2VV4 B;  3ZR7 A;  4OK1 A;  1NUO A;  1YIN A;  4YNK A;  2H79 A;  3ET0 A;  2PIN A;  2VV4 A;  3X36 A;  5APJ A;  4POJ A;  4OEZ A;  5DXM A;  3WJ4 A;  5KR9 A;  2I0G A;  2ZLA A;  5DY8 A;  1YA3 A;  2GPO A;  2ATH A;  4RFW A;  2PIX A;  3IMY A;  4RUJ A;  5DK9 A;  3S9S A;  2OAX A;  1Z95 A;  4S0S A;  5SYZ A;  5KRO A;  1XDK A;  4K7A A;  5G3J A;  1XVP B;  3H52 A;  3KPZ A;  5DXB B;  5AYG A;  4CSJ A;  3A78 A;  5DXQ A;  3B3K A;  3CS6 A;  5DXB A;  4OH5 A;  1FM9 D;  1YY4 A;  4PRG A;  3RY9 A;  4PXM A;  5KCC A;  2PRG A;  2H77 A;  4J5W A;  3W5R A;  1ZGY A;  1GWR A;  4MGA B;  1M2Z A;  5AAU A;  1NQ2 A;  1NQ0 A;  3JZB A;  4OJ4 A;  3FXV A;  4N1Y A;  5G43 A;  1WM0 X;  2ZNQ A;  1I7I A;  3B68 A;  3UUA B;  5E0W A;  5GT4 A;  3UUA A;  4N8R A;  3ZRA A;  4CI5 A;  5DMC A;  3X1I A;  2GPV A;  4ZNT A;  4ZNU A;  2QE4 A;  5KCE A;  3N00 A;  1M7W A;  1UHL A;  1Y0X X;  3HO0 A;  2XYX A;  1E3K A;  1ERE A;  2VST A;  3GWS X;  4N73 A;  5M96 A;  2PIU A;  4Q50 A;  1PDU A;  2HVC A;  5DV6 A;  3OKI A;  3UUC A;  4XI3 A;  1QKN A;  1S19 A;  4G20 A;  5APH A;  2VV1 B;  5L7H A;  3TX7 B;  2PJL A;  2GWX A;  3FEJ A;  2GP7 A;  4S14 A;  5AVI A;  4DQM A;  2OVH A;  2R40 D;  3ADW A;  3B65 A;  3UUD B;  3B67 A;  4IA3 A;  3L03 A;  5DKG A;  5KRL A;  1R5K A;  3OLF A;  3R2A A;  1X7E A;  3VSP A;  1FD0 A;  3W5P A;  3ERT A;  2IOG A;  3AN4 A;  3LBD A;  1T76 A;  2HB8 A;  5KD9 A;  3D57 A;  3ET3 A;  5DXG A;  1ILG A;  5DYD A;  3V3E A;  1U3R A;  3OMP A;  1XP6 A;  3NSP A;  5KRM A;  3V9Y A;  3R5M A;  1P8D A;  4EMA A;  3X1H A;  1OT7 A;  3HM1 A;  3MNP A;  3DZU A;  3G0W A;  4WHF A;  5DWI A;  4YPQ A;  5K13 A;  1T7R A;  1YOK A;  2ZKC A;  4HLW A;  2BJ4 A;  4WHG A;  2EWP A;  2QR9 A;  3AUN A;  1XIU A;  3P8X A;  3D5F A;  4LBD A;  4IA2 A;  4MGD A;  4TUZ A;  5G45 A;  1R20 A;  1FBY A;  4MGB A;  2ZL9 A;  4DM6 A;  3OGT A;  2AMB A;  3OS8 A;  5G44 A;  4PP3 A;  1S9P A;  1FM6 A;  1X7R A;  3IA6 A;  4ITF A;  4E2J A;  4L98 A;  2Q59 B;  3VT5 A;  5DLR A;  1DKF A;  3GD2 A;  2PIR A;  4J5X C;  2Q1H A;  1QKT A;  2Q59 A;  1HG4 A;  4OGH A;  1KKQ A;  1T7F A;  5E1C A;  5E14 A;  1R6G A;  2PIO A;  1S9Q A;  3A2H A;  2QGT A;  3K8S A;  1T7T A;  3B0R A;  3PEQ A;  5GIE A;  4XUH A;  3CJW A;  5HCV A;  5DIG A;  2Q5S A;  5KCD A;  5IAW A;  5LWP A;  4UDD A;  1A28 A;  1T65 A;  3WFG A;  3HOD A;  4G2I A;  4NQA B;  2ZNP A;  2JFA A;  4RAK A;  2QA6 A;  4P6X A;  4G1Z A;  2AX8 A;  2NV7 A;  4KZM A;  4S15 A;  4OZR E;  3OSI A;  2NPA A;  2Q3Y A;  4OKW A;  4PP6 A;  3UP3 A;  4ZO1 X;  4LSJ A;  3DZU D;  4UDB A;  3VN2 A;  1K4W A;  3FEI A;  5DKE A;  2Q60 A;  2ZXM A;  1FM9 A;  2PKL A;  2IOK A;  4ZNW A;  1T7M A;  4WVD A;  4QE8 A;  1VJB A;  3X31 A;  1PRG A;  4NUF A;  2QA8 B;  2REW A;  1NAX A;  1TXI A;  5C4S A;  2ZMJ A;  2GL8 A;  2ZXN A;  3R8D A;  5EGV A;  4FHH A;  4YMQ A;  1N46 A;  2ZVT A;  4RZG A;  4WLB A;  4X1G A;  3L1B A;  5DVC A;  3VJH A;  4IW8 A;  4QE6 A;  1FM6 D;  1KV6 A;  4CI4 A;  2HWR A;  1NAV A;  3CS8 A;  3VT9 A;  3ADS A;  4R2U A;  4NY9 A;  3W0C A;  4DOS A;  3A40 X;  4JGV A;  3W5Q A;  3GZ9 A;  4FHI A;  3ZRB A;  2POB A;  2BAW A;  1GWQ A;  1YJE A;  4XHD A;  3T03 A;  1ERR A;  1U9E A;  2Q5G A;  1T63 A;  4MDD A;  1YIM A;  1A52 A;  2YAT A;  5DWE A;  3VT7 A;  3F5C B;  5G46 A;  1YYE A;  3F5C A;  2F4B A;  3A3Z X;  2R40 A;  1E3G A;  3AZ1 A;  1SJ0 A;  3KDU A;  2HWQ A;  2QW4 A;  2OUZ A;  3L0J A;  5DMF A;  4APU A;  4MGC A;  1RK3 A;  5DKS A;  4G21 A;  3VTD A;  4J5W C;  2ZLC A;  4XT9 A;  5AWJ A;  4PF3 A;  4DMA A;  5C4O A;  4KZI A;  4QM0 A;  5AZT A;  2A3I A;  4IWC A;  3DZY A;  1PZL A;  5DRM