4RZEA

Crystal structure analysis of the nur77 ligand binding domain, l437w,d594e mutant
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
237
structure length
232
Chain Sequence
ANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDWLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMETLPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impeding the interaction between Nur77 and p38 reduces LPS-induced inflammation.
pubmed doi rcsb
molecule keywords Nuclear receptor subfamily 4 group A member 1
molecule tags Transcription
source organism Homo sapiens
total genus 88
structure length 232
sequence length 237
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4rzeA00
2G0GA 1UOMA 5AZTA 3WMHA 1XOWA 2AX9A 2ZY0A 4B7WA 3KMGA 3GN8A 4DM6A 2REWA 4QL8A 5DXGA 3D24A 2POGA 4JYIA 5G5WA 3F5CB 3ADXA 1YJEA 2P7ZA 2VV3A 5G45A 3IXPD 1NAVA 3SZ1A 1S0ZA 2YFEA 4A2JA 1I37A 1RDTD 4PPPA 3VTDA 4OEYA 5CJ6A 5DXBA 4OGHA 4RWVA 5F9BA 3V9YA 3JZCA 2HAMA 1R5KA 2QR9A 1XDKB 3WJ5A 4RMCA 3PBAA 4REFA 5M96A 4FGYA 3GYTA 3E00A 2AXAA 4S15A 2Q60A 2VV0A 3CDPA 3FEIA 1X7RA 4IU7A 5DXEA 3VTCA 2QABA 3AFRA 3H0AA 4MG6A 5I4VA 3TKMA 2VSTA 5DV8A 3RLLA 1FD0A 3ZQTA 4OHAA 4IA1A 5E1CA 5G42A 3OKIA 1DKFA 2I0GA 5DZ3A 3R8DA 2IOGA 5AVIA 4NB6A 4M8HA 4CI5A 1OSHA 2GPPA 3ZRAA 2VV4A 4FNEA 1U3QA 3UUCA 3VRUA 3PLZA 3OLFA 1NUOA 1XP6A 3KYTA 4PF3A 3M7RA 3DT3A 3PCUA 2ZK6A 2ZK3A 3KMZA 3A2HA 5DZHA 2JJ3A 3G0WA 1T7FA 2Z4JA 5DP0A 1A52A 2ZK5A 3D90A 5DKBA 2ZNPA 3DY6A 3R8AA 4OFUA 1U3SA 5AVLA 2GPVA 3OGTA 1E3GA 4FHIA 5DXQA 3ZR7A 5DVCA 1FM6D 1PQCA 1NDEA 1XDKA 3HODA 3MNEA 3OSWA 4IW8A 4ZNWA 5DMCA 1XIUA 3T03A 2PKLA 1XLSE 2ABIA 1N46A 4IS8A 4NUFA 4PP6A 2YLQA 5EHJA 4EM9A 4N1YA 1Y0XX 5DRJA 5KRJA 2NPAA 1S19A 3VHVA 1X7BA 1KKQA 3IXPA 4RE8A 2P1UA 1Z5XE 5DZ1A 1RDTA 3RY9A 1FCXA 3KFCA 3IPUA 4REEA 4E4QA 1X76A 3D6DA 3CLDA 3L3ZA 1UPVA 2QA8B 2ZNNA 3HO0A 4OC7A 5JY3A 4IUIA 2R40D 3VJIA 2YHDA 4JGVA 3X36A 4UDBA 5DLRA 3P0UA 1H9UA 1NHZA 2HCDA 1XLSA 3BQDA 4ZNHA 3RVFA 4DK7A 5L11A 3PO9A 3X31A 1PQ9A 1X7JA 2AX7A 2AYRA 2ZXNA 4QK4A 1MVCA 2GTKA 4OZRE 5DVVA 3GD2A 5AK2A 4RZEA 4YPQA 3WJ4A 1A28A 3GWXA 2HWQA 2QE4A 4DM8A 4YNKA 3VSPA 5A86A 3B0TA 5HJPA 1G50A 4PXMA 2XYWA 1XV9B 3PRGA 5DWJA 4G2HA 4J5WA 4XHDA 4WPFA 2BJ4B 2HFPA 3CDSA 5DUHA 4HEEX 1NQ0A 1ILHA 1NQ2A 1PZLA 2QTUA 1SQNA 3A40X 5DZIA 4ZI1A 2NV7A 1T7RA 3GZ9A 5DV3A 5DXPA 4G1ZA 5DWIA 3W0CA 4DOSA 1TFCA 2XKWA 3AZ1A 2ZLCA 3A78A 4K6IA 2H79A 4OLMA 3ERDA 4OJ9A 2AB2A 5AAVB 5L7GA 2GPOA 4F9MA 1FM6A 2QA8A 1P93A 3CTBA 3VHWA 2QXSA 5DRMA 1R20D 4OFRA 4S14A 5APHA 5DI7A 3P88A 5FQTA 4JAZA 5DWLA 2O4JA 1RK3A 4QE6A 4ZOMA 2AX8A 3LMPA 3P8XA 4QM0A 3RLJA 4FN9A 3OMKA 1DKFB 4Y29A 4S0TA 2B1ZA 4A4WA 5GIEA 3RUUA 4IV4A 5DXRA 1Y0SA 2P1TA 4J26A 5DKSA 1K74D 1U9EA 3W0AA 3SP9A 2VV4B 3EYBA 5KRKA 2YLOA 3DZUD 4G1DA 1UPWA 5DIDA 5G46A 2R40A 3W5TA 3V9TA 2ZMJA 4WQPA 3HZFA 2ZXZA 4HLWA 5DV6A 5E15A 5C4SA 4R6SA 1XV9A 2HB7A 5KRHA 2BJ4A 2QZOB 2GWXA 5AWKA 5KRFA 5FQSA 2ZNQA 2P4YA 1T7MA 4MGBB 3VHUA 1QKMA 5IAWA 5E19A 3DCUA 1XQCA 4ZNUA 1HJ1A 2Q1VA 4OEAA 5DTVA 2ZK0A 3WT5A 3OOKA 5AAVA 1EXAA 5ETHA 3AN4A 4TV1B 2ZXMA 2ACLB 2AO6A 2P54A 5C4TA 2HARA 2PIQA 2YJAB 3OS9A 4IVYA 1PDUA 3W0IA 4XUHA 2YATA 5HCVA 3D5FA 1SR7A 3X1IA 4OIUA 3WT6A 5FQPA 5KCDA 2HASA 3ADSA 4FHHA 3B0RA 4Q50A 4RUPA 2W8YA 4OKXA 3V3QA 1OVLB 2Q3YA 2J14A 5EJVA 3WFFA 1IE9A 2ATHA 5KCEA 1YY4A 1XB7A 3D57A 2Q7IA 5DKGA 1Z5XU 2NW4A 1LV2A 3FUGA 2PNUA 5G43A 1RJKA 2PIWA 2ZNOA 1I7GA 2QZOA 1NQ1A 1ZUCA 1N4HA 3BC5A 1R6GA 2JF9A 3ET2A 4MGBA 5E7VA 1GWXA 3NOAA 1ZH7A 3PEQA 4RMEA 1K74A 4KZMA 3G9EA 2Q7JA 3VT3A 2Q5GA 2Q1HA 4P6WA 5DKEA 