2AXAA

Crystal structure of the androgen receptor ligand binding domain in complex with s-1
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
246
structure length
238
Chain Sequence
IFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Accommodation of Nonsteroidal Ligands in the Androgen Receptor
pubmed doi rcsb
molecule keywords Androgen receptor
molecule tags Transcription
source organism Homo sapiens
total genus 95
structure length 238
sequence length 246
ec nomenclature
pdb deposition date 2005-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2axaA00
2P7GA 2OUZA 1DKFB 3PO9A 3IPSA 5LWPA 1X7JA 3DR1A 1MZNA 2ZMHA 3DT3A 2IHQA 3F5CA 1NDEA 1Z5XU 3G9EA 5DKSA 2P54A 1UHLA 2VV4A 5DXPA 3B1MA 3R5NA 5HYRA 5DXGA 2YLPA 3P0UA 3AZ1A 1I7IA 4PXMA 4DM6A 4MGBA 4WPFA 3B66A 3KBAA 3R8AA 5G42A 3JZBA 4MG9B 1XDKA 2QSEA 3B67A 5EGVA 2PIOA 5KCCA 3AZ2A 4XHDA 4YNKA 3V4AA 2PRGA 2AX7A 3QT0A 4OEAA 2Q59A 3ADWA 4O8FA 3ZR7A 4S0TA 3V9VA 3NSQA 5G5WA 5DXKA 5C4TA 3WMHA 5DRJA 3X1HA 5DVSA 5DK9A 5DLRA 3HZFA 4UDAA 2ABIA 3X31A 5APJA 5GIDA 2XYXA 3ZRBA 3TX7B 4FN9A 4OZRU 4RWVA 5KRFA 3ZQTA 4RZGA 2QA6A 3RLLA 4YT1A 3B68A 3VHVA 5B41A 3V3EA 3OLSA 1R20D 3B0WA 5DWLA 1Y9RA 2NW4A 4P6XA 5DWEA 2V0VA 4KZJA 3ADXA 3UUAB 4QE6A 4R6SA 2GPUA 3WWRA 3UUCA 1GS4A 5AYGA 1FM6D 1XZXX 1R1KA 1A52A 2ZXZA 1XB7A 1QKUA 2Q5SA 3IXPD 2ZK0A 4XTAA 5DV3A 4DORA 5GIEA 1PQCA 2ZLCA 4G21A 3OLLA 2I4PA 3D24A 5DUGA 2YLYA 3VT8A 4OEZA 2QZOB 4QE8A 2QABA 2Q5GA 5DKBA 5KRIA 5AWJA 4P6WA 4F9MA 2PKLA 2VV2A 5FQRA 2PIXA 2HWRA 3HVLA 3KDTA 4FHHA 4IUIA 4OJ4A 3MNPA 3VI8A 1S9QA 2B1ZA 2Q7JA 1R5KA 1XLSE 2AO6A 5E7VA 3AURA 3B0TA 1M2ZA 4G20A 1PRGA 2QTUA 1G5YA 1EREA 2GWXA 2POBA 4ZOMA 5B5BA 2FAIA 4OLMA 5KCEA 4OFRA 1KNUA 5FQVA 3TKMA 3VJIA 3IMYA 4RMCA 3E00D 2R40A 4G1ZA 3UP0A 3BC5A 2QR9A 2YLQA 2Q6RA 3CQVA 5EC9A 2PNUA 2Q7IA 3CLDA 5KD9A 2GIUA 1EXXA 5KCDA 3OGTA 3CS8A 4IA3A 1XAPA 4OKBA 5DIDA 2YLOA 2ZL9A 2HASA 1P93A 3DCTA 1NRLA 5HJSA 3KPZA 5DZIA 1N83A 5FQSA 5DZ0A 2HBHA 3DZYA 1XLSA 3LBDA 2G0HA 3DCUA 1XV9B 4K4JA 5DKGA 5APHA 5DXRA 5HYKA 2Q6SA 1UPWA 2ZK5A 4NB6A 2ZNOA 2AA2A 5G44A 5HZCA 1K4WA 4R06A 2NXXA 5DMCA 3VHWA 1RJKA 2BAWA 4XLDA 2ZK6A 4OIVA 4S15A 5EI1A 5KRMA 1U3QA 4MG8A 4IW8A 5KCFA 4QK4A 5DXQA 2HAMA 1X7BA 3UU7A 5A86A 5KRJA 3H52A 1EXAA 3HODA 3RUUA 1UHLB 4PRGA 3V3QA 2VV4B 1GWRA 1YUCA 4CI4A 4IVWA 5DXMA 1U3RA 1U9EA 5JJMA 4MGBB 2ZMJA 3P88A 2IOKA 3FLIA 1FM9D 1RKGA 3OMQA 4RUJA 4JYIA 4UDDA 5KYAA 4PVUA 1XDKB 2PIRA 4ITEA 1YY4A 4NUFA 2AYRA 2OM9A 1T7RA 3P8XA 3L0JA 4FNEA 1GWQA 1SR7A 2Q60A 4OGHA 3LMPA 4IA7A 4OH5A 1SQNA 1ZDUA 5FQPA 1DB1A 1XV9A 2JFAA 2POGA 4RMEA 2ZK3A 5DVVA 1X78A 4OZRE 4MGDA 3GWSX 3Q95B 2AMAA 3B0QA 5KYJA 4ZN9A 3TKCA 1Y0XX 3GZ9A 2QW4A 4IA1A 3UUDB 4IV4A 4XUMA 2P1TA 1LV2A 2G0GA 2H77A 3OMOA 1R6GA 3F7DA 3L3ZA 3OS9A 1XP9A 4K6IA 4QL8A 2AA5A 3ADVA 3AX8A 3FXVA 4UDCA 3WFGA 1KKQA 2ZASA 3AN3A 5AZVA 3O1DA 2QH6A 5L11A 4JL4A 3A2JA 3OSAA 4OJBA 2J14A 4IVYA 3G0WA 3EYBA 5ETHA 3ZRAA 2OVHA 3OZ0A 3DY6A 3OMMA 2HB8A 1XOWA 4UDBA 3K22A 2Q8SA 5APKA 3VSOA 1L2IA 4QJRA 3AUQA 4IW6A 2V7CA 1X7RA 2PITA 2ZMIA 3OAPA 1ZKYA 3DZUD 1S9PA 5IXKA 1MVCA 3D57A 3BEJA 4ZI1A 3PEQA 1XP6A 1I37A 2GL8A 2GPOA 4Y29A 3A2IA 2XYWA 3ADSA 5C4UA 5L7GA 5M96A 2ZKCA 3BQDA 3ET0A 3L3XA 3VJTA 3X36A 3UVVB 4E4KA 3B0RA 2B50A 1T5ZA 3Q95A 5DX3A 3WT6A 3VJSA 3VT3A 3KFCA 3JZCA 4XI3A 1WM0X 3UUDA 2ZNPA 4A4VA 4DMAA 2FVJA 1T65A 5DTVA 4S0SA 5K13A 2ATHA 1I7GA 2Q70A 3B65A 2Q1HA 1T76A 3D5FA 2PIWA 3ERTA 1R20A 4Q0AC 5DZ3A 2YATA 1N46A 3PBAA 3M7RA 2FSZA 3IA6A 4G2HA 4REEA 5E0WA 5DSHA 5L7HA 3OSWA 3W5PA 3OLFA 1NUOA 1ZH7A 3W0IA 1ILHA 2HFPA 3ET2A 1FM6A 3PCUA 3X1IA 2J7XA 4RZEA 3IXPA 3AN4A 2O4JA 1YOWA 1XQ3A 4FGYA 4A2JA 4OEYA 1HJ1A 4ITFA 1OT7A 5DIGA 1RDTD 4TUZA 4RAKA 3UP3A 2Z4JA 4S14A 3HC5A 2JJ3A 4DK7A 1PCGA 5KRLA 3OSIA 3HO0A 3OZJA 4JGVA 4LNWA 3UVVA 3R8DA 5KRKA 2GPVA 4JYHA 1XNNA 4L98A 4TV1A 1QKNA 5ACCA 1GWXA 1VJBA 2G5OA 3S9SA 3ET3A 2YHDA 2AMBA 1YP0A 3WT7A 3WFFA 4MG8B 4DOSA 1S0XA 3L1BA 5AAVA 3CWDA 3UU7B 4REFA 2ZFXA 1K74D 2ZVTA 3CS4A 1HG4A 3K23A 3H0AD 4WHGA 3V9TA 4OFUA 4Q50A 4J5WA 3CTBA 3FALA 3IPQA 3VT4A 1E3GA 4IS8A 4E4QA 5JJMB 3E00A 4G2IA 2ACLA 3AZ3A 3CDSA 2AB2A 2B1VA 4OILA 4FHIA 1PK5A 5EITA 4PP6A 5DP0A 4OARA 4CI5A 1KV6A 1S0ZA 3VJHA 1IE8A 3A9EA 5DZHA 5DRMA 3OMPA 1E3KA 1OVLA 2JFAB 3SP9A 3VTDA 5IZ0A 1YJEA 2PIUA 5LGAA 3RVFA 4MGDB 4WQPA 1NQ7A 2YJAB 5DL4A 2A3IA 4POHA 2GPPA 4XUHA 1NHZA 3A3ZX 3W0AA 4ZJRA 1A28A 3L0LA 3KDUA 4L96A 1P8DA 3GYTA 2F4BA 4IWCA 4KZIA 1XNXA 2OZ7A 4MGAA 2AAXA 2Q7KA 3GWXA 1RKHA 5DYDA 3GN8A 4NIEA 4RUPA 1T73A 1YIMA 5DMFA 2R6YA 2AX9A 2HARA 3KWYA 1UPVA 5F9BA 1T7MA 1NAXA 4OIUA 4PP3A 3VN2A 3R2AA 4MG7A 4PP5A 5SYZA 2XHSA 3VSPA 4J5XA 4ZO1B 2VSRA 2P7ZA 1FM9A 4IWFA 3FEJA 4K7AA 4EMAA 2AA7A 3K8SA 1S19A 2BJ4A 1FCZA 3OMKA 2J7YA 4G1YA 4OH6A 5KRAA 3VT6A 2VV0A 4ZN7A 5E19A 1PQ6A 3VRWA 5DX3B 3WJ4A 4ZNWA 2H79A 2YFEA 3GBKA 1PQ9A 2AX6A 2ZK1A 3VRUA 1FCXA 5JY3A 3R29A 3HM1A 3P89A 4J5WC 4ONIA 1U3SA 3D6DA 3IPUA 4IU7A 3W0GA 2YJDA 3WJ5A 1LBDA 3MNEA 5EHJA 1QKTA 4KZMA 4M8EA 5DU5A 4MDDA 1SKXA 2B23A 2ZNQA 4OZTU 4ZNTA 5KCWA 2I0JA 3ILZA 4JYGA 4APUA 5L7EA 4N5GA 5CJ6A 2EWPA 2LBDA 3CJWA 5AZTA 5E15A 1OSVA 3MNOA 5JI0D 5HJPA 2J4AA 4LNXA 5GICA 5G3JA 2QGWA 4LTWA 4DK8A 4TUZB 1K7LA 3T03A 3VT5A 4EM9A 4XT9A 5KRCA 4BCRA 3KMGA 1ZGYA 2XKWA 3G8IA 2HC4A 1MV9A 3DZUA 1XVPA 5HCVA 1T79A 3ADTA 1X7EA 4TV1B 1ERRA 4DQMA 5AVLA 4WHFA 5G46A 5C4SA 5KROA 3VTCA 2R6WA 4MG5A 3WGPA 2VSTA 5KCUA 2QPYA 3HQ5A 2QE4A 5AAVB 4E2JA 4ZNSA 5DXBA 4POJA 4Q13A 4NY9A 1SJ0A 5DV6A 4JAZA 3FALB 1I38A 1UOMA 2GP7A 4J5XC 3SP6A 4ZO1X 2VV3A 2ACLB 3OOKA 1T74A 2HB7A 1FCYA 2Q5PA 3W5TA 1XJ7A 2AX8A 2NV7A 3W0JA 5DY8A 1T63A 3KMRA 1R1KD 3CS6A 1XIUA 5E0XA 2O9IA 3RY9A 1Z95A 1DKFA 3A9EB 2QXMA 2PINA 3FS1A 1OVLB 2QA8B 2HVCA 2QGTA 1XPCA 4A4WA 2XYJA 3GD2A 1FD0A 4HEEX 2AM9A 1M7WA 1RDTA 3R5MA 4OKXA 4RMDA 1NAVA 1ZUCA 4N8RA 2P7AA 2OVMA 3NOAA 4J24A 1IE9A 3VRVA 5KR9A 2AWHA 2Q6JA 4MG9A 2HWQA 4OJ9A 1YMTA 4WLBA 1TXIA 5DWIA 3B5RA 3VT9A 3AFRA 2NPAA 1XP1A 4MGAB 3D90A 3V49A 2ZXMA 3NSPA 2E2RA 5DYBA 3V9YA 3FC6B 5DV8A 1FBYA 3WT5A 4ZJWA 3VHUA 1YA3A 3R8IA 3B3KA 4QM0A 5AVIA 4HLWA 3VTBA 4OHAA 1ILGA 3FEIA 4PF3A 1K74A 4NQAB 1NQ0A 2R40D 1YINA 3H0AA 1H9UA 2IOGA 3N00A 2JF9A 4G1DA 4MG7B 4PLDA 3PLZA 5DXEA 3E7CA 1OSHA 2Q7LA 3ADUA 2P1VA 3K6PA 3KMZA 3UUAA 4MG6A 4IV2A 5AWKA 2NXXE 3O1EA 4N1YA 2QA8A 1X76A 2AXAA 1QKMA 4PPPA 3U9QA 1NQ1A 2BJ4B 1ZAFA 2QNVA 1BSXA 1TFCA 3A2HA 3A40X 3OS8A 4OK1A 4PWLA 1YOKA 4MGCA 3L03A 3RUTA 3W0YA 1XQCA 2I0GA 3VRTA 2I4JA 5KCTA 3HLVA 1G50A 4IA2A 5DUEA 3DZYD 1G1UA 4RZFA 5H1EA 1RK3A 4R2UA 4RFWA 2VV1B 3E94A 5AK2A 5GT4A 2GTKA 5DVCA 4PPSA 2QZOA 1ZEOA 3PRGA 2W8YA 4LSJA 2ZXNA 1YYEA 5FQTA 2O4RA 2ZNNA 3FC6A 2ZK4A 4WVDA 4OEDA 2P4YA 4YPQA 4ZNUA 5AAUA 4OZTE 4CSJA 2OCFA 2Z4BA 4OKWA 3GYUA 2HCDA 2P15A 2QMVA 4X1GA 5DIEA 4LBDA 3HC6A 4DM8A 5C4OA 5HJPB 2QXSA 1PZLA 5DWJA 2ZBSA 2ZLAA 2ZK2A 1NYXA 3ET1A 2Q61A 3FUGA 5DZ1A 5G43A 3TY0A 4ZNVA 3SZ1A 5DWGA 2REWA 4OC7A 2PIQA 2Q3YA 4B7WA 4ZNHA 3CDPA 3FURA 3L0EA 3F5CB 1XVPB 3G8OA 1ZDTA 5DKEA 1T7TA 1Z5XE 2G44A 2PIVA 3A78A 1Q4XA 5DUHA 5G45A 3KYTA 4IQRA 3WTQA 5E14A 4YMQA 4J26A 5EJVA 4OKTA 4XAOA 2VV1A 5DI7A 3OKHA 2AA6A 5KRHA 3ERDA 1L2JA 2ZY0A 3AUNA 5DXBB 4M8HA 2Q59B 3RLJA 4N73A 3W0HA 1T7FA 3W5RA 4PLEA 2I4ZA 3OOFA 1G2NA 1Y0SA 3VT7A 5IAWA 4RE8A 5ICKA 2PIPL 2Q1VA 1PDUA 2PJLA 4RUOX 4X1FA 3W0CA 3W5QA 1N4HA 1M13A 5I4VA 2OAXA 5E1CA 3OKIA 3OS8C 2P1UA 1NQ2A