A;  5FQS A;  4OKT A;  3GWX A;  1XOW A;  1NRL A;  3VHU A;  4PPP A;  1XVP A;  1G5Y A;  5L7G A;  2ZK6 A;  1XP1 A;  5DUE A;  3ILZ A;  4OC7 A;  1SQN A;  3RLJ A;  3PCU A;  3V49 A;  5KCF A;  3WTQ A;  5C4U A;  1RDT D;  4PVU A;  1X78 A;  5FQP A;  4MGA A;  3UVV B;  3VJT A;  5HYK A;  5L11 A;  2AA2 A;  2YJD A;  2QZO B;  3VRV A;  1XZX X;  3ERD A;  2B1Z A;  3OZJ A;  5DX3 B;  4ZN7 A;  1Z5X E;  2QZO A;  2ZNN A;  4LNX A;  3VRT A;  3OMK A;  1NYX A;  1PQC A;  2O4R A;  4REF A;  2O9I A;  3VTC A;  2P15 A;  5FQT A;  2YLP A;  2AA7 A;  3F7D A;  1QKM A;  3AN3 A;  3WGP A;  1L2I A;  5JI0 D;  4P6W A;  3HC6 A;  2VV1 A;  5JJM B;  3ZQT A;  5DV8 A;  1G50 A;  3W0J A;  2O4J A;  5DSH A;  3UUD A;  4POH A;  3VHV A;  1R1K D;  2Q5P A;  3CDS A;  3L0E A;  3V9T A;  4MG8 B;  4OZT E;  3R29 A;  4K4J A;  4MG6 A;  3ET1 A;  3DZY D;  1XQ3 A;  3L0L A;  4REE A;  5DUG A;  3B0W A;  3KWY A;  3OOF A;  5DXE A;  2FSZ A;  3PRG A;  5EJV A;  3OS8 C;  4G1Y A;  3L3Z A;  2I4P A;  1I7G A;  2NXX E;  3JZC A;  3PBA A;  2GPP A;  2HBH A;  1XLS E;  3UP0 A;  2QAB A;  5DVS A;  4ZNH A;  2V0V A;  2Q1V A;  4XUM A;  1YP0 A;  1XB7 A;  3MNE A;  2Q7I A;  4A4W A;  1T73 A;  5KYJ A;  1XPC A;  4OHA A;  1K74 A;  3B0Q A;  3W0I A;  4YT1 A;  2AX7 A;  3RLL A;  5AZV A;  1RKH A;  3VRW A;  5I4V A;  3CQV A;  3DY6 A;  2PIW A;  3OKH A;  4OKX A;  5DZ1 A;  1EXA A;  1Z5X U;  4X1F A;  3WFF A;  4A2J A;  2J14 A;  4PLE A;  5HJS A;  4R06 A;  1MZN A;  1QKU A;  4BCR A;  4OFU A;  4OKB A;  4RUP A;  4OED A;  3O1D A;  3K6P A;  1U3S A;  3L3X A;  4IA1 A;  5DRJ A;  1N83 A;  3CLD A;  3CWD A;  3M7R A;  4ZO1 B;  4IA7 A;  5G5W A;  5GIC A;  5KRK A;  2GPU A;  4RZF A;  5KRA A;  3O1E A;  4S0T A;  1XNN A;  1YOW A;  3OOK A;  2P1T A;  3AUQ A;  1XV9 B;  5DZI A;  2QMV A;  4OIV A;  2P7A A;  4R6S A;  5DXK A;  5DL4 A;  5KYA A;  3B66 A;  3VT8 A;  1X7J A;  4UDC A;  3HC5 A;  5E19 A;  4ZJR A;  2P1V A;  5APK A;  2OM9 A;  1IE8 A;  1FCZ A;  3LMP A;  5C4T A;  4ZN9 A;  3K23 A;  5DWJ A;  1N4H A;  3A2J A;  3SP6 A;  2P4Y A;  4OIU A;  1UOM A;  4B7W A;  1FCX A;  5AWK A;  5DYB A;  4RUO X;  4E4Q A;  2I4Z A;  2ZAS A;  4ZI1 A;  4Y29 A;  5DUH A;  5JY3 A;  1NHZ A;  4HEE X;  5CJ6 A;  3TKC A;  3W0G A;  2VV3 A;  1K74 D;  1KNU A;  4FGY A;  4IUI A;  2QGW A;  4JAZ A;  5DXP A;  2P1U A;  2QA8 A;  3WMH A;  5FQV A;  1PQ6 A;  1RDT A;  4IVW A;  5FQR A;  2Q6R A;  2ZBS A;  3VJI A;  3UU7 B;  1UPV A;  3W5T A;  4QJR A;  2AM9 A;  3B0T A;  1XJ7 A;  2POG A;  2ZK2 A;  3UU7 A;  1XQC A;  3NOA A;  3HVL A;  2AAX A;  3CS4 A;  1SKX A;  2ZMH A;  2Q7K A;  4N5G A;  1M13 A;  4IU7 A;  4PP5 A;  2ACL B;  2VV2 A;  3GN8 A;  4IQR A;  1SR7 A;  5GID A;  1ZDU A;  2PNU A;  2ZK5 A;  2ZK0 A;  3AUR A;  4QK4 A;  5DU5 A;  3W0H A;  4DM8 A;  2HAS A;  2AX6 A;  5IZ0 A;  1ZKY A;  1MVC A;  2R6W A;  4ZJW A;  5HJP B;  3NSQ A;  4JL4 A;  1R1K A;  3AFR A;  3HQ5 A;  3A2I A;  3ADX A;  2AYR A;  3KFC A;  3OZ0 A;  3OLS A;  2J4A A;  1IE9 A;  4OJB A;  4UDA A;  4ZNV A;  5HJP A;  1P93 A;  2AB2 A;  2ZK4 A;  3AZ3 A;  2OZ7 A;  5DZ0 A;  3FUG A;  3A9E B;  3RUT A;  3BC5 A;  3E94 A;  2HFP A;  2YFE A;  1TFC A;  4RMC A;  2FAI A;  3G8O A;  4OZR U;  5DIE A;  2FVJ A;  4ITE A;  2Q7J A;  2Q70 A;  3VHW A;  1I37 A;  2I4J A;  1OSH A;  2GIU A;  2OVM A;  3EYB A;  2Q61 A;  4Q13 A;  4RMD A;  1U3Q A;  2R6Y A;  3KMR A;  1Q4X A;  4G1D A;  5E7V A;  3DR1 A;  5DI7 A;  3V9V A;  3VT3 A;  3AX8 A;  2NXX A;  5DID A;  4M8H A;  1XLS A;  4JYH A;  3UVV A;  5G42 A;  2QNV A;  1RJK A;  3P0U A;  4MG9 B;  4FN9 A;  1XDK B;  5DX3 A;  3SZ1 A;  1NDE A;  2XKW A;  3MNO A;  5HZC A;  3DCT A;  