3WGPA 2P7GA 5HJPB 2R6YA 3CJWA 4MGCA 1PRGA 4ZNVA 1FM9D 4POHA 3DZUA 5DYDA 4WLBA 3R2AA 1E3KA 5E0XA 2XYJA 4TV1A 5C4OA 4OZRU 2ACLA 3FC6B 3FURA 3HC6A 2GL8A 3OZJA 4LNXA 1FBYA 4N5GA 1N83A 3AUQA 5KCWA 1S9PA 2P15A 2Q6JA 3IPQA 3V49A 2HVCA 1ILGA 3OMOA 5JJMB 2IOKA 2R6WA 3AURA 4R06A 3VT8A 3VJHA 4J5WC 4XUMA 1OVLA 4ZO1X 2J7XA 4K7AA 1XZXX 2G5OA 4WHGA 1M7WA 1QKTA 4TUZB 4XI3A 1OT7A 3G8IA 3ZRBA 2ZVTA 2HC4A 3VRWA 1YOWA 3K6PA 3FXVA 2ZMHA 3JZBA 4OKTA 4JYGA 2PIOA 4OZTE 5DWEA 3WTQA 4NIEA 4JYHA 3GYUA 4O8FA 4R2UA 3VT6A 3FALA 4L98A 1I38A 1S0XA 2LBDA 1YOKA 1XP1A 1XPCA 2QA6A 2PRGA 4E4KA 3OKHA 5DMFA 2PIPL 1T63A 5GT4A 2IHQA 3UP3A 5KCFA 5ACCA 4LBDA 5DY8A 2P1VA 2ZASA 2YLYA 4OH6A 1BSXA 3B67A 4PRGA 3UUDB 5GIDA 3V9VA 2OVMA 3DR1A 3W0GA 4NQAB 3FC6A 1R1KD 1XNXA 2Q5PA 2OAXA 2V7CA 2PIVA 4PWLA 3E7CA 2G0HA 5G3JA 3R5MA 5JJMA 3L03A 3V4AA 5DUEA 4ONIA 3CS4A 5DK9A 5HJSA 3OAPA 1FM9A 1GWRA 3L0LA 1YUCA 2AA2A 4WVDA 3VJTA 1ZDTA 1RKHA 1ZEOA 3ADTA 4OJBA 4TUZA 4XT9A 3B0WA 5KCCA 4ZN9A 3WT7A 4UDDA 2AX6A 3HM1A 5SYZA 1YYEA 3ET0A 4IQRA 1VJBA 3OLSA 3OMMA 4NY9A 5APKA 5IXKA 2NXXE 1NRLA 4J5XC 2G44A 1G1UA 3AZ2A 1YMTA 5JI0D 5DWGA 2AMAA 2EWPA 5L7EA 3UVVB 4OIVA 3HQ5A 1IE8A 3NSPA 3KBAA 3AX8A 5AYGA 4YMQA 3ADWA 4PP3A 5KYAA 4ZJWA 5KROA 5LGAA 2QPYA 3ADVA 1T7TA 1PK5A 4S0SA 3LBDA 5FQRA 2POBA 3ADUA 3OLLA 1MV9A 3ET3A 4MGAB 3K22A 3UUDA 2PIRA 2PITA 2JFAA 1PCGA 1T65A 3FLIA 5EGVA 3KDUA 4IV2A 1KV6A 1P8DA 3OS8A 4XAOA 1M13A 2NXXA 2B1VA 3VRVA 4P6XA 3R8IA 3FS1A 3VN2A 2VV1A 2FAIA 5DYBA 2ZMIA 4A4VA 1EREA 3E94A 3K23A 5DIEA 4J5XA 2PIXA 2GP7A 2AA5A 2YLPA 4IA7A 2AAXA 1XQ3A 2ZKCA 3HC5A 1T76A 4MGDB 3W0JA 1FCYA 1R1KA 5EITA 1G5YA 3IPSA 4G20A 1Y9RA 4PPSA 4MDDA 3L0JA 4OK1A 5DU5A 4MG7B 3HVLA 3QT0A 3CS8A 4RAKA 2OVHA 4RZGA 1ZKYA 1L2JA 3OSAA 5KRMA 3UVVA 2YJDA 4EMAA 3NSQA 3A2IA 3B66A 3Q95B 2Q59A 4MG8A 1YA3A 4Q0AC 5DVSA 5C4UA 5HYRA 2HWRA 2ZK2A 4K4JA 1WM0X 1XNNA 3B5RA 2BAWA 1R20A 3B1MA 3L3XA 1S9QA 1XVPB 4MGAA 4MG9A 4OILA 3B68A 3L0EA 2GIUA 2HB8A 3R29A 2AM9A 2B23A 3UU7B 5KR9A 2QXMA 3VT9A 3FALB 4IWCA 2QH6A 3TKCA 3RUTA 2FSZA 2ZK1A 3B3KA 4DORA 4DMAA 3UP0A 1XP9A 3U9QA 3OZ0A 3W5PA 4PP5A 4KZIA 2F4BA 3VRTA 4LSJA 4RUOX 2VV2A 4OZTU 4ZO1B 2AWHA 5AAUA 2PINA 2ZBSA 1LBDA 3W0HA 1G2NA 1T79A 4M8EA 3OMQA 2OUZA 4MGDA 2QGWA 3CWDA 2B50A 3MNPA 4LNWA 2QGTA 3H52A 4QJRA 4DQMA 1K7LA 2V0VA 4ZN7A 3KWYA 3W0YA 1L2IA 3K8SA 4X1GA 5L7HA 1ZDUA 2I4ZA 4MG7A 4N8RA 2Q8SA 1SJ0A 3F5CA 5KCUA 1X78A 5AWJA 1QKUA 2PJLA 2ZL9A 1KNUA 4JL4A 5B41A 4XLDA 1UHLB 2OCFA 4PVUA 1GS4A 5DX3B 5APJA 5EI1A 3MNOA 5AZVA 3KPZA 3Q95A 4LTWA 1T73A 2Z4BA 1RKGA 4G2IA 1T5ZA 2VSRA 3ILZA 1XVPA 4J24A 1EXXA 1XAPA 1K4WA 5H1EA 4OARA 2Q5SA 5G44A 4IWFA 1NYXA 3UU7A 3OMPA 5KRLA 1FCZA 3VT4A 5DSHA 2PIUA 3O1DA 3OSIA 1ZGYA 3B65A 4YT1A 5HYKA 2J4AA 3ET1A 2GPUA 2O4RA 3AZ3A 3IA6A 3AUNA 4PLDA 1YINA 3DZYD 5DXKA 4RUJA 4RZFA 1NQ7A 2QNVA 4G1YA 1Q4XA 3AN3A 1YIMA 2JFAB 3A9EB 3N00A 5B5BA 3UUAB 3V3EA 4OEDA 4ZNTA 1M2ZA 3WFGA 1OSVA 3W5QA 2XYXA 4UDCA 3BEJA 3P89A 4BCRA 4L96A 5KRCA 2VV1B 1YP0A 5IZ0A 4N73A 5FQVA 3R5NA 4DK8A 3ERTA 5KYJA 1TXIA 4IA3A 5DL4A 4Q13A 2O9IA 1UHLA 3OS8C 3A2JA 5DX3A 3FEJA 2Q61A 1X7EA 4X1FA 2OZ7A 5LWPA 2AA6A 2Q6RA 1NAXA 4MG5A 5KD9A 3E00D 2A3IA 2ZFXA 1HG4A 3CQVA 3B0QA 2I4JA 1PQ6A 2OM9A 2AA7A 3H0AD 4RFWA 4RMDA 1ERRA 5HZCA 4KZJA 3VJSA 4CI4A 5EC9A 5KRIA 1GWQA 1QKNA 5DXBB 5E14A 2Q6SA 1T74A 4OKWA 2ZLAA 2Q59B 4MG8B 4E2JA 1U3RA 2QW4A 3KMRA 1ZAFA 3DCTA 5DIGA 5KRAA 2P7AA 3VT7A 3VSOA 3HLVA 3VT5A 2E2RA 4OJ4A 3A3ZX 4CSJA 4MG9B 3IMYA 2HBHA 4IA2A 4ITEA 4QE8A 2QSEA 1MZNA 1SKXA 1DB1A 2ZK4A 3A9EA 4PLEA 4WHFA 2FVJA 3UUAA 5KCTA 3L1BA 3W5RA 2Q7LA 2XHSA 4ZJRA 3VI8A 4OH5A 5K13A 5DXMA 3O1EA 5DUGA 5GICA 3S9SA 4G21A 3GBKA 4ZNSA 4POJA 3GWSX 5E0WA 3VTBA 3G8OA 3SP6A 1I7IA 2AMBA 2I0JA 4APUA 3TX7B 2Q7KA 1Z95A 4IW6A 4UDAA 3DZYA 3KDTA 5ICKA 4OKBA 1XJ7A 3TY0A 3F7DA 3OOFA 5DZ0A 2I4PA 2H77A 2J7YA 2Q70A 3CS6A 4XTAA 3X1HA 4OEZA 3WWRA 4IVWA 4ITFA 2QMVA