chains in the Genus database with same CATH superfamily
2P7GA 2OUZA 1DKFB 3PO9A 3IPSA 5LWPA 1X7JA 3DR1A 1MZNA 2ZMHA 3DT3A 2IHQA 3F5CA 1NDEA 1Z5XU 3G9EA 5DKSA 2P54A 1UHLA 2VV4A 5DXPA 3B1MA 3R5NA 5HYRA 5DXGA 2YLPA 3P0UA 3AZ1A 1I7IA 4PXMA 4DM6A 4MGBA 4WPFA 3B66A 3KBAA 3R8AA 5G42A 3JZBA 4MG9B 1XDKA 2QSEA 3B67A 5EGVA 2PIOA 5KCCA 3AZ2A 4XHDA 4YNKA 3V4AA 2PRGA 2AX7A 3QT0A 4OEAA 2Q59A 3ADWA 4O8FA 3ZR7A 4S0TA 3V9VA 3NSQA 5G5WA 5DXKA 5C4TA 3WMHA 5DRJA 3X1HA 5DVSA 5DK9A 5DLRA 3HZFA 4UDAA 2ABIA 3X31A 5APJA 5GIDA 2XYXA 3ZRBA 3TX7B 4FN9A 4OZRU 4RWVA 5KRFA 3ZQTA 4RZGA 2QA6A 3RLLA 4YT1A 3B68A 3VHVA 5B41A 3V3EA 3OLSA 1R20D 3B0WA 5DWLA 1Y9RA 2NW4A 4P6XA 5DWEA 2V0VA 4KZJA 3ADXA 3UUAB 4QE6A 4R6SA 2GPUA 3WWRA 3UUCA 1GS4A 5AYGA 1FM6D 1XZXX 1R1KA 1A52A 2ZXZA 1XB7A 1QKUA 2Q5SA 3IXPD 2ZK0A 4XTAA 5DV3A 4DORA 5GIEA 1PQCA 2ZLCA 4G21A 3OLLA 2I4PA 3D24A 5DUGA 2YLYA 3VT8A 4OEZA 2QZOB 4QE8A 2QABA 2Q5GA 5DKBA 5KRIA 5AWJA 4P6WA 4F9MA 2PKLA 2VV2A 5FQRA 2PIXA 2HWRA 3HVLA 3KDTA 4FHHA 4IUIA 4OJ4A 3MNPA 3VI8A 1S9QA 2B1ZA 2Q7JA 1R5KA 1XLSE 2AO6A 5E7VA 3AURA 3B0TA 1M2ZA 4G20A 1PRGA 2QTUA 1G5YA 1EREA 2GWXA 2POBA 4ZOMA 5B5BA 2FAIA 4OLMA 5KCEA 4OFRA 1KNUA 5FQVA 3TKMA 3VJIA 3IMYA 4RMCA 3E00D 2R40A 4G1ZA 3UP0A 3BC5A 2QR9A 2YLQA 2Q6RA 3CQVA 5EC9A 2PNUA 2Q7IA 3CLDA 5KD9A 2GIUA 1EXXA 5KCDA 3OGTA 3CS8A 4IA3A 1XAPA 4OKBA 5DIDA 2YLOA 2ZL9A 2HASA 1P93A 3DCTA 1NRLA 5HJSA 3KPZA 5DZIA 1N83A 5FQSA 5DZ0A 2HBHA 3DZYA 1XLSA 3LBDA 2G0HA 3DCUA 1XV9B 4K4JA 5DKGA 5APHA 5DXRA 5HYKA 2Q6SA 1UPWA 2ZK5A 4NB6A 2ZNOA 2AA2A 5G44A 5HZCA 1K4WA 4R06A 2NXXA 5DMCA 3VHWA 1RJKA 2BAWA 4XLDA 2ZK6A 4OIVA 4S15A 5EI1A 5KRMA 1U3QA 4MG8A 4IW8A 5KCFA 4QK4A 5DXQA 2HAMA 1X7BA 3UU7A 5A86A 5KRJA 3H52A 1EXAA 3HODA 3RUUA 1UHLB 4PRGA 3V3QA 2VV4B 1GWRA 1YUCA 4CI4A 4IVWA 5DXMA 1U3RA 1U9EA 5JJMA 4MGBB 2ZMJA 3P88A 2IOKA 3FLIA 1FM9D 1RKGA 3OMQA 4RUJA 4JYIA 4UDDA 5KYAA 4PVUA 1XDKB 2PIRA 4ITEA 1YY4A 4NUFA 2AYRA 2OM9A 1T7RA 3P8XA 3L0JA 4FNEA 1GWQA 1SR7A 2Q60A 4OGHA 3LMPA 4IA7A 4OH5A 1SQNA 1ZDUA 5FQPA 1DB1A 1XV9A 2JFAA 2POGA 4RMEA 2ZK3A 5DVVA 1X78A 4OZRE 4MGDA 3GWSX 3Q95B 2AMAA 3B0QA 5KYJA 4ZN9A 3TKCA 1Y0XX 3GZ9A 2QW4A 4IA1A 3UUDB 4IV4A 4XUMA 2P1TA 1LV2A 2G0GA 2H77A 3OMOA 1R6GA 3F7DA 3L3ZA 3OS9A 1XP9A 4K6IA 4QL8A 2AA5A 3ADVA 3AX8A 3FXVA 4UDCA 3WFGA 1KKQA 2ZASA 3AN3A 5AZVA 3O1DA 2QH6A 5L11A 4JL4A 3A2JA 3OSAA 4OJBA 2J14A 4IVYA 3G0WA 3EYBA 5ETHA 3ZRAA 2OVHA 3OZ0A 3DY6A 3OMMA 2HB8A 1XOWA 4UDBA 3K22A 2Q8SA 5APKA 3VSOA 1L2IA 4QJRA 3AUQA 4IW6A 2V7CA 1X7RA 2PITA 2ZMIA 3OAPA 1ZKYA 3DZUD 1S9PA 5IXKA 1MVCA 3D57A 3BEJA 4ZI1A 3PEQA 1XP6A 1I37A 2GL8A 2GPOA 4Y29A 3A2IA 2XYWA 3ADSA 5C4UA 5L7GA 5M96A 2ZKCA 3BQDA 3ET0A 3L3XA 3VJTA 3X36A 3UVVB 4E4KA 3B0RA 2B50A 1T5ZA 3Q95A 5DX3A 3WT6A 3VJSA 3VT3A 3KFCA 3JZCA 4XI3A 1WM0X 3UUDA 2ZNPA 4A4VA 4DMAA 2FVJA 1T65A 5DTVA 4S0SA 5K13A 2ATHA 1I7GA 2Q70A 3B65A 2Q1HA 1T76A 3D5FA 2PIWA 3ERTA 1R20A 4Q0AC 5DZ3A 2YATA 1N46A 3PBAA 3M7RA 2FSZA 3IA6A 4G2HA 4REEA 5E0WA 5DSHA 5L7HA 3OSWA 3W5PA 3OLFA 1NUOA 1ZH7A 3W0IA 1ILHA 2HFPA 3ET2A 1FM6A 3PCUA 3X1IA 2J7XA 4RZEA 3IXPA 3AN4A 2O4JA 1YOWA 1XQ3A 4FGYA 4A2JA 4OEYA 1HJ1A 4ITFA 1OT7A 5DIGA 1RDTD 4TUZA 4RAKA 3UP3A 2Z4JA 4S14A 3HC5A 2JJ3A 4DK7A 1PCGA 5KRLA 3OSIA 3HO0A 3OZJA 4JGVA 4LNWA 3UVVA 3R8DA 5KRKA 2GPVA 4JYHA 1XNNA 4L98A 4TV1A 1QKNA 5ACCA 1GWXA 1VJBA 2G5OA 3S9SA 3ET3A 2YHDA 2AMBA 1YP0A 3WT7A 3WFFA 4MG8B 4DOSA 1S0XA 3L1BA 5AAVA 3CWDA 3UU7B 4REFA 2ZFXA 1K74D 2ZVTA 3CS4A 1HG4A 3K23A 3H0AD 4WHGA 3V9TA 4OFUA 4Q50A 4J5WA 3CTBA 3FALA 3IPQA 3VT4A 1E3GA 4IS8A 4E4QA 5JJMB 3E00A 4G2IA 2ACLA 3AZ3A 3CDSA 2AB2A 2B1VA 4OILA 4FHIA 1PK5A 5EITA 4PP6A 5DP0A 4OARA 4CI5A 1KV6A 1S0ZA 3VJHA 1IE8A 3A9EA 5DZHA 5DRMA 3OMPA 1E3KA 1OVLA 2JFAB 3SP9A 3VTDA 5IZ0A 1YJEA 2PIUA 5LGAA 3RVFA 4MGDB 4WQPA 1NQ7A 2YJAB 5DL4A 2A3IA 4POHA 2GPPA 4XUHA 1NHZA 3A3ZX 3W0AA 4ZJRA 1A28A 3L0LA 3KDUA 4L96A 1P8DA 3GYTA 2F4BA 4IWCA 4KZIA 1XNXA 2OZ7A 4MGAA 2AAXA 2Q7KA 3GWXA 1RKHA 5DYDA 3GN8A 4NIEA 4RUPA 1T73A 1YIMA 5DMFA 2R6YA 2AX9A 2HARA 3KWYA 1UPVA 5F9BA 1T7MA 1NAXA 4OIUA 4PP3A 3VN2A 3R2AA 4MG7A 4PP5A 5SYZA 2XHSA 3VSPA 4J5XA 4ZO1B 2VSRA 2P7ZA 1FM9A 4IWFA 3FEJA 4K7AA 4EMAA 2AA7A 3K8SA 1S19A 2BJ4A 1FCZA 3OMKA 2J7YA 4G1YA 4OH6A 5KRAA 3VT6A 2VV0A 4ZN7A 5E19A 1PQ6A 3VRWA 5DX3B 3WJ4A 4ZNWA 2H79A 2YFEA 3GBKA 1PQ9A 2AX6A 2ZK1A 3VRUA 1FCXA 5JY3A 3R29A 3HM1A 3P89A 4J5WC 4ONIA 1U3SA 3D6DA 3IPUA 4IU7A 3W0GA 2YJDA 3WJ5A 1LBDA 3MNEA 5EHJA 1QKTA 4KZMA 4M8EA 5DU5A 4MDDA 1SKXA 2B23A 2ZNQA 4OZTU 4ZNTA 5KCWA 2I0JA 3ILZA 4JYGA 4APUA 5L7EA 4N5GA 5CJ6A 2EWPA 2LBDA 3CJWA 5AZTA 5E15A 1OSVA 3MNOA 5JI0D 5HJPA 2J4AA 4LNXA 5GICA 5G3JA 2QGWA 4LTWA 4DK8A 4TUZB 1K7LA 3T03A 3VT5A 4EM9A 4XT9A 5KRCA 4BCRA 3KMGA 1ZGYA 2XKWA 3G8IA 2HC4A 1MV9A 3DZUA 1XVPA 5HCVA 1T79A 3ADTA 1X7EA 4TV1B 1ERRA 4DQMA 5AVLA 4WHFA 5G46A 5C4SA 5KROA 3VTCA 2R6WA 4MG5A 3WGPA 2VSTA 5KCUA 2QPYA 3HQ5A 2QE4A 5AAVB 4E2JA 4ZNSA 5DXBA 4POJA 4Q13A 4NY9A 1SJ0A 5DV6A 4JAZA 3FALB 1I38A 1UOMA 2GP7A 4J5XC 3SP6A 4ZO1X 2VV3A 2ACLB 3OOKA 1T74A 2HB7A 1FCYA 2Q5PA 3W5TA 1XJ7A 2AX8A 2NV7A 3W0JA 5DY8A 1T63A 3KMRA 1R1KD 3CS6A 1XIUA 5E0XA 2O9IA 3RY9A 1Z95A 1DKFA 3A9EB 2QXMA 2PINA 3FS1A 1OVLB 2QA8B 2HVCA 2QGTA 1XPCA 4A4WA 2XYJA 3GD2A 1FD0A 4HEEX 2AM9A 1M7WA 1RDTA 3R5MA 4OKXA 4RMDA 1NAVA 1ZUCA 4N8RA 2P7AA 2OVMA 3NOAA 4J24A 1IE9A 3VRVA 5KR9A 2AWHA 2Q6JA 4MG9A 2HWQA 4OJ9A 1YMTA 4WLBA 1TXIA 5DWIA 3B5RA 3VT9A 3AFRA 2NPAA 1XP1A 4MGAB 3D90A 3V49A 2ZXMA 3NSPA 2E2RA 5DYBA 3V9YA 3FC6B 5DV8A 1FBYA 3WT5A 4ZJWA 3VHUA 1YA3A 3R8IA 3B3KA 4QM0A 5AVIA 4HLWA 3VTBA 4OHAA 