4OEY A;  2XHS A;  3E00 D;  4MG9 A;  5E0X A;  4WQP A;  3SP9 A;  3R8I A;  5L7E A;  4IS8 A;  1RKG A;  3IPQ A;  4PPS A;  4WPF A;  5AK2 A;  3OMM A;  1T5Z A;  4NB6 A;  5B5B A;  4TV1 B;  2AXA A;  1ZUC A;  2ZFX A;  4TV1 A;  4F9M A;  4OEA A;  3B1M A;  5KRJ A;  2VSR A;  5JJM A;  3IPU A;  2HAR A;  2QSE A;  1MV9 A;  2V7C A;  1EXX A;  3TY0 A;  3G9E A;  2OCF A;  4JYI A;  4MG8 A;  5KRF A;  4A4V A;  3IXP A;  1ZH7 A;  1UHL B;  3FS1 A;  5KRC A;  3VJS A;  3KYT A;  3OAP A;  3H0A A;  4MG7 B;  1BSX A;  5AVL A;  4NIE A;  5E15 A;  3VI8 A;  4ZOM A;  4MG7 A;  2XYJ A;  3ET2 A;  1G1U A;  2P7Z A;  3FLI A;  3GYT A;  2PIV A;  3KMZ A;  4IV4 A;  1Y9R A;  3Q95 B;  5IXK A;  1X7B A;  3CDP A;  3IPS A;  3P88 A;  3Q95 A;  3KMG A;  4RWV A;  5DP0 A;  1Y0S A;  3VTB A;  2QTU A;  2YLO A;  2G0H A;  4L96 A;  2JJ3 A;  5ACC A;  4OJ9 A;  4ZNS A;  3P89 A;  3U9Q A;  3WWR A;  3OMO A;  4FNE A;  2Q6J A;  2G0G A;  3OMQ A;  2HC4 A;  4RME A;  2E2R A;  5DZH A;  5B41 A;  2YHD A;  4LTW A;  2HB7 A;  5DWL A; 
#chains in the Genus database with same CATH topology
 3B5R A;  4XTA A;  2BJ4 B;  3GBK A;  2Z4J A;  5DV3 A;  5EC9 A;  3OSA A;  4MGD B;  2ZMI A;  4TUZ B;  3WJ5 A;  2QPY A;  1LV2 A;  2NW4 A;  1OSV A;  4MGB B;  3CTB A;  2LBD A;  1XV9 A;  2PIP L;  2I0J A;  2YLQ A;  3GYU A;  1ILH A;  4IW6 A;  3VRU A;  2QXM A;  1I38 A;  2Q8S A;  1GWX A;  4O8F A;  3OS9 A;  1PCG A;  4KZJ A;  3IXP D;  3PLZ A;  4OZT U;  3W0A A;  3RUU A;  5HYR A;  3E7C A;  4J26 A;  3G8I A;  1DKF B;  1T79 A;  1UPW A;  2HCD A;  4RZE A;  1GS4 A;  2AMA A;  5ETH A;  2PIT A;  5KCW A;  3BQD A;  3H0A D;  3WT6 A;  4DK8 A;  2QXS A;  2YJA B;  5KRI A;  2J7X A;  3DCU A;  3DT3 A;  1X76 A;  1K7L A;  1H9U A;  3ADV A;  4OIL A;  4E4K A;  2W8Y A;  4IV2 A;  1NQ1 A;  4J24 A;  1LBD A;  3W0Y A;  3QT0 A;  1PQ9 A;  1XP9 A;  3D90 A;  4OH6 A;  1S0X A;  2XYW A;  1FCY A;  1YMT A;  4IWF A;  2YLY A;  3R5N A;  5AAV B;  5EHJ A;  2P54 A;  2VV0 A;  2AA6 A;  3RVF A;  3HZF A;  1G2N A;  2Q6S A;  3R8A A;  4XLD A;  1ZAF A;  5AAV A;  1DB1 A;  4RE8 A;  4J5X A;  2JFA B;  5DWG A;  2ZNO A;  4PLD A;  2J7Y A;  2AX9 A;  2ZK3 A;  3OLL A;  1ZDT A;  4OAR A;  3VT6 A;  1S0Z A;  2ZXZ A;  5DKB A;  2PIQ A;  1PK5 A;  2B23 A;  1XNX A;  1ZEO A;  3ADU A;  5LGA A;  3KBA A;  3TKM A;  3E00 A;  3V3Q A;  4OLM A;  4IVY A;  3BEJ A;  5EI1 A;  4DK7 A;  2Z4B A;  5F9B A;  3OSW A;  5A86 A;  5KCU A;  4MG5 A;  1L2J A;  2B1V A;  2HAM A;  2ACL A;  2AWH A;  4LNW A;  4K6I A;  5DTV A;  3V4A A;  1R20 D;  3HLV A;  4QL8 A;  5ICK A;  3K22 A;  1T74 A;  4ONI A;  2Q7L A;  3FC6 B;  4G2H A;  4Q0A C;  2P7G A;  1OVL B;  2G5O A;  3ADT A;  3WT5 A;  3FC6 A;  2G44 A;  1OVL A;  2AA5 A;  3FAL B;  2QH6 A;  4PWL A;  2IHQ A;  5DVV A;  2ZK1 A;  5DXR A;  4OFR A;  3FAL A;  5DZ3 A;  1NQ7 A;  5KCT A;  3D6D A;  3KDT A;  2ABI A;  1HJ1 A;  2JF9 A;  3A9E A;  4JYG A;  3PO9 A;  4M8E A;  4XAO A;  4DOR A;  2AO6 A;  2GTK A;  5KRH A;  3WT7 A;  5EIT A;  2ZY0 A;  3D24 A;  1YUC A;  3FUR A;  2B50 A;  3AZ2 A;  3VSO A;  3VT4 A;  4EM9 A;  5H1E A;  1XAP A;  2VV4 B;  3ZR7 A;  4OK1 A;  1NUO A;  1YIN A;  4YNK A;  2H79 A;  3ET0 A;  2PIN A;  2VV4 A;  3X36 A;  5APJ A;  4POJ A;  4OEZ A;  5DXM A;  3WJ4 A;  5KR9 A;  2I0G A;  2ZLA A;  5DY8 A;  1YA3 A;  2GPO A;  2ATH A;  4RFW A;  2PIX A;  3IMY A;  4RUJ A;  5DK9 A;  3S9S A;  2OAX A;  1Z95 A;  4S0S A;  5SYZ A;  5KRO A;  1XDK A;  4K7A A;  5G3J A;  1XVP B;  3H52 A;  3KPZ A;  5DXB B;  5AYG A;  4CSJ A;  3A78 A;  5DXQ A;  3B3K A;  3CS6 A;  5DXB A;  4OH5 A;  1FM9 D;  1YY4 A;  4PRG A;  3RY9 A;  4PXM A;  5KCC A;  2PRG A;  2H77 