chains in the Genus database with same CATH superfamily
2G0GA 1UOMA 5AZTA 3WMHA 1XOWA 2AX9A 2ZY0A 4B7WA 3KMGA 3GN8A 4DM6A 2REWA 4QL8A 5DXGA 3D24A 2POGA 4JYIA 5G5WA 3F5CB 3ADXA 1YJEA 2P7ZA 2VV3A 5G45A 3IXPD 1NAVA 3SZ1A 1S0ZA 2YFEA 4A2JA 1I37A 1RDTD 4PPPA 3VTDA 4OEYA 5CJ6A 5DXBA 4OGHA 4RWVA 5F9BA 3V9YA 3JZCA 2HAMA 1R5KA 2QR9A 1XDKB 3WJ5A 4RMCA 3PBAA 4REFA 5M96A 4FGYA 3GYTA 3E00A 2AXAA 4S15A 2Q60A 2VV0A 3CDPA 3FEIA 1X7RA 4IU7A 5DXEA 3VTCA 2QABA 3AFRA 3H0AA 4MG6A 5I4VA 3TKMA 2VSTA 5DV8A 3RLLA 1FD0A 3ZQTA 4OHAA 4IA1A 5E1CA 5G42A 3OKIA 1DKFA 2I0GA 5DZ3A 3R8DA 2IOGA 5AVIA 4NB6A 4M8HA 4CI5A 1OSHA 2GPPA 3ZRAA 2VV4A 4FNEA 1U3QA 3UUCA 3VRUA 3PLZA 3OLFA 1NUOA 1XP6A 3KYTA 4PF3A 3M7RA 3DT3A 3PCUA 2ZK6A 2ZK3A 3KMZA 3A2HA 5DZHA 2JJ3A 3G0WA 1T7FA 2Z4JA 5DP0A 1A52A 2ZK5A 3D90A 5DKBA 2ZNPA 3DY6A 3R8AA 4OFUA 1U3SA 5AVLA 2GPVA 3OGTA 1E3GA 4FHIA 5DXQA 3ZR7A 5DVCA 1FM6D 1PQCA 1NDEA 1XDKA 3HODA 3MNEA 3OSWA 4IW8A 4ZNWA 5DMCA 1XIUA 3T03A 2PKLA 1XLSE 2ABIA 1N46A 4IS8A 4NUFA 4PP6A 2YLQA 5EHJA 4EM9A 4N1YA 1Y0XX 5DRJA 5KRJA 2NPAA 1S19A 3VHVA 1X7BA 1KKQA 3IXPA 4RE8A 2P1UA 1Z5XE 5DZ1A 1RDTA 3RY9A 1FCXA 3KFCA 3IPUA 4REEA 4E4QA 1X76A 3D6DA 3CLDA 3L3ZA 1UPVA 2QA8B 2ZNNA 3HO0A 4OC7A 5JY3A 4IUIA 2R40D 3VJIA 2YHDA 4JGVA 3X36A 4UDBA 5DLRA 3P0UA 1H9UA 1NHZA 2HCDA 1XLSA 3BQDA 4ZNHA 3RVFA 4DK7A 5L11A 3PO9A 3X31A 1PQ9A 1X7JA 2AX7A 2AYRA 2ZXNA 4QK4A 1MVCA 2GTKA 4OZRE 5DVVA 3GD2A 5AK2A 4RZEA 4YPQA 3WJ4A 1A28A 3GWXA 2HWQA 2QE4A 4DM8A 4YNKA 3VSPA 5A86A 3B0TA 5HJPA 1G50A 4PXMA 2XYWA 1XV9B 3PRGA 5DWJA 4G2HA 4J5WA 4XHDA 4WPFA 2BJ4B 2HFPA 3CDSA 5DUHA 4HEEX 1NQ0A 1ILHA 1NQ2A 1PZLA 2QTUA 1SQNA 3A40X 5DZIA 4ZI1A 2NV7A 1T7RA 3GZ9A 5DV3A 5DXPA 4G1ZA 5DWIA 3W0CA 4DOSA 1TFCA 2XKWA 3AZ1A 2ZLCA 3A78A 4K6IA 2H79A 4OLMA 3ERDA 4OJ9A 2AB2A 5AAVB 5L7GA 2GPOA 4F9MA 1FM6A 2QA8A 1P93A 3CTBA 3VHWA 2QXSA 5DRMA 1R20D 4OFRA 4S14A 5APHA 5DI7A 3P88A 5FQTA 4JAZA 5DWLA 2O4JA 1RK3A 4QE6A 4ZOMA 2AX8A 3LMPA 3P8XA 4QM0A 3RLJA 4FN9A 3OMKA 1DKFB 4Y29A 4S0TA 2B1ZA 4A4WA 5GIEA 3RUUA 4IV4A 5DXRA 1Y0SA 2P1TA 4J26A 5DKSA 1K74D 1U9EA 3W0AA 3SP9A 2VV4B 3EYBA 5KRKA 2YLOA 3DZUD 4G1DA 1UPWA 5DIDA 5G46A 2R40A 3W5TA 3V9TA 2ZMJA 4WQPA 3HZFA 2ZXZA 4HLWA 5DV6A 5E15A 5C4SA 4R6SA 1XV9A 2HB7A 5KRHA 2BJ4A 2QZOB 2GWXA 5AWKA 5KRFA 5FQSA 2ZNQA 2P4YA 1T7MA 4MGBB 3VHUA 1QKMA 5IAWA 5E19A 3DCUA 1XQCA 4ZNUA 1HJ1A 2Q1VA 4OEAA 5DTVA 2ZK0A 3WT5A 3OOKA 5AAVA 1EXAA 5ETHA 3AN4A 4TV1B 2ZXMA 2ACLB 2AO6A 2P54A 5C4TA 2HARA 2PIQA 2YJAB 3OS9A 4IVYA 1PDUA 3W0IA 4XUHA 2YATA 5HCVA 3D5FA 1SR7A 3X1IA 4OIUA 3WT6A 5FQPA 5KCDA 2HASA 3ADSA 4FHHA 3B0RA 4Q50A 4RUPA 2W8YA 4OKXA 3V3QA 1OVLB 2Q3YA 2J14A 5EJVA 3WFFA 1IE9A 2ATHA 5KCEA 1YY4A 1XB7A 3D57A 2Q7IA 5DKGA 1Z5XU 2NW4A 1LV2A 3FUGA 2PNUA 5G43A 1RJKA 2PIWA 2ZNOA 1I7GA 2QZOA 1NQ1A 1ZUCA 1N4HA 3BC5A 1R6GA 2JF9A 3ET2A 4MGBA 5E7VA 1GWXA 3NOAA 1ZH7A 3PEQA 4RMEA 1K74A 4KZMA 3G9EA 2Q7JA 3VT3A 2Q5GA 2Q1HA 4P6WA 5DKEA 3WGPA 2P7GA 5HJPB 2R6YA 3CJWA 4MGCA 1PRGA 4ZNVA 1FM9D 4POHA 3DZUA 5DYDA 4WLBA 3R2AA 1E3KA 5E0XA 2XYJA 4TV1A 5C4OA 4OZRU 2ACLA 3FC6B 3FURA 3HC6A 2GL8A 3OZJA 4LNXA 1FBYA 4N5GA 1N83A 3AUQA 5KCWA 1S9PA 2P15A 2Q6JA 3IPQA 3V49A 2HVCA 1ILGA 3OMOA 5JJMB 2IOKA 2R6WA 3AURA 4R06A 3VT8A 3VJHA 4J5WC 4XUMA 1OVLA 4ZO1X 2J7XA 4K7AA 1XZXX 2G5OA 4WHGA 1M7WA 