1ILGA 3FEIA 4PF3A 1K74A 4NQAB 1NQ0A 2R40D 1YINA 3H0AA 1H9UA 2IOGA 3N00A 2JF9A 4G1DA 4MG7B 4PLDA 3PLZA 5DXEA 3E7CA 1OSHA 2Q7LA 3ADUA 2P1VA 3K6PA 3KMZA 3UUAA 4MG6A 4IV2A 5AWKA 2NXXE 3O1EA 4N1YA 2QA8A 1X76A 2AXAA 1QKMA 4PPPA 3U9QA 1NQ1A 2BJ4B 1ZAFA 2QNVA 1BSXA 1TFCA 3A2HA 3A40X 3OS8A 4OK1A 4PWLA 1YOKA 4MGCA 3L03A 3RUTA 3W0YA 1XQCA 2I0GA 3VRTA 2I4JA 5KCTA 3HLVA 1G50A 4IA2A 5DUEA 3DZYD 1G1UA 4RZFA 5H1EA 1RK3A 4R2UA 4RFWA 2VV1B 3E94A 5AK2A 5GT4A 2GTKA 5DVCA 4PPSA 2QZOA 1ZEOA 3PRGA 2W8YA 4LSJA 2ZXNA 1YYEA 5FQTA 2O4RA 2ZNNA 3FC6A 2ZK4A 4WVDA 4OEDA 2P4YA 4YPQA 4ZNUA 5AAUA 4OZTE 4CSJA 2OCFA 2Z4BA 4OKWA 3GYUA 2HCDA 2P15A 2QMVA 4X1GA 5DIEA 4LBDA 3HC6A 4DM8A 5C4OA 5HJPB 2QXSA 1PZLA 5DWJA 2ZBSA 2ZLAA 2ZK2A 1NYXA 3ET1A 2Q61A 3FUGA 5DZ1A 5G43A 3TY0A 4ZNVA 3SZ1A 5DWGA 2REWA 4OC7A 2PIQA 2Q3YA 4B7WA 4ZNHA 3CDPA 3FURA 3L0EA 3F5CB 1XVPB 3G8OA 1ZDTA 5DKEA 1T7TA 1Z5XE 2G44A 2PIVA 3A78A 1Q4XA 5DUHA 5G45A 3KYTA 4IQRA 3WTQA 5E14A 4YMQA 4J26A 5EJVA 4OKTA 4XAOA 2VV1A 5DI7A 3OKHA 2AA6A 5KRHA 3ERDA 1L2JA 2ZY0A 3AUNA 5DXBB 4M8HA 2Q59B 3RLJA 4N73A 3W0HA 1T7FA 3W5RA 4PLEA 2I4ZA 3OOFA 1G2NA 1Y0SA 3VT7A 5IAWA 4RE8A 5ICKA 2PIPL 2Q1VA 1PDUA 2PJLA 4RUOX 4X1FA 3W0CA 3W5QA 1N4HA 1M13A 5I4VA 2OAXA 5E1CA 3OKIA 3OS8C 2P1UA 1NQ2A
chains in the Genus database with same CATH topology
2P7GA 2OUZA 1DKFB 3PO9A 3IPSA 5LWPA 1X7JA 3DR1A 1MZNA 2ZMHA 3DT3A 2IHQA 3F5CA 1NDEA 1Z5XU 3G9EA 5DKSA 2P54A 1UHLA 2VV4A 5DXPA 3B1MA 3R5NA 5HYRA 5DXGA 2YLPA 3P0UA 3AZ1A 1I7IA 4PXMA 4DM6A 4MGBA 4WPFA 3B66A 3KBAA 3R8AA 5G42A 3JZBA 4MG9B 1XDKA 2QSEA 3B67A 5EGVA 2PIOA 5KCCA 3AZ2A 4XHDA 4YNKA 3V4AA 2PRGA 2AX7A 3QT0A 4OEAA 2Q59A 3ADWA 4O8FA 3ZR7A 4S0TA 3V9VA 3NSQA 5G5WA 5DXKA 5C4TA 3WMHA 5DRJA 3X1HA 5DVSA 5DK9A 5DLRA 3HZFA 4UDAA 2ABIA 3X31A 5APJA 5GIDA 2XYXA 3ZRBA 3TX7B 4FN9A 4OZRU 4RWVA 5KRFA 3ZQTA 4RZGA 2QA6A 3RLLA 4YT1A 3B68A 3VHVA 5B41A 3V3EA 3OLSA 1R20D 3B0WA 5DWLA 1Y9RA 2NW4A 4P6XA 5DWEA 2V0VA 4KZJA 3ADXA 3UUAB 4QE6A 4R6SA 2GPUA 3WWRA 3UUCA 1GS4A 5AYGA 1FM6D 1XZXX 1R1KA 1A52A 2ZXZA 1XB7A 1QKUA 2Q5SA 3IXPD 2ZK0A 4XTAA 5DV3A 4DORA 5GIEA 1PQCA 2ZLCA 4G21A 3OLLA 2I4PA 3D24A 5DUGA 2YLYA 3VT8A 4OEZA 2QZOB 4QE8A 2QABA 2Q5GA 5DKBA 5KRIA 5AWJA 4P6WA 4F9MA 2PKLA 2VV2A 5FQRA 2PIXA 2HWRA 3HVLA 3KDTA 4FHHA 4IUIA 4OJ4A 3MNPA 3VI8A 1S9QA 2B1ZA 2Q7JA 1R5KA 1XLSE 2AO6A 5E7VA 3AURA 3B0TA 1M2ZA 4G20A 1PRGA 2QTUA 1G5YA 1EREA 2GWXA 2POBA 4ZOMA 5B5BA 2FAIA 4OLMA 5KCEA 4OFRA 1KNUA 5FQVA 3TKMA 3VJIA 3IMYA 4RMCA 3E00D 2R40A 4G1ZA 3UP0A 3BC5A 2QR9A 2YLQA 2Q6RA 3CQVA 5EC9A 2PNUA 2Q7IA 3CLDA 5KD9A 2GIUA 1EXXA 5KCDA 3OGTA 3CS8A 4IA3A 1XAPA 4OKBA 5DIDA 2YLOA 2ZL9A 2HASA 1P93A 3DCTA 1NRLA 5HJSA 3KPZA 5DZIA 1N83A 5FQSA 5DZ0A 2HBHA 3DZYA 1XLSA 3LBDA 2G0HA 3DCUA 1XV9B 4K4JA 5DKGA 5APHA 5DXRA 5HYKA 2Q6SA 1UPWA 2ZK5A 4NB6A 2ZNOA 2AA2A 5G44A 5HZCA 1K4WA 4R06A 2NXXA 5DMCA 3VHWA 1RJKA 2BAWA 4XLDA 2ZK6A 4OIVA 4S15A 5EI1A 5KRMA 1U3QA 4MG8A 4IW8A 5KCFA 4QK4A 5DXQA 2HAMA 1X7BA 3UU7A 5A86A 5KRJA 3H52A 1EXAA 3HODA 3RUUA 1UHLB 4PRGA 3V3QA 2VV4B 1GWRA 1YUCA 4CI4A 4IVWA 5DXMA 1U3RA 1U9EA 5JJMA 4MGBB 2ZMJA 3P88A 2IOKA 3FLIA 1FM9D 1RKGA 3OMQA 4RUJA 4JYIA 4UDDA 5KYAA 4PVUA 1XDKB 2PIRA 4ITEA 1YY4A 4NUFA 2AYRA 2OM9A 1T7RA 3P8XA 3L0JA 4FNEA 1GWQA 1SR7A 2Q60A 4OGHA 3LMPA 4IA7A 4OH5A 1SQNA 1ZDUA 5FQPA 1DB1A 1XV9A 2JFAA 2POGA 4RMEA 2ZK3A 5DVVA 1X78A 4OZRE 4MGDA 3GWSX 3Q95B 2AMAA 3B0QA 5KYJA 4ZN9A 3TKCA 1Y0XX 3GZ9A 2QW4A 4IA1A 3UUDB 4IV4A 4XUMA 2P1TA 1LV2A 2G0GA 2H77A 3OMOA 1R6GA 3F7DA 3L3ZA 3OS9A 1XP9A 4K6IA 4QL8A 2AA5A 3ADVA 3AX8A 3FXVA 4UDCA 3WFGA 1KKQA 2ZASA 3AN3A 5AZVA 3O1DA 2QH6A 5L11A 4JL4A 3A2JA 3OSAA 4OJBA 2J14A 4IVYA 3G0WA 3EYBA 5ETHA 3ZRAA 2OVHA 3OZ0A 3DY6A 3OMMA 2HB8A 1XOWA 4UDBA 3K22A 2Q8SA 5APKA 3VSOA 1L2IA 4QJRA 3AUQA 4IW6A 2V7CA 1X7RA 2PITA 2ZMIA 3OAPA 1ZKYA 3DZUD 1S9PA 5IXKA 1MVCA 3D57A 3BEJA 4ZI1A 3PEQA 1XP6A 1I37A 2GL8A 2GPOA 4Y29A 3A2IA 2XYWA 3ADSA 5C4UA 5L7GA 5M96A 2ZKCA 3BQDA 3ET0A 3L3XA 3VJTA 3X36A 3UVVB 4E4KA 3B0RA 2B50A 1T5ZA 3Q95A 5DX3A 3WT6A 3VJSA 3VT3A 3KFCA 3JZCA 4XI3A 1WM0X 3UUDA 2ZNPA 4A4VA 4DMAA 2FVJA 1T65A 5DTVA 4S0SA 5K13A 2ATHA 1I7GA 2Q70A 3B65A 2Q1HA 1T76A 3D5FA 2PIWA 3ERTA 1R20A 4Q0AC 5DZ3A 2YATA 1N46A 3PBAA 3M7RA 2FSZA 3IA6A 4G2HA 4REEA 5E0WA 5DSHA 5L7HA 3OSWA 3W5PA 3OLFA 1NUOA 1ZH7A 3W0IA 1ILHA 2HFPA 3ET2A 1FM6A 3PCUA 3X1IA 2J7XA 4RZEA 3IXPA 3AN4A 2O4JA 1YOWA 1XQ3A 4FGYA 4A2JA 4OEYA 1HJ1A 4ITFA 1OT7A 5DIGA 1RDTD 4TUZA 4RAKA 3UP3A 2Z4JA 4S14A 3HC5A 2JJ3A 4DK7A 1PCGA 5KRLA 3OSIA 3HO0A 3OZJA 4JGVA 4LNWA 3UVVA 3R8DA 5KRKA 2GPVA 4JYHA 1XNNA 4L98A 4TV1A 1QKNA 5ACCA 1GWXA 1VJBA 2G5OA 3S9SA 3ET3A 2YHDA 2AMBA 1YP0A 3WT7A 3WFFA 4MG8B 4DOSA 1S0XA 3L1BA 5AAVA 3CWDA 3UU7B 4REFA 2ZFXA 1K74D 2ZVTA 3CS4A 1HG4A 3K23A 3H0AD 4WHGA 3V9TA 4OFUA 4Q50A 4J5WA 3CTBA 3FALA 3IPQA 3VT4A 1E3GA 4IS8A 4E4QA 5JJMB 3E00A 4G2IA 2ACLA 3AZ3A 3CDSA 2AB2A 2B1VA 4OILA 4FHIA 1PK5A 5EITA 4PP6A 5DP0A 4OARA 4CI5A 1KV6A 1S0ZA 3VJHA 1IE8A 3A9EA 5DZHA 5DRMA 3OMPA 1E3KA 1OVLA 2JFAB 3SP9A 3VTDA 5IZ0A 1YJEA 2PIUA 5LGAA 3RVFA 4MGDB 4WQPA 1NQ7A 2YJAB 5DL4A 2A3IA 4POHA 2GPPA 4XUHA 1NHZA 3A3ZX 3W0AA 4ZJRA 1A28A 3L0LA 3KDUA 4L96A 1P8DA 3GYTA 2F4BA 4IWCA 4KZIA 1XNXA 2OZ7A 4MGAA 2AAXA 2Q7KA 3GWXA 1RKHA 5DYDA 3GN8A 4NIEA 4RUPA 1T73A 1YIMA 5DMFA 2R6YA 2AX9A 2HARA 3KWYA 1UPVA 5F9BA 1T7MA 1NAXA 4OIUA 4PP3A 3VN2A 3R2AA 4MG7A 4PP5A 5SYZA 2XHSA 3VSPA 4J5XA 4ZO1B 2VSRA 2P7ZA 1FM9A 4IWFA 3FEJA 4K7AA 4EMAA 2AA7A 3K8SA 1S19A 2BJ4A 1FCZA 3OMKA 2J7YA 4G1YA 4OH6A 5KRAA 3VT6A 2VV0A 4ZN7A 5E19A 1PQ6A 3VRWA 5DX3B 3WJ4A 4ZNWA 2H79A 2YFEA 3GBKA 1PQ9A 2AX6A 2ZK1A 3VRUA 1FCXA 5JY3A 3R29A 3HM1A 3P89A 4J5WC 4ONIA 1U3SA 3D6DA 3IPUA 4IU7A 3W0GA 2YJDA 3WJ5A 1LBDA 3MNEA 5EHJA 1QKTA 4KZMA 4M8EA 5DU5A 4MDDA 1SKXA 2B23A 2ZNQA 4OZTU 4ZNTA 5KCWA 2I0JA 3ILZA 4JYGA 4APUA 5L7EA 4N5GA 5CJ6A 2EWPA 2LBDA 3CJWA 5AZTA 5E15A 1OSVA 3MNOA 5JI0D 5HJPA 2J4AA 4LNXA 5GICA 5G3JA 2QGWA 4LTWA 4DK8A 4TUZB 1K7LA 3T03A 3VT5A 4EM9A 4XT9A 5KRCA 4BCRA 3KMGA 1ZGYA 2XKWA 3G8IA 2HC4A 1MV9A 3DZUA 1XVPA 5HCVA 1T79A 3ADTA 1X7EA 4TV1B 1ERRA 4DQMA 5AVLA 4WHFA 5G46A 5C4SA 5KROA 3VTCA 2R6WA 4MG5A 3WGPA 2VSTA 5KCUA 2QPYA 3HQ5A 2QE4A 5AAVB 4E2JA 4ZNSA 5DXBA 4POJA 4Q13A 4NY9A 1SJ0A 5DV6A 4JAZA 3FALB 1I38A 1UOMA 2GP7A 4J5XC 3SP6A 4ZO1X 2VV3A 2ACLB 3OOKA 1T74A 2HB7A 1FCYA 2Q5PA 3W5TA 1XJ7A 2AX8A 2NV7A 3W0JA 5DY8A 1T63A 3KMRA 1R1KD 3CS6A 1XIUA 5E0XA 2O9IA 3RY9A 1Z95A 1DKFA 3A9EB 2QXMA 2PINA 3FS1A 1OVLB 2QA8B 2HVCA 2QGTA 1XPCA 