A;  4J5W A;  3W5R A;  1ZGY A;  1GWR A;  4MGA B;  1M2Z A;  5AAU A;  1NQ2 A;  1NQ0 A;  3JZB A;  4OJ4 A;  3FXV A;  4N1Y A;  5G43 A;  1WM0 X;  2ZNQ A;  1I7I A;  3B68 A;  3UUA B;  5E0W A;  5GT4 A;  3UUA A;  4N8R A;  3ZRA A;  4CI5 A;  5DMC A;  3X1I A;  2GPV A;  4ZNT A;  4ZNU A;  2QE4 A;  5KCE A;  3N00 A;  1M7W A;  1UHL A;  1Y0X X;  3HO0 A;  2XYX A;  1E3K A;  1ERE A;  2VST A;  3GWS X;  4N73 A;  5M96 A;  2PIU A;  4Q50 A;  1PDU A;  2HVC A;  5DV6 A;  3OKI A;  3UUC A;  4XI3 A;  1QKN A;  1S19 A;  4G20 A;  5APH A;  2VV1 B;  5L7H A;  3TX7 B;  2PJL A;  2GWX A;  3FEJ A;  2GP7 A;  4S14 A;  5AVI A;  4DQM A;  2OVH A;  2R40 D;  3ADW A;  3B65 A;  3UUD B;  3B67 A;  4IA3 A;  3L03 A;  5DKG A;  5KRL A;  1R5K A;  3OLF A;  3R2A A;  1X7E A;  3VSP A;  1FD0 A;  3W5P A;  3ERT A;  2IOG A;  3AN4 A;  3LBD A;  1T76 A;  2HB8 A;  5KD9 A;  3D57 A;  3ET3 A;  5DXG A;  1ILG A;  5DYD A;  3V3E A;  1U3R A;  3OMP A;  1XP6 A;  3NSP A;  5KRM A;  3V9Y A;  3R5M A;  1P8D A;  4EMA A;  3X1H A;  1OT7 A;  3HM1 A;  3MNP A;  3DZU A;  3G0W A;  4WHF A;  5DWI A;  4YPQ A;  5K13 A;  1T7R A;  1YOK A;  2ZKC A;  4HLW A;  2BJ4 A;  4WHG A;  2EWP A;  2QR9 A;  3AUN A;  1XIU A;  3P8X A;  3D5F A;  4LBD A;  4IA2 A;  4MGD A;  4TUZ A;  5G45 A;  1R20 A;  1FBY A;  4MGB A;  2ZL9 A;  4DM6 A;  3OGT A;  2AMB A;  3OS8 A;  5G44 A;  4PP3 A;  1S9P A;  1FM6 A;  1X7R A;  3IA6 A;  4ITF A;  4E2J A;  4L98 A;  2Q59 B;  3VT5 A;  5DLR A;  1DKF A;  3GD2 A;  2PIR A;  4J5X C;  2Q1H A;  1QKT A;  2Q59 A;  1HG4 A;  4OGH A;  1KKQ A;  1T7F A;  5E1C A;  5E14 A;  1R6G A;  2PIO A;  1S9Q A;  3A2H A;  2QGT A;  3K8S A;  1T7T A;  3B0R A;  3PEQ A;  5GIE A;  4XUH A;  3CJW A;  5HCV A;  5DIG A;  2Q5S A;  5KCD A;  5IAW A;  5LWP A;  4UDD A;  1A28 A;  1T65 A;  3WFG A;  3HOD A;  4G2I A;  4NQA B;  2ZNP A;  2JFA A;  4RAK A;  2QA6 A;  4P6X A;  4G1Z A;  2AX8 A;  2NV7 A;  4KZM A;  4S15 A;  4OZR E;  3OSI A;  2NPA A;  2Q3Y A;  4OKW A;  4PP6 A;  3UP3 A;  4ZO1 X;  4LSJ A;  3DZU D;  4UDB A;  3VN2 A;  1K4W A;  3FEI A;  5DKE A;  2Q60 A;  2ZXM A;  1FM9 A;  2PKL A;  2IOK A;  4ZNW A;  1T7M A;  4WVD A;  4QE8 A;  1VJB A;  3X31 A;  1PRG A;  4NUF A;  2QA8 B;  2REW A;  1NAX A;  1TXI A;  5C4S A;  2ZMJ A;  2GL8 A;  2ZXN A;  3R8D A;  5EGV A;  4FHH A;  4YMQ A;  1N46 A;  2ZVT A;  4RZG A;  4WLB A;  4X1G A;  3L1B A;  5DVC A;  3VJH A;  4IW8 A;  4QE6 A;  1FM6 D;  1KV6 A;  4CI4 A;  2HWR A;  1NAV A;  3CS8 A;  3VT9 A;  3ADS A;  4R2U A;  4NY9 A;  3W0C A;  4DOS A;  3A40 X;  4JGV A;  3W5Q A;  3GZ9 A;  4FHI A;  3ZRB A;  2POB A;  2BAW A;  1GWQ A;  1YJE A;  4XHD A;  3T03 A;  1ERR A;  1U9E A;  2Q5G A;  1T63 A;  4MDD A;  1YIM A;  1A52 A;  2YAT A;  5DWE A;  3VT7 A;  3F5C B;  5G46 A;  1YYE A;  3F5C A;  2F4B A;  3A3Z X;  2R40 A;  1E3G A;  3AZ1 A;  1SJ0 A;  3KDU A;  2HWQ A;  2QW4 A;  2OUZ A;  3L0J A;  5DMF A;  4APU A;  4MGC A;  1RK3 A;  5DKS A;  4G21 A;  3VTD A;  4J5W C;  2ZLC A;  4XT9 A;  5AWJ A;  4PF3 A;  4DMA A;  5C4O A;  4KZI A;  4QM0 A;  5AZT A;  2A3I A;  4IWC A;  3DZY A;  1PZL A;  5DRM A;  5FQS A;  4OKT A;  3GWX A;  1XOW A;  1NRL A;  3VHU A;  4PPP A;  1XVP A;  1G5Y A;  5L7G A;  2ZK6 A;  1XP1 A;  5DUE A;  3ILZ A;  4OC7 A;  1SQN A;  3RLJ A;  3PCU A;  3V49 A;  5KCF A;  3WTQ A;  5C4U A;  1RDT D;  4PVU A;  1X78 A;  5FQP A;  4MGA A;  3UVV B;  3VJT A;  5HYK A;  5L11 A;  2AA2 A;  2YJD A;  2QZO B;  3VRV A;  1XZX X;  3ERD A;  2B1Z A;  3OZJ A;  5DX3 B;  4ZN7 A;  1Z5X E;  2QZO A;  2ZNN A;  4LNX A;  3VRT A;  3OMK A;  1NYX A;  1PQC A;  2O4R A;  4REF A;  2O9I A;  3VTC A;  2P15 A;  5FQT A;  2YLP A;  2AA7 A;  3F7D A;  1QKM A;  3AN3 A;  3WGP A;  1L2I A;  5JI0 D;  4P6W A;  3HC6 A;  2VV1 A;  5JJM B;  3ZQT A;  5DV8 A;  1G50 A;  3W0J A;  2O4J A;  5DSH A;  3UUD A;  4POH A;  3VHV A;  1R1K D;  2Q5P A;  3CDS A;  3L0E A;  3V9T A;  4MG8 B;  4OZT E;  3R29 A;  4K4J A;  4MG6 A;  3ET1 A;  3DZY D;  1XQ3 A;  3L0L A;  4REE A;  5DUG A;  3B0W A;  3KWY A;  3OOF A;  5DXE A;  2FSZ A;  3PRG A;  5EJV A;  3OS8 C;  4G1Y A;  3L3Z A;  2I4P A;  1I7G A;  2NXX E;  3JZC A;  3PBA A;  2GPP A;  2HBH A;  1XLS E;  3UP0 A;  2QAB A;  5DVS A;  4ZNH A;  2V0V A;  2Q1V A;  4XUM A;  1YP0 A;  1XB7 A;  3MNE A;  2Q7I A;  4A4W A;  1T73 A;  5KYJ A;  1XPC A;  4OHA A;  1K74 A;  3B0Q A;  3W0I A;  4YT1 A;  2AX7 A;  3RLL A;  5AZV A;  1RKH A;  3VRW A;  5I4V A;  3CQV A;  3DY6 A;  2PIW A;  3OKH A;  4OKX A;  5DZ1 A;  1EXA A;  1Z5X U;  4X1F A;  3WFF A;  4A2J A;  2J14 A;  4PLE A;  5HJS A;  4R06 A;  1MZN A;  1QKU A;  4BCR A;  4OFU A;  4OKB A;  4RUP A;  4OED A;  3O1D A;  3K6P A;  1U3S A;  3L3X A;  4IA1 A;  5DRJ A;  1N83 A;  3CLD A;  3CWD A;  3M7R A;  4ZO1 B;  4IA7 A;  5G5W A;  5GIC A;  5KRK A;  2GPU A;  4RZF A;  5KRA A;  3O1E A;  4S0T A;  1XNN A;  1YOW A;  3OOK A;  2P1T A;  3AUQ A;  1XV9 B;  5DZI A;  2QMV A;  4OIV A;  2P7A A;  4R6S A;  5DXK A;  5DL4 A;  5KYA A;  3B66 A;  3VT8 A;  1X7J A;  4UDC A;  3HC5 A;  5E19 A;  4ZJR A;  2P1V A;  5APK A;  2OM9 A;  1IE8 A;  1FCZ A;  3LMP A;  5C4T A;  4ZN9 A;  3K23 A;  5DWJ A;  1N4H A;  3A2J A;  3SP6 A;  2P4Y A;  4OIU A;  1UOM A;  4B7W A;  1FCX A;  5AWK A;  5DYB A;  4RUO X;  4E4Q A;  2I4Z A;  2ZAS A;  4ZI1 A;  4Y29 A;  5DUH A;  5JY3 A;  1NHZ A;  4HEE X;  5CJ6 A;  3TKC A;  3W0G A;  2VV3 A;  1K74 D;  1KNU A;  4FGY A;  4IUI A;  2QGW A;  4JAZ A;  5DXP A;  2P1U A;  2QA8 A;  3WMH A;  5FQV A;  1PQ6 A;  1RDT A;  4IVW A;  5FQR A;  2Q6R A;  2ZBS A;  3VJI A;  3UU7 B;  1UPV A;  3W5T A;  4QJR A;  2AM9 A;  3B0T A;  1XJ7 A;  2POG A;  2ZK2 A;  3UU7 A;  1XQC A;  3NOA A;  3HVL A;  2AAX A;  3CS4 A;  1SKX A;  2ZMH A;  2Q7K A;  4N5G A;  1M13 A;  4IU7 A;  4PP5 A;  2ACL B;  2VV2 A;  3GN8 A;  4IQR A;  1SR7 A;  5GID A;  1ZDU A;  2PNU A;  2ZK5 A;  2ZK0 A;  3AUR A;  4QK4 A;  5DU5 A;  3W0H A;  4DM8 A;  2HAS A;  2AX6 A;  5IZ0 A;  1ZKY A;  1MVC A;  2R6W A;  4ZJW A;  5HJP B;  3NSQ A;  4JL4 A;  1R1K A;  3AFR A;  3HQ5 A;  3A2I A;  3ADX A;  2AYR A;  3KFC A;  3OZ0 A;  3OLS A;  2J4A A;  1IE9 A;  4OJB A;  4UDA A;  4ZNV A;  5HJP A;  1P93 A;  2AB2 A;  2ZK4 A;  3AZ3 A;  2OZ7 A;  5DZ0 A;  3FUG A;  3A9E B;  3RUT A;  3BC5 A;  3E94 A;  2HFP A;  2YFE A;  1TFC A;  4RMC A;  2FAI A;  3G8O A;  4OZR U;  5DIE A;  2FVJ A;  4ITE A;  2Q7J A;  2Q70 A;  3VHW A;  1I37 A;  2I4J A;  1OSH A;  2GIU A;  2OVM A;  3EYB A;  2Q61 A;  4Q13 A;  4RMD A;  1U3Q A;  2R6Y A;  3KMR A;  1Q4X A;  4G1D A;  5E7V A;  3DR1 A;  5DI7 A;  3V9V A;  3VT3 A;  3AX8 A;  2NXX A;  5DID A;  4M8H A;  1XLS A;  4JYH A;  3UVV A;  5G42 A;  2QNV A;  1RJK A;  3P0U A;  4MG9 B;  4FN9 A;  1XDK B;  5DX3 A;  3SZ1 A;  1NDE A;  2XKW A;  3MNO A;  5HZC A;  3DCT A;  4OEY A;  2XHS A;  3E00 D;  4MG9 A;  5E0X A;  4WQP A;  3SP9 A;  3R8I A;  5L7E A;  4IS8 A;  1RKG A;  3IPQ A;  4PPS A;  4WPF A;  5AK2 A;  3OMM A;  1T5Z A;  4NB6 A;  5B5B A;  4TV1 B;  2AXA A;  1ZUC A;  2ZFX A;  4TV1 A;  4F9M A;  4OEA A;  3B1M A;  5KRJ A;  2VSR A;  5JJM A;  3IPU A;  2HAR A;  2QSE A;  1MV9 A;  2V7C A;  1EXX A;  3TY0 A;  3G9E A;  2OCF A;  4JYI A;  4MG8 A;  5KRF A;  4A4V A;  3IXP A;  1ZH7 A;  1UHL B;  3FS1 A;  5KRC A;  3VJS A;  3KYT A;  3OAP A;  3H0A A;  4MG7 B;  1BSX A;  5AVL A;  4NIE A;  5E15 A;  3VI8 A;  4ZOM A;  4MG7 A;  2XYJ A;  3ET2 A;  1G1U A;  2P7Z A;  3FLI A;  3GYT A;  2PIV A;  3KMZ A;  4IV4 A;  1Y9R A;  3Q95 B;  5IXK A;  1X7B A;  3CDP A;  3IPS A;  3P88 A;  3Q95 A;  3KMG A;  4RWV A;  5DP0 A;  1Y0S A;  3VTB A;  2QTU A;  2YLO A;  2G0H A;  4L96 A;  2JJ3 A;  5ACC A;  4OJ9 A;  4ZNS A;  3P89 A;  3U9Q A;  3WWR A;  3OMO A;  4FNE A;  2Q6J A;  2G0G A;  3OMQ A;  2HC4 A;  4RME A;  2E2R A;  5DZH A;  5B41 A;  2YHD A;  4LTW A;  2HB7 A;  5DWL A; 