1QKTA 4TUZB 4XI3A 1OT7A 3G8IA 3ZRBA 2ZVTA 2HC4A 3VRWA 1YOWA 3K6PA 3FXVA 2ZMHA 3JZBA 4OKTA 4JYGA 2PIOA 4OZTE 5DWEA 3WTQA 4NIEA 4JYHA 3GYUA 4O8FA 4R2UA 3VT6A 3FALA 4L98A 1I38A 1S0XA 2LBDA 1YOKA 1XP1A 1XPCA 2QA6A 2PRGA 4E4KA 3OKHA 5DMFA 2PIPL 1T63A 5GT4A 2IHQA 3UP3A 5KCFA 5ACCA 4LBDA 5DY8A 2P1VA 2ZASA 2YLYA 4OH6A 1BSXA 3B67A 4PRGA 3UUDB 5GIDA 3V9VA 2OVMA 3DR1A 3W0GA 4NQAB 3FC6A 1R1KD 1XNXA 2Q5PA 2OAXA 2V7CA 2PIVA 4PWLA 3E7CA 2G0HA 5G3JA 3R5MA 5JJMA 3L03A 3V4AA 5DUEA 4ONIA 3CS4A 5DK9A 5HJSA 3OAPA 1FM9A 1GWRA 3L0LA 1YUCA 2AA2A 4WVDA 3VJTA 1ZDTA 1RKHA 1ZEOA 3ADTA 4OJBA 4TUZA 4XT9A 3B0WA 5KCCA 4ZN9A 3WT7A 4UDDA 2AX6A 3HM1A 5SYZA 1YYEA 3ET0A 4IQRA 1VJBA 3OLSA 3OMMA 4NY9A 5APKA 5IXKA 2NXXE 1NRLA 4J5XC 2G44A 1G1UA 3AZ2A 1YMTA 5JI0D 5DWGA 2AMAA 2EWPA 5L7EA 3UVVB 4OIVA 3HQ5A 1IE8A 3NSPA 3KBAA 3AX8A 5AYGA 4YMQA 3ADWA 4PP3A 5KYAA 4ZJWA 5KROA 5LGAA 2QPYA 3ADVA 1T7TA 1PK5A 4S0SA 3LBDA 5FQRA 2POBA 3ADUA 3OLLA 1MV9A 3ET3A 4MGAB 3K22A 3UUDA 2PIRA 2PITA 2JFAA 1PCGA 1T65A 3FLIA 5EGVA 3KDUA 4IV2A 1KV6A 1P8DA 3OS8A 4XAOA 1M13A 2NXXA 2B1VA 3VRVA 4P6XA 3R8IA 3FS1A 3VN2A 2VV1A 2FAIA 5DYBA 2ZMIA 4A4VA 1EREA 3E94A 3K23A 5DIEA 4J5XA 2PIXA 2GP7A 2AA5A 2YLPA 4IA7A 2AAXA 1XQ3A 2ZKCA 3HC5A 1T76A 4MGDB 3W0JA 1FCYA 1R1KA 5EITA 1G5YA 3IPSA 4G20A 1Y9RA 4PPSA 4MDDA 3L0JA 4OK1A 5DU5A 4MG7B 3HVLA 3QT0A 3CS8A 4RAKA 2OVHA 4RZGA 1ZKYA 1L2JA 3OSAA 5KRMA 3UVVA 2YJDA 4EMAA 3NSQA 3A2IA 3B66A 3Q95B 2Q59A 4MG8A 1YA3A 4Q0AC 5DVSA 5C4UA 5HYRA 2HWRA 2ZK2A 4K4JA 1WM0X 1XNNA 3B5RA 2BAWA 1R20A 3B1MA 3L3XA 1S9QA 1XVPB 4MGAA 4MG9A 4OILA 3B68A 3L0EA 2GIUA 2HB8A 3R29A 2AM9A 2B23A 3UU7B 5KR9A 2QXMA 3VT9A 3FALB 4IWCA 2QH6A 3TKCA 3RUTA 2FSZA 2ZK1A 3B3KA 4DORA 4DMAA 3UP0A 1XP9A 3U9QA 3OZ0A 3W5PA 4PP5A 4KZIA 2F4BA 3VRTA 4LSJA 4RUOX 2VV2A 4OZTU 4ZO1B 2AWHA 5AAUA 2PINA 2ZBSA 1LBDA 3W0HA 1G2NA 1T79A 4M8EA 3OMQA 2OUZA 4MGDA 2QGWA 3CWDA 2B50A 3MNPA 4LNWA 2QGTA 3H52A 4QJRA 4DQMA 1K7LA 2V0VA 4ZN7A 3KWYA 3W0YA 1L2IA 3K8SA 4X1GA 5L7HA 1ZDUA 2I4ZA 4MG7A 4N8RA 2Q8SA 1SJ0A 3F5CA 5KCUA 1X78A 5AWJA 1QKUA 2PJLA 2ZL9A 1KNUA 4JL4A 5B41A 4XLDA 1UHLB 2OCFA 4PVUA 1GS4A 5DX3B 5APJA 5EI1A 3MNOA 5AZVA 3KPZA 3Q95A 4LTWA 1T73A 2Z4BA 1RKGA 4G2IA 1T5ZA 2VSRA 3ILZA 1XVPA 4J24A 1EXXA 1XAPA 1K4WA 5H1EA 4OARA 2Q5SA 5G44A 4IWFA 1NYXA 3UU7A 3OMPA 5KRLA 1FCZA 3VT4A 5DSHA 2PIUA 3O1DA 3OSIA 1ZGYA 3B65A 4YT1A 5HYKA 2J4AA 3ET1A 2GPUA 2O4RA 3AZ3A 3IA6A 3AUNA 4PLDA 1YINA 3DZYD 5DXKA 4RUJA 4RZFA 1NQ7A 2QNVA 4G1YA 1Q4XA 3AN3A 1YIMA 2JFAB 3A9EB 3N00A 5B5BA 3UUAB 3V3EA 4OEDA 4ZNTA 1M2ZA 3WFGA 1OSVA 3W5QA 2XYXA 4UDCA 3BEJA 3P89A 4BCRA 4L96A 5KRCA 2VV1B 1YP0A 5IZ0A 4N73A 5FQVA 3R5NA 4DK8A 3ERTA 5KYJA 1TXIA 4IA3A 5DL4A 4Q13A 2O9IA 1UHLA 3OS8C 3A2JA 5DX3A 3FEJA 2Q61A 1X7EA 4X1FA 2OZ7A 5LWPA 2AA6A 2Q6RA 1NAXA 4MG5A 5KD9A 3E00D 2A3IA 2ZFXA 1HG4A 3CQVA 3B0QA 2I4JA 1PQ6A 2OM9A 2AA7A 3H0AD 4RFWA 4RMDA 1ERRA 5HZCA 4KZJA 3VJSA 4CI4A 5EC9A 5KRIA 1GWQA 1QKNA 5DXBB 5E14A 2Q6SA 1T74A 4OKWA 2ZLAA 2Q59B 4MG8B 4E2JA 1U3RA 2QW4A 3KMRA 1ZAFA 3DCTA 5DIGA 5KRAA 2P7AA 3VT7A 3VSOA 3HLVA 3VT5A 2E2RA 4OJ4A 3A3ZX 4CSJA 4MG9B 3IMYA 2HBHA 4IA2A 4ITEA 4QE8A 2QSEA 1MZNA 1SKXA 1DB1A 2ZK4A 3A9EA 4PLEA 4WHFA 2FVJA 3UUAA 5KCTA 3L1BA 3W5RA 2Q7LA 2XHSA 4ZJRA 3VI8A 4OH5A 5K13A 5DXMA 3O1EA 5DUGA 5GICA 3S9SA 4G21A 3GBKA 4ZNSA 4POJA 3GWSX 5E0WA 3VTBA 3G8OA 3SP6A 1I7IA 2AMBA 2I0JA 4APUA 3TX7B 2Q7KA 1Z95A 4IW6A 4UDAA 3DZYA 3KDTA 5ICKA 4OKBA 1XJ7A 3TY0A 3F7DA 3OOFA 5DZ0A 2I4PA 2H77A 2J7YA 2Q70A 3CS6A 4XTAA 3X1HA 4OEZA 3WWRA 4IVWA 4ITFA 2QMVA
chains in the Genus database with same CATH topology