4A4WA 2XYJA 3GD2A 1FD0A 4HEEX 2AM9A 1M7WA 1RDTA 3R5MA 4OKXA 4RMDA 1NAVA 1ZUCA 4N8RA 2P7AA 2OVMA 3NOAA 4J24A 1IE9A 3VRVA 5KR9A 2AWHA 2Q6JA 4MG9A 2HWQA 4OJ9A 1YMTA 4WLBA 1TXIA 5DWIA 3B5RA 3VT9A 3AFRA 2NPAA 1XP1A 4MGAB 3D90A 3V49A 2ZXMA 3NSPA 2E2RA 5DYBA 3V9YA 3FC6B 5DV8A 1FBYA 3WT5A 4ZJWA 3VHUA 1YA3A 3R8IA 3B3KA 4QM0A 5AVIA 4HLWA 3VTBA 4OHAA 1ILGA 3FEIA 4PF3A 1K74A 4NQAB 1NQ0A 2R40D 1YINA 3H0AA 1H9UA 2IOGA 3N00A 2JF9A 4G1DA 4MG7B 4PLDA 3PLZA 5DXEA 3E7CA 1OSHA 2Q7LA 3ADUA 2P1VA 3K6PA 3KMZA 3UUAA 4MG6A 4IV2A 5AWKA 2NXXE 3O1EA 4N1YA 2QA8A 1X76A 2AXAA 1QKMA 4PPPA 3U9QA 1NQ1A 2BJ4B 1ZAFA 2QNVA 1BSXA 1TFCA 3A2HA 3A40X 3OS8A 4OK1A 4PWLA 1YOKA 4MGCA 3L03A 3RUTA 3W0YA 1XQCA 2I0GA 3VRTA 2I4JA 5KCTA 3HLVA 1G50A 4IA2A 5DUEA 3DZYD 1G1UA 4RZFA 5H1EA 1RK3A 4R2UA 4RFWA 2VV1B 3E94A 5AK2A 5GT4A 2GTKA 5DVCA 4PPSA 2QZOA 1ZEOA 3PRGA 2W8YA 4LSJA 2ZXNA 1YYEA 5FQTA 2O4RA 2ZNNA 3FC6A 2ZK4A 4WVDA 4OEDA 2P4YA 4YPQA 4ZNUA 5AAUA 4OZTE 4CSJA 2OCFA 2Z4BA 4OKWA 3GYUA 2HCDA 2P15A 2QMVA 4X1GA 5DIEA 4LBDA 3HC6A 4DM8A 5C4OA 5HJPB 2QXSA 1PZLA 5DWJA 2ZBSA 2ZLAA 2ZK2A 1NYXA 3ET1A 2Q61A 3FUGA 5DZ1A 5G43A 3TY0A 4ZNVA 3SZ1A 5DWGA 2REWA 4OC7A 2PIQA 2Q3YA 4B7WA 4ZNHA 3CDPA 3FURA 3L0EA 3F5CB 1XVPB 3G8OA 1ZDTA 5DKEA 1T7TA 1Z5XE 2G44A 2PIVA 3A78A 1Q4XA 5DUHA 5G45A 3KYTA 4IQRA 3WTQA 5E14A 4YMQA 4J26A 5EJVA 4OKTA 4XAOA 2VV1A 5DI7A 3OKHA 2AA6A 5KRHA 3ERDA 1L2JA 2ZY0A 3AUNA 5DXBB 4M8HA 2Q59B 3RLJA 4N73A 3W0HA 1T7FA 3W5RA 4PLEA 2I4ZA 3OOFA 1G2NA 1Y0SA 3VT7A 5IAWA 4RE8A 5ICKA 2PIPL 2Q1VA 1PDUA 2PJLA 4RUOX 4X1FA 3W0CA 3W5QA 1N4HA 1M13A 5I4VA 2OAXA 5E1CA 3OKIA 3OS8C 2P1UA 1NQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P7G A;  2OUZ A;  1DKF B;  3PO9 A;  3IPS A;  5LWP A;  1X7J A;  3DR1 A;  1MZN A;  2ZMH A;  3DT3 A;  2IHQ A;  3F5C A;  1NDE A;  1Z5X U;  3G9E A;  5DKS A;  2P54 A;  1UHL A;  2VV4 A;  5DXP A;  3B1M A;  3R5N A;  5HYR A;  5DXG A;  2YLP A;  3P0U A;  3AZ1 A;  1I7I A;  4PXM A;  4DM6 A;  4MGB A;  4WPF A;  3B66 A;  3KBA A;  3R8A A;  5G42 A;  3JZB A;  4MG9 B;  1XDK A;  2QSE A;  3B67 A;  5EGV A;  2PIO A;  5KCC A;  3AZ2 A;  4XHD A;  4YNK A;  3V4A A;  2PRG A;  2AX7 A;  3QT0 A;  4OEA A;  2Q59 A;  3ADW A;  4O8F A;  3ZR7 A;  4S0T A;  3V9V A;  3NSQ A;  5G5W A;  5DXK A;  5C4T A;  3WMH A;  5DRJ A;  3X1H A;  5DVS A;  5DK9 A;  5DLR A;  3HZF A;  4UDA A;  2ABI A;  3X31 A;  5APJ A;  5GID A;  2XYX A;  3ZRB A;  3TX7 B;  4FN9 A;  4OZR U;  4RWV A;  5KRF A;  3ZQT A;  4RZG A;  2QA6 A;  3RLL A;  4YT1 A;  3B68 A;  3VHV A;  5B41 A;  3V3E A;  3OLS A;  1R20 D;  3B0W A;  5DWL A;  1Y9R A;  2NW4 A;  4P6X A;  5DWE A;  2V0V A;  4KZJ A;  3ADX A;  3UUA B;  4QE6 A;  4R6S A;  2GPU A;  3WWR A;  3UUC A;  1GS4 A;  5AYG A;  1FM6 D;  1XZX X;  1R1K A;  1A52 A;  2ZXZ A;  1XB7 A;  1QKU A;  2Q5S A;  3IXP D;  2ZK0 A;  4XTA A;  5DV3 A;  4DOR A;  5GIE A;  1PQC A;  2ZLC A;  4G21 A;  3OLL A;  2I4P A;  3D24 A;  5DUG A;  2YLY A;  3VT8 A;  4OEZ A;  2QZO B;  4QE8 A;  2QAB A;  2Q5G A;  5DKB A;  5KRI A;  5AWJ A;  4P6W A;  4F9M A;  2PKL A;  2VV2 A;  5FQR A;  2PIX A;  2HWR A;  3HVL A;  3KDT A;  4FHH A;  4IUI A;  4OJ4 A;  3MNP A;  3VI8 A;  1S9Q A;  2B1Z A;  2Q7J A;  1R5K A;  1XLS E;  2AO6 A;  5E7V A;  3AUR A;  3B0T A;  1M2Z A;  4G20 A;  1PRG A;  2QTU A;  1G5Y A;  1ERE A;  2GWX A;  2POB A;  4ZOM A;  5B5B A;  2FAI A;  4OLM A;  5KCE A;  4OFR A;  1KNU A;  5FQV A;  3TKM A;  3VJI A;  3IMY A;  4RMC A;  3E00 D;  2R40 A;  4G1Z A;  3UP0 A;  3BC5 A;  2QR9 A;  2YLQ A;  2Q6R A;  3CQV A;  5EC9 A;  2PNU A;  2Q7I A;  3CLD A;  5KD9 A;  2GIU A;  1EXX A;  5KCD A;  3OGT A;  3CS8 A;  4IA3 A;  1XAP A;  4OKB A;  5DID A;  2YLO A;  2ZL9 A;  2HAS A;  1P93 A;  3DCT A;  1NRL A;  5HJS A;  3KPZ A;  5DZI A;  1N83 A;  5FQS A;  5DZ0 A;  2HBH A;  3DZY A;  1XLS A;  3LBD A;  2G0H A;  3DCU A;  1XV9 B;  4K4J A;  5DKG A;  5APH A;  5DXR A;  5HYK A;  2Q6S A;  1UPW A;  2ZK5 A;  4NB6 A;  2ZNO A;  2AA2 A;  5G44 A;  5HZC A;  1K4W A;  4R06 A;  2NXX A;  5DMC A;  3VHW A;  1RJK A;  2BAW A;  4XLD A;  2ZK6 A;  4OIV A;  4S15 A;  5EI1 A;  5KRM A;  1U3Q A;  4MG8 A;  4IW8 A;  5KCF A;  4QK4 A;  5DXQ A;  2HAM A;  1X7B A;  3UU7 A;  5A86 A;  5KRJ A;  3H52 A;  1EXA A;  3HOD A;  3RUU A;  1UHL B;  4PRG A;  3V3Q A;  2VV4 B;  1GWR A;  1YUC A;  4CI4 A;  4IVW A;  5DXM A;  1U3R A;  1U9E A;  5JJM A;  4MGB B;  2ZMJ A;  3P88 A;  2IOK A;  3FLI A;  1FM9 D;  1RKG A;  3OMQ A;  4RUJ A;  4JYI A;  4UDD A;  5KYA A;  4PVU A;  1XDK B;  2PIR A;  4ITE A;  1YY4 A;  4NUF A;  2AYR A;  2OM9 A;  1T7R A;  3P8X A;  3L0J A;  4FNE A;  1GWQ A;  1SR7 A;  2Q60 A;  4OGH A;  3LMP A;  4IA7 A;  4OH5 A;  1SQN A;  1ZDU A;  5FQP A;  1DB1 A;  1XV9 A;  2JFA A;  2POG A;  4RME A;  2ZK3 A;  5DVV A;  1X78 A;  4OZR E;  4MGD A;  3GWS X;  3Q95 B;  2AMA A;  3B0Q A;  5KYJ A;  4ZN9 A;  3TKC A;  1Y0X X;  3GZ9 A;  2QW4 A;  4IA1 A;  3UUD B;  4IV4 A;  4XUM A;  2P1T A;  1LV2 A;  2G0G A;  2H77 A;  3OMO A;  1R6G A;  3F7D A;  3L3Z A;  3OS9 A;  1XP9 A;  4K6I A;  4QL8 A;  2AA5 A;  3ADV A;  3AX8 A;  3FXV A;  4UDC A;  3WFG A;  1KKQ A;  2ZAS A;  3AN3 A;  5AZV A;  3O1D A;  2QH6 A;  5L11 A;  4JL4 A;  3A2J A;  3OSA A;  4OJB A;  2J14 A;  4IVY A;  3G0W A;  3EYB A;  5ETH A;  3ZRA A;  2OVH A;  3OZ0 A;  3DY6 A;  3OMM A;  2HB8 A;  1XOW A;  4UDB A;  3K22 A;  2Q8S A;  5APK A;  3VSO A;  1L2I A;  4QJR A;  3AUQ A;  4IW6 A;  2V7C A;  1X7R A;  2PIT A;  2ZMI A;  3OAP A;  1ZKY A;  3DZU D;  1S9P A;  5IXK A;  1MVC A;  3D57 A;  3BEJ A;  4ZI1 A;  3PEQ A;  1XP6 A;  1I37 A;  2GL8 A;  2GPO A;  4Y29 A;  3A2I A;  2XYW A;  3ADS A;  5C4U A;  5L7G A;  5M96 A;  2ZKC A;  3BQD A;  3ET0 A;  3L3X A;  3VJT A;  3X36 A;  3UVV B;  4E4K A;  3B0R A;  2B50 A;  1T5Z A;  3Q95 A;  5DX3 A;  3WT6 A;  3VJS A;  3VT3 A;  3KFC A;  3JZC A;  4XI3 A;  1WM0 X;  3UUD A;  2ZNP A;  4A4V A;  4DMA A;  2FVJ A;  1T65 A;  5DTV A;  4S0S A;  5K13 A;  2ATH A;  1I7G A;  2Q70 A;  3B65 A;  2Q1H A;  1T76 A;  3D5F A;  2PIW A;  3ERT A;  1R20 A;  4Q0A C;  5DZ3 A;  2YAT A;  1N46 A;  3PBA A;  3M7R A;  2FSZ A;  3IA6 A;  4G2H A;  4REE A;  5E0W A;  5DSH A;  5L7H A;  3OSW A;  3W5P A;  3OLF A;  1NUO A;  1ZH7 A;  3W0I A;  1ILH A;  2HFP A;  3ET2 A;  1FM6 A;  3PCU A;  3X1I A;  2J7X A;  4RZE A;  3IXP A;  3AN4 A;  2O4J A;  1YOW A;  1XQ3 A;  4FGY A;  4A2J A;  4OEY A;  1HJ1 A;  4ITF A;  1OT7 A;  5DIG A;  1RDT D;  4TUZ A;  4RAK A;  3UP3 A;  2Z4J A;  4S14 A;  3HC5 A;  2JJ3 A;  4DK7 A;  1PCG A;  5KRL A;  3OSI A;  3HO0 A;  3OZJ A;  4JGV A;  4LNW A;  3UVV A;  3R8D A;  5KRK A;  2GPV A;  4JYH A;  1XNN A;  4L98 A;  4TV1 A;  1QKN A;  5ACC A;  1GWX A;  1VJB A;  2G5O A;  3S9S A;  3ET3 A;  2YHD A;  2AMB A;  1YP0 A;  3WT7 A;  3WFF A;  4MG8 B;  4DOS A;  1S0X A;  3L1B A;  5AAV A;  3CWD A;  3UU7 B;  4REF A;  2ZFX A;  1K74 D;  2ZVT A;  3CS4 A;  1HG4 A;  3K23 A;  3H0A D;  4WHG A;  3V9T A;  4OFU A;  4Q50 A;  4J5W A;  3CTB A;  3FAL A;  3IPQ A;  3VT4 A;  1E3G A;  4IS8 A;  4E4Q A;  5JJM B;  3E00 A;  4G2I A;  2ACL A;  3AZ3 A;  3CDS A;  2AB2 A;  2B1V A;  4OIL A;  4FHI A;  1PK5 A;  5EIT A;  4PP6 A;  5DP0 A;  4OAR A;  4CI5 A;  1KV6 A;  1S0Z A;  3VJH A;  1IE8 A;  3A9E A;  5DZH A;  5DRM A;  3OMP A;  1E3K A;  1OVL A;  2JFA B;  3SP9 A;  3VTD A;  5IZ0 A;  1YJE A;  2PIU A;  5LGA A;  3RVF A;  4MGD B;  4WQP A;  1NQ7 A;  2YJA B;  5DL4 A;  2A3I A;  4POH A;  2GPP A;  4XUH A;  1NHZ A;  3A3Z X;  3W0A A;  4ZJR A;  1A28 A;  3L0L A;  3KDU A;  4L96 A;  1P8D A;  3GYT A;  2F4B A;  4IWC A;  4KZI A;  1XNX A;  2OZ7 A;  4MGA A;  2AAX A;  2Q7K A;  3GWX A;  1RKH A;  5DYD A;  3GN8 A;  4NIE A;  4RUP A;  1T73 A;  1YIM A;  5DMF A;  2R6Y A;  2AX9 A;  2HAR A;  3KWY A;  1UPV A;  5F9B A;  1T7M A;  1NAX A;  4OIU A;  4PP3 A;  3VN2 A;  3R2A A;  4MG7 A;  4PP5 A;  5SYZ A;  2XHS A;  3VSP A;  4J5X A;  4ZO1 B;  2VSR A;  2P7Z A;  1FM9 A;  4IWF A;  3FEJ A;  4K7A A;  4EMA A;  2AA7 A;  3K8S A;  1S19 A;  2BJ4 A;  1FCZ A;  3OMK A;  2J7Y A;  4G1Y A;  4OH6 A;  5KRA A;  3VT6 A;  2VV0 A;  4ZN7 A;  5E19 A;  1PQ6 A;  3VRW A;  5DX3 B;  3WJ4 A;  4ZNW A;  2H79 A;  2YFE A;  3GBK A;  1PQ9 A;  2AX6 A;  2ZK1 A;  3VRU A;  1FCX A;  5JY3 A;  3R29 A;  3HM1 A;  3P89 A;  4J5W C;  4ONI A;  1U3S A;  3D6D A;  3IPU A;  4IU7 A;  3W0G A;  2YJD A;  3WJ5 A;  1LBD A;  3MNE A;  5EHJ A;  1QKT A;  4KZM A;  4M8E A;  5DU5 A;  4MDD A;  1SKX A;  2B23 A;  2ZNQ A;  4OZT U;  4ZNT A;  5KCW A;  2I0J A;  3ILZ A;  4JYG A;  4APU A;  5L7E A;  4N5G A;  5CJ6 A;  2EWP A;  2LBD A;  3CJW A;  5AZT A;  5E15 A;  1OSV A;  3MNO A;  5JI0 D;  5HJP A;  2J4A A;  4LNX A;  5GIC A;  5G3J A;  2QGW A;  4LTW A;  4DK8 A;  4TUZ B;  1K7L A;  3T03 A;  3VT5 A;  4EM9 A;  4XT9 A;  5KRC A;  4BCR A;  3KMG A;  1ZGY A;  2XKW A;  3G8I A;  2HC4 A;  1MV9 A;  3DZU A;  1XVP A;  5HCV A;  1T79 A;  3ADT A;  1X7E A;  4TV1 B;  1ERR A;  4DQM A;  5AVL A;  4WHF A;  5G46 A;  5C4S A;  5KRO A;  3VTC A;  2R6W A;  4MG5 A;  3WGP A;  2VST A;  5KCU A;  2QPY A;  3HQ5 A;  2QE4 A;  5AAV B;  4E2J A;  4ZNS A;  5DXB A;  4POJ A;  4Q13 A;  4NY9 A;  1SJ0 A;  5DV6 A;  4JAZ A;  3FAL B;  1I38 A;  1UOM A;  2GP7 A;  4J5X C;  3SP6 A;  4ZO1 X;  2VV3 A;  2ACL B;  3OOK A;  1T74 A;  2HB7 A;  1FCY A;  2Q5P A;  3W5T A;  1XJ7 A;  2AX8 A;  2NV7 A;  3W0J A;  5DY8 A;  1T63 A;  3KMR A;  1R1K D;  3CS6 A;  1XIU A;  5E0X A;  2O9I A;  3RY9 A;  1Z95 A;  1DKF A;  3A9E B;  2QXM A;  2PIN A;  3FS1 A;  1OVL B;  2QA8 B;  2HVC A;  2QGT A;  1XPC A;  4A4W A;  2XYJ A;  3GD2 A;  1FD0 A;  4HEE X;  2AM9 A;  1M7W A;  1RDT A;  3R5M A;  4OKX A;  4RMD A;  1NAV A;  1ZUC A;  4N8R A;  2P7A A;  2OVM A;  3NOA A;  4J24 A;  1IE9 A;  3VRV A;  5KR9 A;  2AWH A;  2Q6J A;  4MG9 A;  2HWQ A;  4OJ9 A;  1YMT A;  4WLB A;  1TXI A;  5DWI A;  3B5R A;  3VT9 A;  3AFR A;  2NPA A;  1XP1 A;  4MGA B;  3D90 A;  3V49 A;  2ZXM A;  3NSP A;  2E2R A;  5DYB A;  3V9Y A;  3FC6 B;  5DV8 A;  1FBY A;  3WT5 A;  4ZJW A;  3VHU A;  1YA3 A;  3R8I A;  3B3K A;  4QM0 A;  5AVI A;  4HLW A;  3VTB A;  4OHA A;  1ILG A;  3FEI A;  4PF3 A;  1K74 A;  4NQA B;  1NQ0 A;  2R40 D;  1YIN A;  3H0A A;  1H9U A;  2IOG A;  3N00 A;  2JF9 A;  4G1D A;  4MG7 B;  4PLD A;  3PLZ A;  5DXE A;  3E7C A;  1OSH A;  2Q7L A;  3ADU A;  2P1V A;  3K6P A;  3KMZ A;  3UUA A;  4MG6 A;  4IV2 A;  5AWK A;  2NXX E;  3O1E A;  4N1Y A;  2QA8 A;  1X76 A;  2AXA A;  1QKM A;  4PPP A;  3U9Q A;  1NQ1 A;  2BJ4 B;  1ZAF A;  2QNV A;  1BSX A;  1TFC A;  3A2H A;  3A40 X;  3OS8 A;  4OK1 A;  4PWL A;  1YOK A;  4MGC A;  3L03 A;  3RUT A;  3W0Y A;  1XQC A;  2I0G A;  3VRT A;  2I4J A;  5KCT A;  3HLV A;  1G50 A;  4IA2 A;  5DUE A;  3DZY D;  1G1U A;  4RZF A;  5H1E A;  1RK3 A;  4R2U A;  4RFW A;  2VV1 B;  3E94 A;  5AK2 A;  5GT4 A;  2GTK A;  5DVC A;  4PPS A;  2QZO A;  1ZEO A;  3PRG A;  2W8Y A;  4LSJ A;  2ZXN A;  1YYE A;  5FQT A;  2O4R A;  2ZNN A;  3FC6 A;  2ZK4 A;  4WVD A;  4OED A;  2P4Y A;  4YPQ A;  4ZNU A;  5AAU A;  4OZT E;  4CSJ A;  2OCF A;  2Z4B A;  4OKW A;  3GYU A;  2HCD A;  2P15 A;  2QMV A;  4X1G A;  5DIE A;  4LBD A;  3HC6 A;  4DM8 A;  5C4O A;  5HJP B;  2QXS A;  1PZL A;  5DWJ A;  2ZBS A;  2ZLA A;  2ZK2 A;  1NYX A;  3ET1 A;  2Q61 A;  3FUG A;  5DZ1 A;  5G43 A;  3TY0 A;  4ZNV A;  3SZ1 A;  5DWG A;  2REW A;  4OC7 A;  2PIQ A;  2Q3Y A;  4B7W A;  4ZNH A;  3CDP A;  3FUR A;  3L0E A;  3F5C B;  1XVP B;  3G8O A;  1ZDT A;  5DKE A;  1T7T A;  1Z5X E;  2G44 A;  2PIV A;  3A78 A;  1Q4X A;  5DUH A;  5G45 A;  3KYT A;  4IQR A;  3WTQ A;  5E14 A;  4YMQ A;  4J26 A;  5EJV A;  4OKT A;  4XAO A;  2VV1 A;  5DI7 A;  3OKH A;  2AA6 A;  5KRH A;  3ERD A;  1L2J A;  2ZY0 A;  3AUN A;  5DXB B;  4M8H A;  2Q59 B;  3RLJ A;  4N73 A;  3W0H A;  1T7F A;  3W5R A;  4PLE A;  2I4Z A;  3OOF A;  1G2N A;  1Y0S A;  3VT7 A;  5IAW A;  4RE8 A;  5ICK A;  2PIP L;  2Q1V A;  1PDU A;  2PJL A;  4RUO X;  4X1F A;  3W0C A;  3W5Q A;  1N4H A;  1M13 A;  5I4V A;  2OAX A;  5E1C A;  3OKI A;  3OS8 C;  2P1U A;  1NQ2 A; 
#chains in the Genus database with same CATH topology
 2P7G A;  2OUZ A;  1DKF B;  3PO9 A;  3IPS A;  5LWP A;  1X7J A;  3DR1 A;  1MZN A;  2ZMH A;  3DT3 A;  2IHQ A;  3F5C A;  1NDE A;  1Z5X U;  3G9E A;  5DKS A;  2P54 A;  1UHL A;  2VV4 A;  5DXP A;  3B1M A;  3R5N A;  5HYR A;  5DXG A;  2YLP A;  3P0U A;  3AZ1 A;  1I7I A;  4PXM A;  4DM6 A;  4MGB A;  4WPF A;  3B66 A;  3KBA A;  3R8A A;  5G42 A;  3JZB A;  4MG9 B;  1XDK A;  2QSE A;  3B67 A;  5EGV A;  2PIO A;  5KCC A;  3AZ2 A;  4XHD A;  4YNK A;  3V4A A;  2PRG A;  2AX7 A;  3QT0 A;  4OEA A;  2Q59 A;  3ADW A;  4O8F A;  3ZR7 A;  4S0T A;  3V9V A;  3NSQ A;  5G5W A;  5DXK A;  5C4T A;  3WMH A;  5DRJ A;  3X1H A;  5DVS A;  5DK9 A;  5DLR A;  3HZF A;  4UDA A;  2ABI A;  3X31 A;  5APJ A;  5GID A;  2XYX A;  3ZRB A;  3TX7 B;  4FN9 A;  4OZR U;  4RWV A;  5KRF A;  3ZQT A;  4RZG A;  2QA6 A;  3RLL A;  4YT1 A;  3B68 A;  3VHV A;  5B41 A;  3V3E A;  3OLS A;  1R20 D;  3B0W A;  5DWL A;  1Y9R A;  2NW4 A;  4P6X A;  5DWE A;  2V0V A;  4KZJ A;  3ADX A;  3UUA B;  4QE6 A;  4R6S A;  2GPU A;  3WWR A;  3UUC A;  1GS4 