#chains in the Genus database with same CATH homology
 3B5R A;  4XTA A;  2BJ4 B;  3GBK A;  2Z4J A;  5DV3 A;  5EC9 A;  3OSA A;  4MGD B;  2ZMI A;  4TUZ B;  3WJ5 A;  2QPY A;  1LV2 A;  2NW4 A;  1OSV A;  4MGB B;  3CTB A;  2LBD A;  1XV9 A;  2PIP L;  2I0J A;  2YLQ A;  3GYU A;  1ILH A;  4IW6 A;  3VRU A;  2QXM A;  1I38 A;  2Q8S A;  1GWX A;  4O8F A;  3OS9 A;  1PCG A;  4KZJ A;  3IXP D;  3PLZ A;  4OZT U;  3W0A A;  3RUU A;  5HYR A;  3E7C A;  4J26 A;  3G8I A;  1DKF B;  1T79 A;  1UPW A;  2HCD A;  4RZE A;  1GS4 A;  2AMA A;  5ETH A;  2PIT A;  5KCW A;  3BQD A;  3H0A D;  3WT6 A;  4DK8 A;  2QXS A;  2YJA B;  5KRI A;  2J7X A;  3DCU A;  3DT3 A;  1X76 A;  1K7L A;  1H9U A;  3ADV A;  4OIL A;  4E4K A;  2W8Y A;  4IV2 A;  1NQ1 A;  4J24 A;  1LBD A;  3W0Y A;  3QT0 A;  1PQ9 A;  1XP9 A;  3D90 A;  4OH6 A;  1S0X A;  2XYW A;  1FCY A;  1YMT A;  4IWF A;  2YLY A;  3R5N A;  5AAV B;  5EHJ A;  2P54 A;  2VV0 A;  2AA6 A;  3RVF A;  3HZF A;  1G2N A;  2Q6S A;  3R8A A;  4XLD A;  1ZAF A;  5AAV A;  1DB1 A;  4RE8 A;  4J5X A;  2JFA B;  5DWG A;  2ZNO A;  4PLD A;  2J7Y A;  2AX9 A;  2ZK3 A;  3OLL A;  1ZDT A;  4OAR A;  3VT6 A;  1S0Z A;  2ZXZ A;  5DKB A;  2PIQ A;  1PK5 A;  2B23 A;  1XNX A;  1ZEO A;  3ADU A;  5LGA A;  3KBA A;  3TKM A;  3E00 A;  3V3Q A;  4OLM A;  4IVY A;  3BEJ A;  5EI1 A;  4DK7 A;  2Z4B A;  5F9B A;  3OSW A;  5A86 A;  5KCU A;  4MG5 A;  1L2J A;  2B1V A;  2HAM A;  2ACL A;  2AWH A;  4LNW A;  4K6I A;  5DTV A;  3V4A A;  1R20 D;  3HLV A;  4QL8 A;  5ICK A;  3K22 A;  1T74 A;  4ONI A;  2Q7L A;  3FC6 B;  4G2H A;  4Q0A C;  2P7G A;  1OVL B;  2G5O A;  3ADT A;  3WT5 A;  3FC6 A;  2G44 A;  1OVL A;  2AA5 A;  3FAL B;  2QH6 A;  4PWL A;  2IHQ A;  5DVV A;  2ZK1 A;  5DXR A;  4OFR A;  3FAL A;  5DZ3 A;  1NQ7 A;  5KCT A;  3D6D A;  3KDT A;  2ABI A;  1HJ1 A;  2JF9 A;  3A9E A;  4JYG A;  3PO9 A;  4M8E A;  4XAO A;  4DOR A;  2AO6 A;  2GTK A;  5KRH A;  3WT7 A;  5EIT A;  2ZY0 A;  3D24 A;  1YUC A;  3FUR A;  2B50 A;  3AZ2 A;  3VSO A;  3VT4 A;  4EM9 A;  5H1E A;  1XAP A;  2VV4 B;  3ZR7 A;  4OK1 A;  1NUO A;  1YIN A;  4YNK A;  2H79 A;  3ET0 A;  2PIN A;  2VV4 A;  3X36 A;  5APJ A;  4POJ A;  4OEZ A;  5DXM A;  3WJ4 A;  5KR9 A;  2I0G A;  2ZLA A;  5DY8 A;  1YA3 A;  2GPO A;  2ATH A;  4RFW A;  2PIX A;  3IMY A;  4RUJ A;  5DK9 A;  3S9S A;  2OAX A;  1Z95 A;  4S0S A;  5SYZ A;  5KRO A;  1XDK A;  4K7A A;  5G3J A;  1XVP B;  3H52 A;  3KPZ A;  5DXB B;  5AYG A;  4CSJ A;  3A78 A;  5DXQ A;  3B3K A;  3CS6 A;  5DXB A;  4OH5 A;  1FM9 D;  1YY4 A;  4PRG A;  3RY9 A;  4PXM A;  5KCC A;  2PRG A;  2H77 A;  4J5W A;  3W5R A;  1ZGY A;  1GWR A;  4MGA B;  1M2Z A;  5AAU A;  1NQ2 A;  1NQ0 A;  3JZB A;  4OJ4 A;  3FXV A;  4N1Y A;  5G43 A;  1WM0 X;  2ZNQ A;  1I7I A;  3B68 A;  3UUA B;  5E0W A;  5GT4 A;  3UUA A;  4N8R A;  3ZRA A;  4CI5 A;  5DMC A;  3X1I A;  2GPV A;  4ZNT A;  4ZNU A;  2QE4 A;  5KCE A;  3N00 A;  1M7W A;  1UHL A;  1Y0X X;  3HO0 A;  2XYX A;  1E3K A;  1ERE A;  2VST A;  3GWS X;  4N73 A;  5M96 A;  2PIU A;  4Q50 A;  1PDU A;  2HVC A;  5DV6 A;  3OKI A;  3UUC A;  4XI3 A;  1QKN A;  1S19 A;  4G20 A;  5APH