2G0GA 1UOMA 5AZTA 3WMHA 1XOWA 2AX9A 2ZY0A 4B7WA 3KMGA 3GN8A 4DM6A 2REWA 4QL8A 5DXGA 3D24A 2POGA 4JYIA 5G5WA 3F5CB 3ADXA 1YJEA 2P7ZA 2VV3A 5G45A 3IXPD 1NAVA 3SZ1A 1S0ZA 2YFEA 4A2JA 1I37A 1RDTD 4PPPA 3VTDA 4OEYA 5CJ6A 5DXBA 4OGHA 4RWVA 5F9BA 3V9YA 3JZCA 2HAMA 1R5KA 2QR9A 1XDKB 3WJ5A 4RMCA 3PBAA 4REFA 5M96A 4FGYA 3GYTA 3E00A 2AXAA 4S15A 2Q60A 2VV0A 3CDPA 3FEIA 1X7RA 4IU7A 5DXEA 3VTCA 2QABA 3AFRA 3H0AA 4MG6A 5I4VA 3TKMA 2VSTA 5DV8A 3RLLA 1FD0A 3ZQTA 4OHAA 4IA1A 5E1CA 5G42A 3OKIA 1DKFA 2I0GA 5DZ3A 3R8DA 2IOGA 5AVIA 4NB6A 4M8HA 4CI5A 1OSHA 2GPPA 3ZRAA 2VV4A 4FNEA 1U3QA 3UUCA 3VRUA 3PLZA 3OLFA 1NUOA 1XP6A 3KYTA 4PF3A 3M7RA 3DT3A 3PCUA 2ZK6A 2ZK3A 3KMZA 3A2HA 5DZHA 2JJ3A 3G0WA 1T7FA 2Z4JA 5DP0A 1A52A 2ZK5A 3D90A 5DKBA 2ZNPA 3DY6A 3R8AA 4OFUA 1U3SA 5AVLA 2GPVA 3OGTA 1E3GA 4FHIA 5DXQA 3ZR7A 5DVCA 1FM6D 1PQCA 1NDEA 1XDKA 3HODA 3MNEA 3OSWA 4IW8A 4ZNWA 5DMCA 1XIUA 3T03A 2PKLA 1XLSE 2ABIA 1N46A 4IS8A 4NUFA 4PP6A 2YLQA 5EHJA 4EM9A 4N1YA 1Y0XX 5DRJA 5KRJA 2NPAA 1S19A 3VHVA 1X7BA 1KKQA 3IXPA 4RE8A 2P1UA 1Z5XE 5DZ1A 1RDTA 3RY9A 1FCXA 3KFCA 3IPUA 4REEA 4E4QA 1X76A 3D6DA 3CLDA 3L3ZA 1UPVA 2QA8B 2ZNNA 3HO0A 4OC7A 5JY3A 4IUIA 2R40D 3VJIA 2YHDA 4JGVA 3X36A 4UDBA 5DLRA 3P0UA 1H9UA 1NHZA 2HCDA 1XLSA 3BQDA 4ZNHA 3RVFA 4DK7A 5L11A 3PO9A 3X31A 1PQ9A 1X7JA 2AX7A 2AYRA 2ZXNA 4QK4A 1MVCA 2GTKA 4OZRE 5DVVA 3GD2A 5AK2A 4RZEA 4YPQA 3WJ4A 1A28A 3GWXA 2HWQA 2QE4A 4DM8A 4YNKA 3VSPA 5A86A 3B0TA 5HJPA 1G50A 4PXMA 2XYWA 1XV9B 3PRGA 5DWJA 4G2HA 4J5WA 4XHDA 4WPFA 2BJ4B 2HFPA 3CDSA 5DUHA 4HEEX 1NQ0A 1ILHA 1NQ2A 1PZLA 2QTUA 1SQNA 3A40X 5DZIA 4ZI1A 2NV7A 1T7RA 3GZ9A 5DV3A 5DXPA 4G1ZA 5DWIA 3W0CA 4DOSA 1TFCA 2XKWA 3AZ1A 2ZLCA 3A78A 4K6IA 2H79A 4OLMA 3ERDA 4OJ9A 2AB2A 5AAVB 5L7GA 2GPOA 4F9MA 1FM6A 2QA8A 1P93A 3CTBA 3VHWA 2QXSA 5DRMA 1R20D 4OFRA 4S14A 5APHA 5DI7A 3P88A 5FQTA 4JAZA 5DWLA 2O4JA 1RK3A 4QE6A 4ZOMA 2AX8A 3LMPA 3P8XA 4QM0A 3RLJA 4FN9A 3OMKA 1DKFB 4Y29A 4S0TA 2B1ZA 4A4WA 5GIEA 3RUUA 4IV4A 5DXRA 1Y0SA 2P1TA 4J26A 5DKSA 1K74D 1U9EA 3W0AA 3SP9A 2VV4B 3EYBA 5KRKA 2YLOA 3DZUD 4G1DA 1UPWA 5DIDA 5G46A 2R40A 3W5TA 3V9TA 2ZMJA 4WQPA 3HZFA 2ZXZA 4HLWA 5DV6A 5E15A 5C4SA 4R6SA 1XV9A 2HB7A 5KRHA 2BJ4A 2QZOB 2GWXA 5AWKA 5KRFA 5FQSA 2ZNQA 2P4YA 1T7MA 4MGBB 3VHUA 1QKMA 5IAWA 5E19A 3DCUA 1XQCA 4ZNUA 1HJ1A 2Q1VA 4OEAA 5DTVA 2ZK0A 3WT5A 3OOKA 5AAVA 1EXAA 5ETHA 3AN4A 4TV1B 2ZXMA 2ACLB 2AO6A 2P54A 5C4TA 2HARA 2PIQA 2YJAB 3OS9A 4IVYA 1PDUA 3W0IA 4XUHA 2YATA 5HCVA 3D5FA 1SR7A 3X1IA 4OIUA 3WT6A 5FQPA 5KCDA 2HASA 3ADSA 4FHHA 3B0RA 4Q50A 4RUPA 2W8YA 4OKXA 3V3QA 1OVLB 2Q3YA 2J14A 5EJVA 3WFFA 1IE9A 2ATHA 5KCEA 1YY4A 1XB7A 3D57A 2Q7IA 5DKGA 1Z5XU 2NW4A 1LV2A 3FUGA 2PNUA 5G43A 1RJKA 2PIWA 2ZNOA 1I7GA 2QZOA 1NQ1A 1ZUCA 1N4HA 3BC5A 1R6GA 2JF9A 3ET2A 4MGBA 5E7VA 1GWXA 3NOAA 1ZH7A 3PEQA 4RMEA 1K74A 4KZMA 3G9EA 2Q7JA 3VT3A 2Q5GA 2Q1HA 4P6WA 5DKEA 3WGPA 2P7GA 5HJPB 2R6YA 3CJWA 4MGCA 1PRGA 4ZNVA 1FM9D 4POHA 3DZUA 5DYDA 4WLBA 3R2AA 1E3KA 5E0XA 2XYJA 4TV1A 5C4OA 4OZRU 2ACLA 3FC6B 3FURA 3HC6A 2GL8A 3OZJA 4LNXA 1FBYA 4N5GA 1N83A 3AUQA 5KCWA 1S9PA 2P15A 2Q6JA 3IPQA 3V49A 2HVCA 1ILGA 3OMOA 5JJMB 2IOKA 2R6WA 3AURA 4R06A 3VT8A 3VJHA 4J5WC 4XUMA 1OVLA 4ZO1X 2J7XA 4K7AA 1XZXX 2G5OA 4WHGA 1M7WA 1QKTA 4TUZB 4XI3A 1OT7A 3G8IA 3ZRBA 2ZVTA 2HC4A 3VRWA 1YOWA 3K6PA 3FXVA 2ZMHA 3JZBA 4OKTA 4JYGA 2PIOA 4OZTE 5DWEA 3WTQA 4NIEA 4JYHA 3GYUA 4O8FA 4R2UA 3VT6A 3FALA 4L98A 1I38A 1S0XA 2LBDA 1YOKA 1XP1A 1XPCA 2QA6A 2PRGA 4E4KA 3OKHA 5DMFA 2PIPL 1T63A 5GT4A 2IHQA 3UP3A 5KCFA 5ACCA 4LBDA 5DY8A 2P1VA 2ZASA 2YLYA 4OH6A 1BSXA 3B67A 4PRGA 3UUDB 5GIDA 3V9VA 