A;  5AYG A;  1FM6 D;  1XZX X;  1R1K A;  1A52 A;  2ZXZ A;  1XB7 A;  1QKU A;  2Q5S A;  3IXP D;  2ZK0 A;  4XTA A;  5DV3 A;  4DOR A;  5GIE A;  1PQC A;  2ZLC A;  4G21 A;  3OLL A;  2I4P A;  3D24 A;  5DUG A;  2YLY A;  3VT8 A;  4OEZ A;  2QZO B;  4QE8 A;  2QAB A;  2Q5G A;  5DKB A;  5KRI A;  5AWJ A;  4P6W A;  4F9M A;  2PKL A;  2VV2 A;  5FQR A;  2PIX A;  2HWR A;  3HVL A;  3KDT A;  4FHH A;  4IUI A;  4OJ4 A;  3MNP A;  3VI8 A;  1S9Q A;  2B1Z A;  2Q7J A;  1R5K A;  1XLS E;  2AO6 A;  5E7V A;  3AUR A;  3B0T A;  1M2Z A;  4G20 A;  1PRG A;  2QTU A;  1G5Y A;  1ERE A;  2GWX A;  2POB A;  4ZOM A;  5B5B A;  2FAI A;  4OLM A;  5KCE A;  4OFR A;  1KNU A;  5FQV A;  3TKM A;  3VJI A;  3IMY A;  4RMC A;  3E00 D;  2R40 A;  4G1Z A;  3UP0 A;  3BC5 A;  2QR9 A;  2YLQ A;  2Q6R A;  3CQV A;  5EC9 A;  2PNU A;  2Q7I A;  3CLD A;  5KD9 A;  2GIU A;  1EXX A;  5KCD A;  3OGT A;  3CS8 A;  4IA3 A;  1XAP A;  4OKB A;  5DID A;  2YLO A;  2ZL9 A;  2HAS A;  1P93 A;  3DCT A;  1NRL A;  5HJS A;  3KPZ A;  5DZI A;  1N83 A;  5FQS A;  5DZ0 A;  2HBH A;  3DZY A;  1XLS A;  3LBD A;  2G0H A;  3DCU A;  1XV9 B;  4K4J A;  5DKG A;  5APH A;  5DXR A;  5HYK A;  2Q6S A;  1UPW A;  2ZK5 A;  4NB6 A;  2ZNO A;  2AA2 A;  5G44 A;  5HZC A;  1K4W A;  4R06 A;  2NXX A;  5DMC A;  3VHW A;  1RJK A;  2BAW A;  4XLD A;  2ZK6 A;  4OIV A;  4S15 A;  5EI1 A;  5KRM A;  1U3Q A;  4MG8 A;  4IW8 A;  5KCF A;  4QK4 A;  5DXQ A;  2HAM A;  1X7B A;  3UU7 A;  5A86 A;  5KRJ A;  3H52 A;  1EXA A;  3HOD A;  3RUU A;  1UHL B;  4PRG A;  3V3Q A;  2VV4 B;  1GWR A;  1YUC A;  4CI4 A;  4IVW A;  5DXM A;  1U3R A;  1U9E A;  5JJM A;  4MGB B;  2ZMJ A;  3P88 A;  2IOK A;  3FLI A;  1FM9 D;  1RKG A;  3OMQ A;  4RUJ A;  4JYI A;  4UDD A;  5KYA A;  4PVU A;  1XDK B;  2PIR A;  4ITE A;  1YY4 A;  4NUF A;  2AYR A;  2OM9 A;  1T7R A;  3P8X A;  3L0J A;  4FNE A;  1GWQ A;  1SR7 A;  2Q60 A;  4OGH A;  3LMP A;  4IA7 A;  4OH5 A;  1SQN A;  1ZDU A;  5FQP A;  1DB1 A;  1XV9 A;  2JFA A;  2POG A;  4RME A;  2ZK3 A;  5DVV A;  1X78 A;  4OZR E;  4MGD A;  3GWS X;  3Q95 B;  2AMA A;  3B0Q A;  5KYJ A;  4ZN9 A;  3TKC A;  1Y0X X;  3GZ9 A;  2QW4 A;  4IA1 A;  3UUD B;  4IV4 A;  4XUM A;  2P1T A;  1LV2 A;  2G0G A;  2H77 A;  3OMO A;  1R6G A;  3F7D A;  3L3Z A;  3OS9 A;  1XP9 A;  4K6I A;  4QL8 A;  2AA5 A;  3ADV A;  3AX8 A;  3FXV A;  4UDC A;  3WFG A;  1KKQ A;  2ZAS A;  3AN3 A;  5AZV A;  3O1D A;  2QH6 A;  5L11 A;  4JL4 A;  3A2J A;  3OSA A;  4OJB A;  2J14 A;  4IVY A;  3G0W A;  3EYB A;  5ETH A;  3ZRA A;  2OVH A;  3OZ0 A;  3DY6 A;  3OMM A;  2HB8 A;  1XOW A;  4UDB A;  3K22 A;  2Q8S A;  5APK A;  3VSO A;  1L2I A;  4QJR A;  3AUQ A;  4IW6 A;  2V7C A;  1X7R A;  2PIT A;  2ZMI A;  3OAP A;  1ZKY A;  3DZU D;  1S9P A;  5IXK A;  1MVC A;  3D57 A;  3BEJ A;  4ZI1 A;  3PEQ A;  1XP6 A;  1I37 A;  2GL8 A;  2GPO A;  4Y29 A;  3A2I A;  2XYW A;  3ADS A;  5C4U A;  5L7G A;  5M96 A;  2ZKC A;  3BQD A;  3ET0 A;  3L3X A;  3VJT A;  3X36 A;  3UVV B;  4E4K A;  3B0R A;  2B50 A;  1T5Z A;  3Q95 A;  5DX3 A;  3WT6 A;  3VJS A;  3VT3 A;  3KFC A;  3JZC A;  4XI3 A;  1WM0 X;  3UUD A;  2ZNP A;  4A4V A;  4DMA A;  2FVJ A;  1T65 A;  5DTV A;  4S0S A;  5K13 A;  2ATH A;  1I7G A;  2Q70 A;  3B65 A;  2Q1H A;  1T76 A;  3D5F A;  2PIW A;  3ERT A;  1R20 A;  4Q0A C;  5DZ3 A;  2YAT A;  1N46 A;  3PBA A;  3M7R A;  2FSZ A;  3IA6 A;  4G2H A;  4REE A;  5E0W A;  5DSH A;  5L7H A;  3OSW A;  3W5P A;  3OLF A;  1NUO A;  1ZH7 A;  3W0I A;  1ILH A;  2HFP A;  3ET2 A;  1FM6 A;  3PCU A;  3X1I A;  2J7X A;  4RZE A;  3IXP A;  3AN4 A;  2O4J A;  1YOW A;  1XQ3 A;  4FGY A;  4A2J A;  4OEY A;  1HJ1 A;  4ITF A;  1OT7 A;  5DIG A;  1RDT D;  4TUZ A;  4RAK A;  3UP3 A;  2Z4J A;  4S14 A;  3HC5 A;  2JJ3 A;  4DK7 A;  1PCG A;  5KRL A;  3OSI A;  3HO0 A;  3OZJ A;  4JGV A;  4LNW A;  3UVV A;  3R8D A;  5KRK A;  2GPV A;  4JYH A;  1XNN A;  4L98 A;  4TV1 A;  1QKN A;  5ACC A;  1GWX A;  1VJB A;  2G5O A;  3S9S A;  3ET3 A;  2YHD A;  2AMB A;  1YP0 A;  3WT7 A;  3WFF A;  4MG8 B;  4DOS A;  1S0X A;  3L1B A;  5AAV A;  3CWD A;  3UU7 B;  4REF A;  2ZFX A;  1K74 D;  2ZVT A;  3CS4 A;  1HG4 A;  3K23 A;  3H0A D;  4WHG A;  3V9T A;  4OFU A;  4Q50 A;  4J5W A;  3CTB A;  3FAL A;  3IPQ A;  3VT4 A;  1E3G A;  4IS8 A;  4E4Q A;  5JJM B;  3E00 A;  4G2I A;  2ACL A;  3AZ3 A;  3CDS A;  2AB2 A;  2B1V A;  4OIL A;  4FHI A;  1PK5 A;  5EIT A;  4PP6 A;  5DP0 A;  4OAR A;  4CI5 A;  1KV6 A;  1S0Z A;  3VJH A;  1IE8 A;  3A9E A;  5DZH A;  5DRM A;  3OMP A;  1E3K A;  1OVL A;  2JFA B;  3SP9 A;  3VTD A;  5IZ0 A;  1YJE A;  2PIU A;  5LGA A;  3RVF A;  4MGD B;  4WQP A;  1NQ7 A;  2YJA B;  5DL4 A;  2A3I A;  4POH A;  2GPP A;  4XUH A;  1NHZ A;  3A3Z X;  3W0A A;  4ZJR A;  1A28 A;  3L0L A;  3KDU A;  4L96 A;  1P8D A;  3GYT A;  2F4B A;  4IWC A;  4KZI A;  1XNX A;  2OZ7 A;  4MGA A;  2AAX A;  2Q7K A;  3GWX A;  1RKH A;  5DYD A;  3GN8 A;  4NIE A;  4RUP A;  1T73 A;  1YIM A;  5DMF A;  2R6Y A;  2AX9 A;  2HAR A;  3KWY A;  1UPV A;  5F9B A;  1T7M A;  1NAX A;  4OIU A;  4PP3 A;  3VN2 A;  3R2A A;  4MG7 A;  4PP5 A;  5SYZ A;  2XHS A;  3VSP A;  4J5X A;  4ZO1 B;  2VSR A;  2P7Z A;  1FM9 A;  4IWF A;  3FEJ A;  4K7A A;  4EMA A;  2AA7 A;  3K8S A;  1S19 A;  2BJ4 A;  1FCZ A;  3OMK A;  2J7Y A;  4G1Y A;  4OH6 A;  5KRA A;  3VT6 A;  2VV0 A;  4ZN7 A;  5E19 A;  1PQ6 A;  3VRW A;  5DX3 B;  3WJ4 A;  4ZNW A;  2H79 A;  2YFE A;  3GBK A;  1PQ9 A;  2AX6 A;  2ZK1 A;  3VRU A;  1FCX A;  5JY3 A;  3R29 A;  3HM1 A;  3P89 A;  4J5W C;  4ONI A;  1U3S A;  3D6D A;  3IPU A;  4IU7 A;  3W0G A;  2YJD A;  3WJ5 A;  1LBD A;  3MNE A;  5EHJ A;  1QKT A;  4KZM A;  4M8E A;  5DU5 A;  4MDD A;  1SKX A;  2B23 A;  2ZNQ A;  4OZT U;  4ZNT A;  5KCW A;  2I0J A;  3ILZ A;  4JYG A;  4APU A;  5L7E A;  4N5G A;  5CJ6 A;  2EWP A;  2LBD A;  3CJW A;  5AZT A;  5E15 A;  1OSV A;  3MNO A;  5JI0 D;  5HJP A;  2J4A A;  4LNX A;  5GIC A;  5G3J A;  2QGW A;  4LTW A;  4DK8 A;  4TUZ B;  1K7L A;  3T03 A;  3VT5 A;  4EM9 A;  4XT9 A;  5KRC A;  4BCR A;  3KMG A;  1ZGY A;  2XKW A;  3G8I A;  2HC4 A;  1MV9 A;  3DZU A;  1XVP A;  5HCV A;  1T79 A;  3ADT A;  1X7E A;  4TV1 B;  1ERR A;  4DQM A;  5AVL A;  4WHF A;  5G46 A;  5C4S A;  5KRO A;  3VTC A;  2R6W A;  4MG5 A;  3WGP A;  2VST A;  5KCU A;  2QPY A;  3HQ5 A;  2QE4 A;  5AAV B;  4E2J A;  4ZNS A;  5DXB A;  4POJ A;  4Q13 A;  4NY9 A;  1SJ0 A;  5DV6 A;  4JAZ A;  3FAL B;  1I38 A;  1UOM A;  2GP7 A;  4J5X C;  3SP6 A;  4ZO1 X;  2VV3 A;  2ACL B;  3OOK A;  1T74 A;  2HB7 A;  1FCY A;  2Q5P A;  3W5T A;  1XJ7 A;  2AX8 