A;  2VV1 B;  5L7H A;  3TX7 B;  2PJL A;  2GWX A;  3FEJ A;  2GP7 A;  4S14 A;  5AVI A;  4DQM A;  2OVH A;  2R40 D;  3ADW A;  3B65 A;  3UUD B;  3B67 A;  4IA3 A;  3L03 A;  5DKG A;  5KRL A;  1R5K A;  3OLF A;  3R2A A;  1X7E A;  3VSP A;  1FD0 A;  3W5P A;  3ERT A;  2IOG A;  3AN4 A;  3LBD A;  1T76 A;  2HB8 A;  5KD9 A;  3D57 A;  3ET3 A;  5DXG A;  1ILG A;  5DYD A;  3V3E A;  1U3R A;  3OMP A;  1XP6 A;  3NSP A;  5KRM A;  3V9Y A;  3R5M A;  1P8D A;  4EMA A;  3X1H A;  1OT7 A;  3HM1 A;  3MNP A;  3DZU A;  3G0W A;  4WHF A;  5DWI A;  4YPQ A;  5K13 A;  1T7R A;  1YOK A;  2ZKC A;  4HLW A;  2BJ4 A;  4WHG A;  2EWP A;  2QR9 A;  3AUN A;  1XIU A;  3P8X A;  3D5F A;  4LBD A;  4IA2 A;  4MGD A;  4TUZ A;  5G45 A;  1R20 A;  1FBY A;  4MGB A;  2ZL9 A;  4DM6 A;  3OGT A;  2AMB A;  3OS8 A;  5G44 A;  4PP3 A;  1S9P A;  1FM6 A;  1X7R A;  3IA6 A;  4ITF A;  4E2J A;  4L98 A;  2Q59 B;  3VT5 A;  5DLR A;  1DKF A;  3GD2 A;  2PIR A;  4J5X C;  2Q1H A;  1QKT A;  2Q59 A;  1HG4 A;  4OGH A;  1KKQ A;  1T7F A;  5E1C A;  5E14 A;  1R6G A;  2PIO A;  1S9Q A;  3A2H A;  2QGT A;  3K8S A;  1T7T A;  3B0R A;  3PEQ A;  5GIE A;  4XUH A;  3CJW A;  5HCV A;  5DIG A;  2Q5S A;  5KCD A;  5IAW A;  5LWP A;  4UDD A;  1A28 A;  1T65 A;  3WFG A;  3HOD A;  4G2I A;  4NQA B;  2ZNP A;  2JFA A;  4RAK A;  2QA6 A;  4P6X A;  4G1Z A;  2AX8 A;  2NV7 A;  4KZM A;  4S15 A;  4OZR E;  3OSI A;  2NPA A;  2Q3Y A;  4OKW A;  4PP6 A;  3UP3 A;  4ZO1 X;  4LSJ A;  3DZU D;  4UDB A;  3VN2 A;  1K4W A;  3FEI A;  5DKE A;  2Q60 A;  2ZXM A;  1FM9 A;  2PKL A;  2IOK A;  4ZNW A;  1T7M A;  4WVD A;  4QE8 A;  1VJB A;  3X31 A;  1PRG A;  4NUF A;  2QA8 B;  2REW A;  1NAX A;  1TXI A;  5C4S A;  2ZMJ A;  2GL8 A;  2ZXN A;  3R8D A;  5EGV A;  4FHH A;  4YMQ A;  1N46 A;  2ZVT A;  4RZG A;  4WLB A;  4X1G A;  3L1B A;  5DVC A;  3VJH A;  4IW8 A;  4QE6 A;  1FM6 D;  1KV6 A;  4CI4 A;  2HWR A;  1NAV A;  3CS8 A;  3VT9 A;  3ADS A;  4R2U A;  4NY9 A;  3W0C A;  4DOS A;  3A40 X;  4JGV A;  3W5Q A;  3GZ9 A;  4FHI A;  3ZRB A;  2POB A;  2BAW A;  1GWQ A;  1YJE A;  4XHD A;  3T03 A;  1ERR A;  1U9E A;  2Q5G A;  1T63 A;  4MDD A;  1YIM A;  1A52 A;  2YAT A;  5DWE A;  3VT7 A;  3F5C B;  5G46 A;  1YYE A;  3F5C A;  2F4B A;  3A3Z X;  2R40 A;  1E3G A;  3AZ1 A;  1SJ0 A;  3KDU A;  2HWQ A;  2QW4 A;  2OUZ A;  3L0J A;  5DMF A;  4APU A;  4MGC A;  1RK3 A;  5DKS A;  4G21 A;  3VTD A;  4J5W C;  2ZLC A;  4XT9 A;  5AWJ A;  4PF3 A;  4DMA A;  5C4O A;  4KZI A;  4QM0 A;  5AZT A;  2A3I A;  4IWC A;  3DZY A;  1PZL A;  5DRM A;  5FQS A;  4OKT A;  3GWX A;  1XOW A;  1NRL A;  3VHU A;  4PPP A;  1XVP A;  1G5Y A;  5L7G A;  2ZK6 A;  1XP1 A;  5DUE A;  3ILZ A;  4OC7 A;  1SQN A;  3RLJ A;  3PCU A;  3V49 A;  5KCF A;  3WTQ A;  5C4U A;  1RDT D;  4PVU A;  1X78 A;  5FQP A;  4MGA A;  3UVV B;  3VJT A;  5HYK A;  5L11 A;  2AA2 A;  2YJD A;  2QZO B;  3VRV A;  1XZX X;  3ERD A;  2B1Z A;  3OZJ A;  5DX3 B;  4ZN7 A;  1Z5X E;  2QZO A;  2ZNN A;  4LNX A;  3VRT A;  3OMK A;  1NYX A;  1PQC A;  2O4R A;  4REF A;  2O9I A;  3VTC A;  2P15 A;  5FQT A;  2YLP A;  2AA7 A;  3F7D A;  1QKM A;  3AN3 A;  3WGP A;  1L2I A;  5JI0 D;  4P6W A;  3HC6 A;  2VV1 A;  5JJM B;  3ZQT A;  5DV8 A;  1G50 A;  3W0J A;  2O4J A;  5DSH A;  3UUD A;  4POH A;  3VHV A;  1R1K D;  2Q5P A;  3CDS A;  3L0E A;  3V9T A;  4MG8 B;  4OZT E;  3R29 A;  4K4J A;  4MG6 A;  3ET1 A;  3DZY D;  1XQ3 A;  3L0L A;  4REE A;  5DUG A;  3B0W A;  3KWY A;  3OOF A;  5DXE A;  2FSZ A;  3PRG A;  5EJV A;  3OS8 C;  4G1Y A;  3L3Z A;  2I4P A;  1I7G A;  2NXX E;  3JZC A;  3PBA A;  2GPP A;  2HBH A;  1XLS E;  3UP0 A;  2QAB A;  