2OVMA 3DR1A 3W0GA 4NQAB 3FC6A 1R1KD 1XNXA 2Q5PA 2OAXA 2V7CA 2PIVA 4PWLA 3E7CA 2G0HA 5G3JA 3R5MA 5JJMA 3L03A 3V4AA 5DUEA 4ONIA 3CS4A 5DK9A 5HJSA 3OAPA 1FM9A 1GWRA 3L0LA 1YUCA 2AA2A 4WVDA 3VJTA 1ZDTA 1RKHA 1ZEOA 3ADTA 4OJBA 4TUZA 4XT9A 3B0WA 5KCCA 4ZN9A 3WT7A 4UDDA 2AX6A 3HM1A 5SYZA 1YYEA 3ET0A 4IQRA 1VJBA 3OLSA 3OMMA 4NY9A 5APKA 5IXKA 2NXXE 1NRLA 4J5XC 2G44A 1G1UA 3AZ2A 1YMTA 5JI0D 5DWGA 2AMAA 2EWPA 5L7EA 3UVVB 4OIVA 3HQ5A 1IE8A 3NSPA 3KBAA 3AX8A 5AYGA 4YMQA 3ADWA 4PP3A 5KYAA 4ZJWA 5KROA 5LGAA 2QPYA 3ADVA 1T7TA 1PK5A 4S0SA 3LBDA 5FQRA 2POBA 3ADUA 3OLLA 1MV9A 3ET3A 4MGAB 3K22A 3UUDA 2PIRA 2PITA 2JFAA 1PCGA 1T65A 3FLIA 5EGVA 3KDUA 4IV2A 1KV6A 1P8DA 3OS8A 4XAOA 1M13A 2NXXA 2B1VA 3VRVA 4P6XA 3R8IA 3FS1A 3VN2A 2VV1A 2FAIA 5DYBA 2ZMIA 4A4VA 1EREA 3E94A 3K23A 5DIEA 4J5XA 2PIXA 2GP7A 2AA5A 2YLPA 4IA7A 2AAXA 1XQ3A 2ZKCA 3HC5A 1T76A 4MGDB 3W0JA 1FCYA 1R1KA 5EITA 1G5YA 3IPSA 4G20A 1Y9RA 4PPSA 4MDDA 3L0JA 4OK1A 5DU5A 4MG7B 3HVLA 3QT0A 3CS8A 4RAKA 2OVHA 4RZGA 1ZKYA 1L2JA 3OSAA 5KRMA 3UVVA 2YJDA 4EMAA 3NSQA 3A2IA 3B66A 3Q95B 2Q59A 4MG8A 1YA3A 4Q0AC 5DVSA 5C4UA 5HYRA 2HWRA 2ZK2A 4K4JA 1WM0X 1XNNA 3B5RA 2BAWA 1R20A 3B1MA 3L3XA 1S9QA 1XVPB 4MGAA 4MG9A 4OILA 3B68A 3L0EA 2GIUA 2HB8A 3R29A 2AM9A 2B23A 3UU7B 5KR9A 2QXMA 3VT9A 3FALB 4IWCA 2QH6A 3TKCA 3RUTA 2FSZA 2ZK1A 3B3KA 4DORA 4DMAA 3UP0A 1XP9A 3U9QA 3OZ0A 3W5PA 4PP5A 4KZIA 2F4BA 3VRTA 4LSJA 4RUOX 2VV2A 4OZTU 4ZO1B 2AWHA 5AAUA 2PINA 2ZBSA 1LBDA 3W0HA 1G2NA 1T79A 4M8EA 3OMQA 2OUZA 4MGDA 2QGWA 3CWDA 2B50A 3MNPA 4LNWA 2QGTA 3H52A 4QJRA 4DQMA 1K7LA 2V0VA 4ZN7A 3KWYA 3W0YA 1L2IA 3K8SA 4X1GA 5L7HA 1ZDUA 2I4ZA 4MG7A 4N8RA 2Q8SA 1SJ0A 3F5CA 5KCUA 1X78A 5AWJA 1QKUA 2PJLA 2ZL9A 1KNUA 4JL4A 5B41A 4XLDA 1UHLB 2OCFA 4PVUA 1GS4A 5DX3B 5APJA 5EI1A 3MNOA 5AZVA 3KPZA 3Q95A 4LTWA 1T73A 2Z4BA 1RKGA 4G2IA 1T5ZA 2VSRA 3ILZA 1XVPA 4J24A 1EXXA 1XAPA 1K4WA 5H1EA 4OARA 2Q5SA 5G44A 4IWFA 1NYXA 3UU7A 3OMPA 5KRLA 1FCZA 3VT4A 5DSHA 2PIUA 3O1DA 3OSIA 1ZGYA 3B65A 4YT1A 5HYKA 2J4AA 3ET1A 2GPUA 2O4RA 3AZ3A 3IA6A 3AUNA 4PLDA 1YINA 3DZYD 5DXKA 4RUJA 4RZFA 1NQ7A 2QNVA 4G1YA 1Q4XA 3AN3A 1YIMA 2JFAB 3A9EB 3N00A 5B5BA 3UUAB 3V3EA 4OEDA 4ZNTA 1M2ZA 3WFGA 1OSVA 3W5QA 2XYXA 4UDCA 3BEJA 3P89A 4BCRA 4L96A 5KRCA 2VV1B 1YP0A 5IZ0A 4N73A 5FQVA 3R5NA 4DK8A 3ERTA 5KYJA 1TXIA 4IA3A 5DL4A 4Q13A 2O9IA 1UHLA 3OS8C 3A2JA 5DX3A 3FEJA 2Q61A 1X7EA 4X1FA 2OZ7A 5LWPA 2AA6A 2Q6RA 1NAXA 4MG5A 5KD9A 3E00D 2A3IA 2ZFXA 1HG4A 3CQVA 3B0QA 2I4JA 1PQ6A 2OM9A 2AA7A 3H0AD 4RFWA 4RMDA 1ERRA 5HZCA 4KZJA 3VJSA 4CI4A 5EC9A 5KRIA 1GWQA 1QKNA 5DXBB 5E14A 2Q6SA 1T74A 4OKWA 2ZLAA 2Q59B 4MG8B 4E2JA 1U3RA 2QW4A 3KMRA 1ZAFA 3DCTA 5DIGA 5KRAA 2P7AA 3VT7A 3VSOA 3HLVA 3VT5A 2E2RA 4OJ4A 3A3ZX 4CSJA 4MG9B 3IMYA 2HBHA 4IA2A 4ITEA 4QE8A 2QSEA 1MZNA 1SKXA 1DB1A 2ZK4A 3A9EA 4PLEA 4WHFA 2FVJA 3UUAA 5KCTA 3L1BA 3W5RA 2Q7LA 2XHSA 4ZJRA 3VI8A 4OH5A 5K13A 5DXMA 3O1EA 5DUGA 5GICA 3S9SA 4G21A 3GBKA 4ZNSA 4POJA 3GWSX 5E0WA 3VTBA 3G8OA 3SP6A 1I7IA 2AMBA 2I0JA 4APUA 3TX7B 2Q7KA 1Z95A 4IW6A 4UDAA 3DZYA 3KDTA 5ICKA 4OKBA 1XJ7A 3TY0A 3F7DA 3OOFA 5DZ0A 2I4PA 2H77A 2J7YA 2Q70A 3CS6A 4XTAA 3X1HA 4OEZA 3WWRA 4IVWA 4ITFA 2QMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0G A;  1UOM A;  5AZT A;  3WMH A;  1XOW A;  2AX9 A;  2ZY0 A;  4B7W A;  3KMG A;  3GN8 A;  4DM6 A;  2REW A;  4QL8 A;  5DXG A;  3D24 A;  2POG A;  4JYI A;  5G5W A;  3F5C B;  3ADX A;  1YJE A;  2P7Z A;  2VV3 A;  5G45 A;  3IXP D;  1NAV A;  3SZ1 A;  1S0Z A;  2YFE A;  4A2J A;  1I37 A;  1RDT D;  4PPP A;  3VTD A;  4OEY A;  5CJ6 A;  5DXB A;  4OGH A;  4RWV A;  5F9B