A;  2NV7 A;  3W0J A;  5DY8 A;  1T63 A;  3KMR A;  1R1K D;  3CS6 A;  1XIU A;  5E0X A;  2O9I A;  3RY9 A;  1Z95 A;  1DKF A;  3A9E B;  2QXM A;  2PIN A;  3FS1 A;  1OVL B;  2QA8 B;  2HVC A;  2QGT A;  1XPC A;  4A4W A;  2XYJ A;  3GD2 A;  1FD0 A;  4HEE X;  2AM9 A;  1M7W A;  1RDT A;  3R5M A;  4OKX A;  4RMD A;  1NAV A;  1ZUC A;  4N8R A;  2P7A A;  2OVM A;  3NOA A;  4J24 A;  1IE9 A;  3VRV A;  5KR9 A;  2AWH A;  2Q6J A;  4MG9 A;  2HWQ A;  4OJ9 A;  1YMT A;  4WLB A;  1TXI A;  5DWI A;  3B5R A;  3VT9 A;  3AFR A;  2NPA A;  1XP1 A;  4MGA B;  3D90 A;  3V49 A;  2ZXM A;  3NSP A;  2E2R A;  5DYB A;  3V9Y A;  3FC6 B;  5DV8 A;  1FBY A;  3WT5 A;  4ZJW A;  3VHU A;  1YA3 A;  3R8I A;  3B3K A;  4QM0 A;  5AVI A;  4HLW A;  3VTB A;  4OHA A;  1ILG A;  3FEI A;  4PF3 A;  1K74 A;  4NQA B;  1NQ0 A;  2R40 D;  1YIN A;  3H0A A;  1H9U A;  2IOG A;  3N00 A;  2JF9 A;  4G1D A;  4MG7 B;  4PLD A;  3PLZ A;  5DXE A;  3E7C A;  1OSH A;  2Q7L A;  3ADU A;  2P1V A;  3K6P A;  3KMZ A;  3UUA A;  4MG6 A;  4IV2 A;  5AWK A;  2NXX E;  3O1E A;  4N1Y A;  2QA8 A;  1X76 A;  2AXA A;  1QKM A;  4PPP A;  3U9Q A;  1NQ1 A;  2BJ4 B;  1ZAF A;  2QNV A;  1BSX A;  1TFC A;  3A2H A;  3A40 X;  3OS8 A;  4OK1 A;  4PWL A;  1YOK A;  4MGC A;  3L03 A;  3RUT A;  3W0Y A;  1XQC A;  2I0G A;  3VRT A;  2I4J A;  5KCT A;  3HLV A;  1G50 A;  4IA2 A;  5DUE A;  3DZY D;  1G1U A;  4RZF A;  5H1E A;  1RK3 A;  4R2U A;  4RFW A;  2VV1 B;  3E94 A;  5AK2 A;  5GT4 A;  2GTK A;  5DVC A;  4PPS A;  2QZO A;  1ZEO A;  3PRG A;  2W8Y A;  4LSJ A;  2ZXN A;  1YYE A;  5FQT A;  2O4R A;  2ZNN A;  3FC6 A;  2ZK4 A;  4WVD A;  4OED A;  2P4Y A;  4YPQ A;  4ZNU A;  5AAU A;  4OZT E;  4CSJ A;  2OCF A;  2Z4B A;  4OKW A;  3GYU A;  2HCD A;  2P15 A;  2QMV A;  4X1G A;  5DIE A;  4LBD A;  3HC6 A;  4DM8 A;  5C4O A;  5HJP B;  2QXS A;  1PZL A;  5DWJ A;  2ZBS A;  2ZLA A;  2ZK2 A;  1NYX A;  3ET1 A;  2Q61 A;  3FUG A;  5DZ1 A;  5G43 A;  3TY0 A;  4ZNV A;  3SZ1 A;  5DWG A;  2REW A;  4OC7 A;  2PIQ A;  2Q3Y A;  4B7W A;  4ZNH A;  3CDP A;  3FUR A;  3L0E A;  3F5C B;  1XVP B;  3G8O A;  1ZDT A;  5DKE A;  1T7T A;  1Z5X E;  2G44 A;  2PIV A;  3A78 A;  1Q4X A;  5DUH A;  5G45 A;  3KYT A;  4IQR A;  3WTQ A;  5E14 A;  4YMQ A;  4J26 A;  5EJV A;  4OKT A;  4XAO A;  2VV1 A;  5DI7 A;  3OKH A;  2AA6 A;  5KRH A;  3ERD A;  1L2J A;  2ZY0 A;  3AUN A;  5DXB B;  4M8H A;  2Q59 B;  3RLJ A;  4N73 A;  3W0H A;  1T7F A;  3W5R A;  4PLE A;  2I4Z A;  3OOF A;  1G2N A;  1Y0S A;  3VT7 A;  5IAW A;  4RE8 A;  5ICK A;  2PIP L;  2Q1V A;  1PDU A;  2PJL A;  4RUO X;  4X1F A;  3W0C A;  3W5Q A;  1N4H A;  1M13 A;  5I4V A;  2OAX A;  5E1C A;  3OKI A;  3OS8 C;  2P1U A;  1NQ2 A; 
#chains in the Genus database with same CATH homology
 2P7G A;  2OUZ A;  1DKF B;  3PO9 A;  3IPS A;  5LWP A;  1X7J A;  3DR1 A;  1MZN A;  2ZMH A;  3DT3 A;  2IHQ A;  3F5C A;  1NDE A;  1Z5X U;  3G9E A;  5DKS A;  2P54 A;  1UHL A;  2VV4 A;  5DXP A;  3B1M A;  3R5N A;  5HYR A;  5DXG A;  2YLP A;  3P0U A;  3AZ1 A;  1I7I A;  4PXM A;  4DM6 A;  4MGB A;  4WPF A;  3B66 A;  3KBA A;  3R8A A;  5G42 A;  3JZB A;  4MG9 B;  1XDK A;  2QSE A;  3B67 A;  5EGV A;  2PIO A;  5KCC A;  3AZ2 A;  4XHD A;  4YNK A;  3V4A A;  2PRG A;  2AX7 A;  3QT0 A;  4OEA A;  2Q59 A;  3ADW A;  4O8F A;  3ZR7 A;  4S0T A;  3V9V A;  3NSQ A;  5G5W A;  5DXK A;  5C4T A;  3WMH A;  5DRJ A;  3X1H A;  5DVS A;  5DK9 A;  5DLR A;  3HZF A;  4UDA A;  2ABI A;  3X31 A;  5APJ A;  5GID A;  2XYX A;  3ZRB A;  3TX7 B;  4FN9 A;  4OZR U;  4RWV A;  5KRF A;  3ZQT A;  4RZG A;  2QA6 A;  3RLL A;  4YT1 A;  3B68 A;  3VHV A;  5B41 A;  3V3E A;  3OLS A;  1R20 D;  3B0W A;  5DWL A;  1Y9R A;  2NW4 A;  4P6X A;  5DWE A;  2V0V A;  4KZJ A;  3ADX A;  3UUA B;  4QE6 A;  4R6S A;  2GPU A;  3WWR A;  3UUC A;  1GS4 A;  5AYG A;  1FM6 D;  1XZX X;  1R1K A;  1A52 A;  2ZXZ A;  1XB7 A;  1QKU A;  2Q5S A;  3IXP D;  2ZK0 A;  4XTA A;  5DV3 A;  4DOR A;  5GIE A;  1PQC A;  2ZLC A;  4G21 A;  3OLL A;  2I4P A;  3D24 A;  5DUG A;  2YLY A;  3VT8 A;  4OEZ A;  2QZO B;  4QE8 A;  2QAB A;  2Q5G A;  5DKB A;  5KRI A;  5AWJ A;  4P6W A;  4F9M A;  2PKL A;  2VV2 A;  5FQR A;  2PIX A;  2HWR A;  3HVL A;  3KDT A;  4FHH A;  4IUI A;  4OJ4 A;  3MNP A;  3VI8 A;  1S9Q A;  2B1Z A;  2Q7J A;  1R5K A;  1XLS E;  2AO6 A;  5E7V A;  3AUR A;  3B0T A;  1M2Z A;  4G20 A;  1PRG A;  2QTU A;  1G5Y A;  1ERE A;  2GWX A;  2POB A;  4ZOM A;  5B5B A;  2FAI A;  4OLM A;  5KCE A;  4OFR A;  1KNU A;  5FQV A;  3TKM A;  3VJI A;  3IMY A;  4RMC A;  3E00 D;  2R40 A;  4G1Z A;  3UP0 A;  3BC5 A;  2QR9 A;  2YLQ A;  2Q6R A;  3CQV A;  5EC9 A;  2PNU A;  2Q7I A;  3CLD A;  5KD9 A;  2GIU A;  1EXX A;  5KCD A;  3OGT A;  3CS8 A;  4IA3 A;  1XAP A;  4OKB A;  5DID A;  2YLO A;  2ZL9 A;  2HAS A;  1P93 A;  3DCT A;  1NRL A;  5HJS A;  3KPZ A;  5DZI A;  1N83 A;  5FQS A;  5DZ0 A;  2HBH A;  3DZY A;  1XLS A;  3LBD A;  2G0H A;  3DCU A;  1XV9 B;  4K4J A;  5DKG A;  5APH A;  5DXR A;  5HYK A;  2Q6S A;  1UPW A;  2ZK5 A;  4NB6 A;  2ZNO A;  2AA2 A;  5G44 A;  5HZC A;  1K4W A;  4R06 A;  2NXX A;  5DMC A;  3VHW A;  1RJK A;  2BAW A;  4XLD A;  2ZK6 A;  4OIV A;  4S15 A;  5EI1 A;  5KRM A;  1U3Q A;  4MG8 A;  4IW8 A;  5KCF A;  4QK4 A;  5DXQ A;  2HAM A;  1X7B A;  3UU7 A;  5A86 A;  5KRJ A;  3H52 A;  1EXA A;  3HOD A;  3RUU A;  1UHL B;  4PRG A;  3V3Q A;  2VV4 B;  1GWR A;  1YUC A;  4CI4 A;  4IVW A;  5DXM A;  1U3R A;  1U9E A;  5JJM A;  4MGB B;  2ZMJ A;  3P88 A;  2IOK A;  3FLI A;  1FM9 D;  1RKG A;  3OMQ A;  4RUJ A;  4JYI A;  4UDD A;  5KYA A;  4PVU A;  1XDK B;  2PIR A;  4ITE A;  1YY4 A;  4NUF A;  2AYR A;  2OM9 A;  1T7R A;  3P8X A;  3L0J A;  4FNE A;  1GWQ A;  1SR7 A;  2Q60 A;  4OGH A;  3LMP A;  4IA7 A;  4OH5 A;  1SQN A;  1ZDU A;  5FQP A;  1DB1 A;  1XV9 A;  2JFA A;  2POG A;  4RME A;  2ZK3 A;  5DVV A;  1X78 A;  4OZR E;  4MGD A;  3GWS X;  3Q95 B;  2AMA A;  3B0Q A;  5KYJ A;  4ZN9 A;  3TKC A;  1Y0X X;  3GZ9 A;  2QW4 A;  4IA1 A;  3UUD B;  4IV4 A;  4XUM A;  2P1T A;  1LV2 A;  2G0G A;  2H77 A;  3OMO A;  1R6G A;  3F7D A;  3L3Z A;  3OS9 A;  1XP9 A;  4K6I A;  4QL8 A;  2AA5 A;  3ADV A;  3AX8 A;  3FXV A;  4UDC A;  3WFG A;  1KKQ A;  2ZAS A;  3AN3 A;  5AZV A;  3O1D A;  2QH6 A;  5L11 A;  4JL4 A;  3A2J A;  3OSA A;  4OJB A;  2J14 A;  4IVY A;  3G0W A;  3EYB A;  5ETH A;  3ZRA A;  2OVH A;  3OZ0 A;  3DY6 A;  3OMM A;  2HB8 A;  1XOW A;  4UDB A;  3K22 A;  2Q8S A;  5APK A;  3VSO A;  1L2I A;  4QJR A;  3AUQ A;  4IW6 A;  2V7C A;  1X7R A;  2PIT A;  2ZMI A;  3OAP A;  1ZKY A;  3DZU D;  1S9P