5DVS A;  4ZNH A;  2V0V A;  2Q1V A;  4XUM A;  1YP0 A;  1XB7 A;  3MNE A;  2Q7I A;  4A4W A;  1T73 A;  5KYJ A;  1XPC A;  4OHA A;  1K74 A;  3B0Q A;  3W0I A;  4YT1 A;  2AX7 A;  3RLL A;  5AZV A;  1RKH A;  3VRW A;  5I4V A;  3CQV A;  3DY6 A;  2PIW A;  3OKH A;  4OKX A;  5DZ1 A;  1EXA A;  1Z5X U;  4X1F A;  3WFF A;  4A2J A;  2J14 A;  4PLE A;  5HJS A;  4R06 A;  1MZN A;  1QKU A;  4BCR A;  4OFU A;  4OKB A;  4RUP A;  4OED A;  3O1D A;  3K6P A;  1U3S A;  3L3X A;  4IA1 A;  5DRJ A;  1N83 A;  3CLD A;  3CWD A;  3M7R A;  4ZO1 B;  4IA7 A;  5G5W A;  5GIC A;  5KRK A;  2GPU A;  4RZF A;  5KRA A;  3O1E A;  4S0T A;  1XNN A;  1YOW A;  3OOK A;  2P1T A;  3AUQ A;  1XV9 B;  5DZI A;  2QMV A;  4OIV A;  2P7A A;  4R6S A;  5DXK A;  5DL4 A;  5KYA A;  3B66 A;  3VT8 A;  1X7J A;  4UDC A;  3HC5 A;  5E19 A;  4ZJR A;  2P1V A;  5APK A;  2OM9 A;  1IE8 A;  1FCZ A;  3LMP A;  5C4T A;  4ZN9 A;  3K23 A;  5DWJ A;  1N4H A;  3A2J A;  3SP6 A;  2P4Y A;  4OIU A;  1UOM A;  4B7W A;  1FCX A;  5AWK A;  5DYB A;  4RUO X;  4E4Q A;  2I4Z A;  2ZAS A;  4ZI1 A;  4Y29 A;  5DUH A;  5JY3 A;  1NHZ A;  4HEE X;  5CJ6 A;  3TKC A;  3W0G A;  2VV3 A;  1K74 D;  1KNU A;  4FGY A;  4IUI A;  2QGW A;  4JAZ A;  5DXP A;  2P1U A;  2QA8 A;  3WMH A;  5FQV A;  1PQ6 A;  1RDT A;  4IVW A;  5FQR A;  2Q6R A;  2ZBS A;  3VJI A;  3UU7 B;  1UPV A;  3W5T A;  4QJR A;  2AM9 A;  3B0T A;  1XJ7 A;  2POG A;  2ZK2 A;  3UU7 A;  1XQC A;  3NOA A;  3HVL A;  2AAX A;  3CS4 A;  1SKX A;  2ZMH A;  2Q7K A;  4N5G A;  1M13 A;  4IU7 A;  4PP5 A;  2ACL B;  2VV2 A;  3GN8 A;  4IQR A;  1SR7 A;  5GID A;  1ZDU A;  2PNU A;  2ZK5 A;  2ZK0 A;  3AUR A;  4QK4 A;  5DU5 A;  3W0H A;  4DM8 A;  2HAS A;  2AX6 A;  5IZ0 A;  1ZKY A;  1MVC A;  2R6W A;  4ZJW A;  5HJP B;  3NSQ A;  4JL4 A;  1R1K A;  3AFR A;  3HQ5 A;  3A2I A;  3ADX A;  2AYR A;  3KFC A;  3OZ0 A;  3OLS A;  2J4A A;  1IE9 A;  4OJB A;  4UDA A;  4ZNV A;  5HJP A;  1P93 A;  2AB2 A;  2ZK4 A;  3AZ3 A;  2OZ7 A;  5DZ0 A;  3FUG A;  3A9E B;  3RUT A;  3BC5 A;  3E94 A;  2HFP A;  2YFE A;  1TFC A;  4RMC A;  2FAI A;  3G8O A;  4OZR U;  5DIE A;  2FVJ A;  4ITE A;  2Q7J A;  2Q70 A;  3VHW A;  1I37 A;  2I4J A;  1OSH A;  2GIU A;  2OVM A;  3EYB A;  2Q61 A;  4Q13 A;  4RMD A;  1U3Q A;  2R6Y A;  3KMR A;  1Q4X A;  4G1D A;  5E7V A;  3DR1 A;  5DI7 A;  3V9V A;  3VT3 A;  3AX8 A;  2NXX A;  5DID A;  4M8H A;  1XLS A;  4JYH A;  3UVV A;  5G42 A;  2QNV A;  1RJK A;  3P0U A;  4MG9 B;  4FN9 A;  1XDK B;  5DX3 A;  3SZ1 A;  1NDE A;  2XKW A;  3MNO A;  5HZC A;  3DCT A;  4OEY A;  2XHS A;  3E00 D;  4MG9 A;  5E0X A;  4WQP A;  3SP9 A;  3R8I A;  5L7E A;  4IS8 A;  1RKG A;  3IPQ A;  4PPS A;  4WPF A;  5AK2 A;  3OMM A;  1T5Z A;  4NB6 A;  5B5B A;  4TV1 B;  2AXA A;  1ZUC A;  2ZFX A;  4TV1 A;  4F9M A;  4OEA A;  3B1M A;  5KRJ A;  2VSR A;  5JJM A;  3IPU A;  2HAR A;  2QSE A;  1MV9 A;  2V7C A;  1EXX A;  3TY0 A;  3G9E A;  2OCF A;  4JYI A;  4MG8 A;  5KRF A;  4A4V A;  3IXP A;  1ZH7 A;  1UHL B;  3FS1 A;  5KRC A;  3VJS A;  3KYT A;  3OAP A;  3H0A A;  4MG7 B;  1BSX A;  5AVL A;  4NIE A;  5E15 A;  3VI8 A;  4ZOM A;  4MG7 A;  2XYJ A;  3ET2 A;  1G1U A;  2P7Z A;  3FLI A;  3GYT A;  2PIV A;  3KMZ A;  4IV4 A;  1Y9R A;  3Q95 B;  5IXK A;  1X7B A;  3CDP A;  3IPS A;  3P88 A;  3Q95 A;  3KMG A;  4RWV A;  5DP0 A;  1Y0S A;  3VTB A;  2QTU A;  2YLO A;  2G0H A;  4L96 A;  2JJ3 A;  5ACC A;  4OJ9 A;  4ZNS A;  3P89 A;  3U9Q A;  3WWR A;  3OMO A;  4FNE A;  2Q6J A;  2G0G A;  3OMQ A;  2HC4 A;  4RME A;  2E2R A;  5DZH A;  5B41 A;  2YHD A;  4LTW A;  2HB7 A;  5DWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...