A;  3V9Y A;  3JZC A;  2HAM A;  1R5K A;  2QR9 A;  1XDK B;  3WJ5 A;  4RMC A;  3PBA A;  4REF A;  5M96 A;  4FGY A;  3GYT A;  3E00 A;  2AXA A;  4S15 A;  2Q60 A;  2VV0 A;  3CDP A;  3FEI A;  1X7R A;  4IU7 A;  5DXE A;  3VTC A;  2QAB A;  3AFR A;  3H0A A;  4MG6 A;  5I4V A;  3TKM A;  2VST A;  5DV8 A;  3RLL A;  1FD0 A;  3ZQT A;  4OHA A;  4IA1 A;  5E1C A;  5G42 A;  3OKI A;  1DKF A;  2I0G A;  5DZ3 A;  3R8D A;  2IOG A;  5AVI A;  4NB6 A;  4M8H A;  4CI5 A;  1OSH A;  2GPP A;  3ZRA A;  2VV4 A;  4FNE A;  1U3Q A;  3UUC A;  3VRU A;  3PLZ A;  3OLF A;  1NUO A;  1XP6 A;  3KYT A;  4PF3 A;  3M7R A;  3DT3 A;  3PCU A;  2ZK6 A;  2ZK3 A;  3KMZ A;  3A2H A;  5DZH A;  2JJ3 A;  3G0W A;  1T7F A;  2Z4J A;  5DP0 A;  1A52 A;  2ZK5 A;  3D90 A;  5DKB A;  2ZNP A;  3DY6 A;  3R8A A;  4OFU A;  1U3S A;  5AVL A;  2GPV A;  3OGT A;  1E3G A;  4FHI A;  5DXQ A;  3ZR7 A;  5DVC A;  1FM6 D;  1PQC A;  1NDE A;  1XDK A;  3HOD A;  3MNE A;  3OSW A;  4IW8 A;  4ZNW A;  5DMC A;  1XIU A;  3T03 A;  2PKL A;  1XLS E;  2ABI A;  1N46 A;  4IS8 A;  4NUF A;  4PP6 A;  2YLQ A;  5EHJ A;  4EM9 A;  4N1Y A;  1Y0X X;  5DRJ A;  5KRJ A;  2NPA A;  1S19 A;  3VHV A;  1X7B A;  1KKQ A;  3IXP A;  4RE8 A;  2P1U A;  1Z5X E;  5DZ1 A;  1RDT A;  3RY9 A;  1FCX A;  3KFC A;  3IPU A;  4REE A;  4E4Q A;  1X76 A;  3D6D A;  3CLD A;  3L3Z A;  1UPV A;  2QA8 B;  2ZNN A;  3HO0 A;  4OC7 A;  5JY3 A;  4IUI A;  2R40 D;  3VJI A;  2YHD A;  4JGV A;  3X36 A;  4UDB A;  5DLR A;  3P0U A;  1H9U A;  1NHZ A;  2HCD A;  1XLS A;  3BQD A;  4ZNH A;  3RVF A;  4DK7 A;  5L11 A;  3PO9 A;  3X31 A;  1PQ9 A;  1X7J A;  2AX7 A;  2AYR A;  2ZXN A;  4QK4 A;  1MVC A;  2GTK A;  4OZR E;  5DVV A;  3GD2 A;  5AK2 A;  4RZE A;  4YPQ A;  3WJ4 A;  1A28 A;  3GWX A;  2HWQ A;  2QE4 A;  4DM8 A;  4YNK A;  3VSP A;  5A86 A;  3B0T A;  5HJP A;  1G50 A;  4PXM A;  2XYW A;  1XV9 B;  3PRG A;  5DWJ A;  4G2H A;  4J5W A;  4XHD A;  4WPF A;  2BJ4 B;  2HFP A;  3CDS A;  5DUH A;  4HEE X;  1NQ0 A;  1ILH A;  1NQ2 A;  1PZL A;  2QTU A;  1SQN A;  3A40 X;  5DZI A;  4ZI1 A;  2NV7 A;  1T7R A;  3GZ9 A;  5DV3 A;  5DXP A;  4G1Z A;  5DWI A;  3W0C A;  4DOS A;  1TFC A;  2XKW A;  3AZ1 A;  2ZLC A;  3A78 A;  4K6I A;  2H79 A;  4OLM A;  3ERD A;  4OJ9 A;  2AB2 A;  5AAV B;  5L7G A;  2GPO A;  4F9M A;  1FM6 A;  2QA8 A;  1P93 A;  3CTB A;  3VHW A;  2QXS A;  5DRM A;  1R20 D;  4OFR A;  4S14 A;  5APH A;  5DI7 A;  3P88 A;  5FQT A;  4JAZ A;  5DWL A;  2O4J A;  1RK3 A;  4QE6 A;  4ZOM A;  2AX8 A;  3LMP A;  3P8X A;  4QM0 A;  3RLJ A;  4FN9 A;  3OMK A;  1DKF B;  4Y29 A;  4S0T A;  2B1Z A;  4A4W A;  5GIE A;  3RUU A;  4IV4 A;  5DXR A;  1Y0S A;  2P1T A;  4J26 A;  5DKS A;  1K74 D;  1U9E A;  3W0A A;  3SP9 A;  2VV4 B;  3EYB A;  5KRK A;  2YLO A;  3DZU D;  4G1D A;  1UPW A;  5DID A;  5G46 A;  2R40 A;  3W5T A;  3V9T A;  2ZMJ A;  4WQP A;  3HZF A;  2ZXZ A;  4HLW A;  5DV6 A;  5E15 A;  5C4S A;  4R6S A;  1XV9 A;  2HB7 A;  5KRH A;  2BJ4 A;  2QZO B;  2GWX A;  5AWK A;  5KRF A;  5FQS A;  2ZNQ A;  2P4Y A;  1T7M A;  4MGB B;  3VHU A;  1QKM A;  5IAW A;  5E19 A;  3DCU A;  1XQC A;  4ZNU A;  1HJ1 A;  2Q1V A;  4OEA A;  5DTV A;  2ZK0 A;  3WT5 A;  3OOK A;  5AAV A;  1EXA A;  5ETH A;  3AN4 A;  4TV1 B;  2ZXM A;  2ACL B;  2AO6 A;  2P54 A;  5C4T A;  2HAR A;  2PIQ A;  2YJA B;  3OS9 A;  4IVY A;  1PDU A;  3W0I A;  4XUH A;  2YAT A;  5HCV A;  3D5F A;  1SR7 A;  3X1I A;  4OIU A;  3WT6 A;  5FQP A;  5KCD A;  2HAS A;  3ADS A;  4FHH A;  3B0R A;  4Q50 A;  4RUP A;  2W8Y A;  4OKX A;  3V3Q A;  1OVL B;  2Q3Y A;  2J14 A;  5EJV A;  3WFF A;  1IE9 A;  2ATH A;  5KCE A;  1YY4 A;  1XB7 A;  3D57 A;  