A;  5IXK A;  1MVC A;  3D57 A;  3BEJ A;  4ZI1 A;  3PEQ A;  1XP6 A;  1I37 A;  2GL8 A;  2GPO A;  4Y29 A;  3A2I A;  2XYW A;  3ADS A;  5C4U A;  5L7G A;  5M96 A;  2ZKC A;  3BQD A;  3ET0 A;  3L3X A;  3VJT A;  3X36 A;  3UVV B;  4E4K A;  3B0R A;  2B50 A;  1T5Z A;  3Q95 A;  5DX3 A;  3WT6 A;  3VJS A;  3VT3 A;  3KFC A;  3JZC A;  4XI3 A;  1WM0 X;  3UUD A;  2ZNP A;  4A4V A;  4DMA A;  2FVJ A;  1T65 A;  5DTV A;  4S0S A;  5K13 A;  2ATH A;  1I7G A;  2Q70 A;  3B65 A;  2Q1H A;  1T76 A;  3D5F A;  2PIW A;  3ERT A;  1R20 A;  4Q0A C;  5DZ3 A;  2YAT A;  1N46 A;  3PBA A;  3M7R A;  2FSZ A;  3IA6 A;  4G2H A;  4REE A;  5E0W A;  5DSH A;  5L7H A;  3OSW A;  3W5P A;  3OLF A;  1NUO A;  1ZH7 A;  3W0I A;  1ILH A;  2HFP A;  3ET2 A;  1FM6 A;  3PCU A;  3X1I A;  2J7X A;  4RZE A;  3IXP A;  3AN4 A;  2O4J A;  1YOW A;  1XQ3 A;  4FGY A;  4A2J A;  4OEY A;  1HJ1 A;  4ITF A;  1OT7 A;  5DIG A;  1RDT D;  4TUZ A;  4RAK A;  3UP3 A;  2Z4J A;  4S14 A;  3HC5 A;  2JJ3 A;  4DK7 A;  1PCG A;  5KRL A;  3OSI A;  3HO0 A;  3OZJ A;  4JGV A;  4LNW A;  3UVV A;  3R8D A;  5KRK A;  2GPV A;  4JYH A;  1XNN A;  4L98 A;  4TV1 A;  1QKN A;  5ACC A;  1GWX A;  1VJB A;  2G5O A;  3S9S A;  3ET3 A;  2YHD A;  2AMB A;  1YP0 A;  3WT7 A;  3WFF A;  4MG8 B;  4DOS A;  1S0X A;  3L1B A;  5AAV A;  3CWD A;  3UU7 B;  4REF A;  2ZFX A;  1K74 D;  2ZVT A;  3CS4 A;  1HG4 A;  3K23 A;  3H0A D;  4WHG A;  3V9T A;  4OFU A;  4Q50 A;  4J5W A;  3CTB A;  3FAL A;  3IPQ A;  3VT4 A;  1E3G A;  4IS8 A;  4E4Q A;  5JJM B;  3E00 A;  4G2I A;  2ACL A;  3AZ3 A;  3CDS A;  2AB2 A;  2B1V A;  4OIL A;  4FHI A;  1PK5 A;  5EIT A;  4PP6 A;  5DP0 A;  4OAR A;  4CI5 A;  1KV6 A;  1S0Z A;  3VJH A;  1IE8 A;  3A9E A;  5DZH A;  5DRM A;  3OMP A;  1E3K A;  1OVL A;  2JFA B;  3SP9 A;  3VTD A;  5IZ0 A;  1YJE A;  2PIU A;  5LGA A;  3RVF A;  4MGD B;  4WQP A;  1NQ7 A;  2YJA B;  5DL4 A;  2A3I A;  4POH A;  2GPP A;  4XUH A;  1NHZ A;  3A3Z X;  3W0A A;  4ZJR A;  1A28 A;  3L0L A;  3KDU A;  4L96 A;  1P8D A;  3GYT A;  2F4B A;  4IWC A;  4KZI A;  1XNX A;  2OZ7 A;  4MGA A;  2AAX A;  2Q7K A;  3GWX A;  1RKH A;  5DYD A;  3GN8 A;  4NIE A;  4RUP A;  1T73 A;  1YIM A;  5DMF A;  2R6Y A;  2AX9 A;  2HAR A;  3KWY A;  1UPV A;  5F9B A;  1T7M A;  1NAX A;  4OIU A;  4PP3 A;  3VN2 A;  3R2A A;  4MG7 A;  4PP5 A;  5SYZ A;  2XHS A;  3VSP A;  4J5X A;  4ZO1 B;  2VSR A;  2P7Z A;  1FM9 A;  4IWF A;  3FEJ A;  4K7A A;  4EMA A;  2AA7 A;  3K8S A;  1S19 A;  2BJ4 A;  1FCZ A;  3OMK A;  2J7Y A;  4G1Y A;  4OH6 A;  5KRA A;  3VT6 A;  2VV0 A;  4ZN7 A;  5E19 A;  1PQ6 A;  3VRW A;  5DX3 B;  3WJ4 A;  4ZNW A;  2H79 A;  2YFE A;  3GBK A;  1PQ9 A;  2AX6 A;  2ZK1 A;  3VRU A;  1FCX A;  5JY3 A;  3R29 A;  3HM1 A;  3P89 A;  4J5W C;  4ONI A;  1U3S A;  3D6D A;  3IPU A;  4IU7 A;  3W0G A;  2YJD A;  3WJ5 A;  1LBD A;  3MNE A;  5EHJ A;  1QKT A;  4KZM A;  4M8E A;  5DU5 A;  4MDD A;  1SKX A;  2B23 A;  2ZNQ A;  4OZT U;  4ZNT A;  5KCW A;  2I0J A;  3ILZ A;  4JYG A;  4APU A;  5L7E A;  4N5G A;  5CJ6 A;  2EWP A;  2LBD A;  3CJW A;  5AZT A;  5E15 A;  1OSV A;  3MNO A;  5JI0 D;  5HJP A;  2J4A A;  4LNX A;  5GIC A;  5G3J A;  2QGW A;  4LTW A;  4DK8 A;  4TUZ B;  1K7L A;  3T03 A;  3VT5 A;  4EM9 A;  4XT9 A;  5KRC A;  4BCR A;  3KMG A;  1ZGY A;  2XKW A;  3G8I A;  2HC4 A;  1MV9 A;  3DZU A;  1XVP A;  5HCV A;  1T79 A;  3ADT A;  1X7E A;  4TV1 B;  1ERR A;  4DQM A;  5AVL A;  4WHF A;  5G46 A;  5C4S A;  5KRO A;  3VTC A;  2R6W A;  4MG5 A;  3WGP A;  2VST A;  5KCU A;  2QPY A;  3HQ5 A;  2QE4 A;  5AAV B;  4E2J A;  4ZNS A;  5DXB A;  4POJ A;  4Q13 A;  4NY9 A;  1SJ0 A;  5DV6 A;  4JAZ A;  3FAL B;  1I38 A;  1UOM A;  2GP7 A;  4J5X C;  3SP6 A;  4ZO1 X;  2VV3 A;  2ACL B;  3OOK A;  1T74 A;  2HB7 A;  1FCY A;  2Q5P A;  3W5T A;  1XJ7 A;  2AX8 A;  2NV7 A;  3W0J A;  5DY8 A;  1T63 A;  3KMR A;  1R1K D;  3CS6 A;  1XIU A;  5E0X A;  2O9I A;  3RY9 A;  1Z95 A;  1DKF A;  3A9E B;  2QXM A;  2PIN A;  3FS1 A;  1OVL B;  2QA8 B;  2HVC A;  2QGT A;  1XPC A;  4A4W A;  2XYJ A;  3GD2 A;  1FD0 A;  4HEE X;  2AM9 A;  1M7W A;  1RDT A;  3R5M A;  4OKX A;  4RMD A;  1NAV A;  1ZUC A;  4N8R A;  2P7A A;  2OVM A;  3NOA A;  4J24 A;  1IE9 A;  3VRV A;  5KR9 A;  2AWH A;  2Q6J A;  4MG9 A;  2HWQ A;  4OJ9 A;  1YMT A;  4WLB A;  1TXI A;  5DWI A;  3B5R A;  3VT9 A;  3AFR A;  2NPA A;  1XP1 A;  4MGA B;  3D90 A;  3V49 A;  2ZXM A;  3NSP A;  2E2R A;  5DYB A;  3V9Y A;  3FC6 B;  5DV8 A;  1FBY A;  3WT5 A;  4ZJW A;  3VHU A;  1YA3 A;  3R8I A;  3B3K A;  4QM0 A;  5AVI A;  4HLW A;  3VTB A;  4OHA A;  1ILG A;  3FEI A;  4PF3 A;  1K74 A;  4NQA B;  1NQ0 A;  2R40 D;  1YIN A;  3H0A A;  1H9U A;  2IOG A;  3N00 A;  2JF9 A;  4G1D A;  4MG7 B;  4PLD A;  3PLZ A;  5DXE A;  3E7C A;  1OSH A;  2Q7L A;  3ADU A;  2P1V A;  3K6P A;  3KMZ A;  3UUA A;  4MG6 A;  4IV2 A;  5AWK A;  2NXX E;  3O1E A;  4N1Y A;  2QA8 A;  1X76 A;  2AXA A;  1QKM A;  4PPP A;  3U9Q A;  1NQ1 A;  2BJ4 B;  1ZAF A;  2QNV A;  1BSX A;  1TFC A;  3A2H A;  3A40 X;  3OS8 A;  4OK1 A;  4PWL A;  1YOK A;  4MGC A;  3L03 A;  3RUT A;  3W0Y A;  1XQC A;  2I0G A;  3VRT A;  2I4J A;  5KCT A;  3HLV A;  1G50 A;  4IA2 A;  5DUE A;  3DZY D;  1G1U A;  4RZF A;  5H1E A;  1RK3 A;  4R2U A;  4RFW A;  2VV1 B;  3E94 A;  5AK2 A;  5GT4 A;  2GTK A;  5DVC A;  4PPS A;  2QZO A;  1ZEO A;  3PRG A;  2W8Y A;  4LSJ A;  2ZXN A;  1YYE A;  5FQT A;  2O4R A;  2ZNN A;  3FC6 A;  2ZK4 A;  4WVD A;  4OED A;  2P4Y A;  4YPQ A;  4ZNU A;  5AAU A;  4OZT E;  4CSJ A;  2OCF A;  2Z4B A;  4OKW A;  3GYU A;  2HCD A;  2P15 A;  2QMV A;  4X1G A;  5DIE A;  4LBD A;  3HC6 A;  4DM8 A;  5C4O A;  5HJP B;  2QXS A;  1PZL A;  5DWJ A;  2ZBS A;  2ZLA A;  2ZK2 A;  1NYX A;  3ET1 A;  2Q61 A;  3FUG A;  5DZ1 A;  5G43 A;  3TY0 A;  4ZNV A;  3SZ1 A;  5DWG A;  2REW A;  4OC7 A;  2PIQ A;  2Q3Y A;  4B7W A;  4ZNH A;  3CDP A;  3FUR A;  3L0E A;  3F5C B;  1XVP B;  3G8O A;  1ZDT A;  5DKE A;  1T7T A;  1Z5X E;  2G44 A;  2PIV A;  3A78 A;  1Q4X A;  5DUH A;  5G45 A;  3KYT A;  4IQR A;  3WTQ A;  5E14 A;  4YMQ A;  4J26 A;  5EJV A;  4OKT A;  4XAO A;  2VV1 A;  5DI7 A;  3OKH A;  2AA6 A;  5KRH A;  3ERD A;  1L2J A;  2ZY0 A;  3AUN A;  5DXB B;  4M8H A;  2Q59 B;  3RLJ A;  4N73 A;  3W0H A;  1T7F A;  3W5R A;  4PLE A;  2I4Z A;  3OOF A;  1G2N A;  1Y0S A;  3VT7 A;  5IAW A;  4RE8 A;  5ICK A;  2PIP L;  2Q1V A;  1PDU A;  2PJL A;  4RUO X;  4X1F A;  3W0C A;  3W5Q A;  1N4H A;  1M13 A;  5I4V A;  2OAX A;  5E1C A;  3OKI A;  3OS8 C;  2P1U A;  1NQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...