2Q7I A;  5DKG A;  1Z5X U;  2NW4 A;  1LV2 A;  3FUG A;  2PNU A;  5G43 A;  1RJK A;  2PIW A;  2ZNO A;  1I7G A;  2QZO A;  1NQ1 A;  1ZUC A;  1N4H A;  3BC5 A;  1R6G A;  2JF9 A;  3ET2 A;  4MGB A;  5E7V A;  1GWX A;  3NOA A;  1ZH7 A;  3PEQ A;  4RME A;  1K74 A;  4KZM A;  3G9E A;  2Q7J A;  3VT3 A;  2Q5G A;  2Q1H A;  4P6W A;  5DKE A;  3WGP A;  2P7G A;  5HJP B;  2R6Y A;  3CJW A;  4MGC A;  1PRG A;  4ZNV A;  1FM9 D;  4POH A;  3DZU A;  5DYD A;  4WLB A;  3R2A A;  1E3K A;  5E0X A;  2XYJ A;  4TV1 A;  5C4O A;  4OZR U;  2ACL A;  3FC6 B;  3FUR A;  3HC6 A;  2GL8 A;  3OZJ A;  4LNX A;  1FBY A;  4N5G A;  1N83 A;  3AUQ A;  5KCW A;  1S9P A;  2P15 A;  2Q6J A;  3IPQ A;  3V49 A;  2HVC A;  1ILG A;  3OMO A;  5JJM B;  2IOK A;  2R6W A;  3AUR A;  4R06 A;  3VT8 A;  3VJH A;  4J5W C;  4XUM A;  1OVL A;  4ZO1 X;  2J7X A;  4K7A A;  1XZX X;  2G5O A;  4WHG A;  1M7W A;  1QKT A;  4TUZ B;  4XI3 A;  1OT7 A;  3G8I A;  3ZRB A;  2ZVT A;  2HC4 A;  3VRW A;  1YOW A;  3K6P A;  3FXV A;  2ZMH A;  3JZB A;  4OKT A;  4JYG A;  2PIO A;  4OZT E;  5DWE A;  3WTQ A;  4NIE A;  4JYH A;  3GYU A;  4O8F A;  4R2U A;  3VT6 A;  3FAL A;  4L98 A;  1I38 A;  1S0X A;  2LBD A;  1YOK A;  1XP1 A;  1XPC A;  2QA6 A;  2PRG A;  4E4K A;  3OKH A;  5DMF A;  2PIP L;  1T63 A;  5GT4 A;  2IHQ A;  3UP3 A;  5KCF A;  5ACC A;  4LBD A;  5DY8 A;  2P1V A;  2ZAS A;  2YLY A;  4OH6 A;  1BSX A;  3B67 A;  4PRG A;  3UUD B;  5GID A;  3V9V A;  2OVM A;  3DR1 A;  3W0G A;  4NQA B;  3FC6 A;  1R1K D;  1XNX A;  2Q5P A;  2OAX A;  2V7C A;  2PIV A;  4PWL A;  3E7C A;  2G0H A;  5G3J A;  3R5M A;  5JJM A;  3L03 A;  3V4A A;  5DUE A;  4ONI A;  3CS4 A;  5DK9 A;  5HJS A;  3OAP A;  1FM9 A;  1GWR A;  3L0L A;  1YUC A;  2AA2 A;  4WVD A;  3VJT A;  1ZDT A;  1RKH A;  1ZEO A;  3ADT A;  4OJB A;  4TUZ A;  4XT9 A;  3B0W A;  5KCC A;  4ZN9 A;  3WT7 A;  4UDD A;  2AX6 A;  3HM1 A;  5SYZ A;  1YYE A;  3ET0 A;  4IQR A;  1VJB A;  3OLS A;  3OMM A;  4NY9 A;  5APK A;  5IXK A;  2NXX E;  1NRL A;  4J5X C;  2G44 A;  1G1U A;  3AZ2 A;  1YMT A;  5JI0 D;  5DWG A;  2AMA A;  2EWP A;  5L7E A;  3UVV B;  4OIV A;  3HQ5 A;  1IE8 A;  3NSP A;  3KBA A;  3AX8 A;  5AYG A;  4YMQ A;  3ADW A;  4PP3 A;  5KYA A;  4ZJW A;  5KRO A;  5LGA A;  2QPY A;  3ADV A;  1T7T A;  1PK5 A;  4S0S A;  3LBD A;  5FQR A;  2POB A;  3ADU A;  3OLL A;  1MV9 A;  3ET3 A;  4MGA B;  3K22 A;  3UUD A;  2PIR A;  2PIT A;  2JFA A;  1PCG A;  1T65 A;  3FLI A;  5EGV A;  3KDU A;  4IV2 A;  1KV6 A;  1P8D A;  3OS8 A;  4XAO A;  1M13 A;  2NXX A;  2B1V A;  3VRV A;  4P6X A;  3R8I A;  3FS1 A;  3VN2 A;  2VV1 A;  2FAI A;  5DYB A;  2ZMI A;  4A4V A;  1ERE A;  3E94 A;  3K23 A;  5DIE A;  4J5X A;  2PIX A;  2GP7 A;  2AA5 A;  2YLP A;  4IA7 A;  2AAX A;  1XQ3 A;  2ZKC A;  3HC5 A;  1T76 A;  4MGD B;  3W0J A;  1FCY A;  1R1K A;  5EIT A;  1G5Y A;  3IPS A;  4G20 A;  1Y9R A;  4PPS A;  4MDD A;  3L0J A;  4OK1 A;  5DU5 A;  4MG7 B;  3HVL A;  3QT0 A;  3CS8 A;  4RAK A;  2OVH A;  4RZG A;  1ZKY A;  1L2J A;  3OSA A;  5KRM A;  3UVV A;  2YJD A;  4EMA A;  3NSQ A;  3A2I A;  3B66 A;  3Q95 B;  2Q59 A;  4MG8 A;  1YA3 A;  4Q0A C;  5DVS A;  5C4U A;  5HYR A;  2HWR A;  2ZK2 A;  4K4J A;  1WM0 X;  1XNN A;  3B5R A;  2BAW A;  1R20 A;  3B1M A;  3L3X A;  1S9Q A;  1XVP B;  4MGA A;  4MG9 A;  4OIL A;  3B68 A;  3L0E A;  2GIU A;  2HB8 A;  3R29 A;  2AM9 A;  2B23 A;  3UU7 B;  5KR9 A;  2QXM A;  3VT9 A;  3FAL B;  4IWC A;  2QH6 A;  3TKC A;  3RUT A;  2FSZ A;  2ZK1 A;  3B3K A;  4DOR A;  4DMA A;  3UP0 A;  1XP9 A;  3U9Q A;  3OZ0 A;  3W5P A;  4PP5 A;  4KZI A;  2F4B A;  3VRT A;  4LSJ A;  4RUO X;  2VV2 A;  4OZT U;  4ZO1 B;  2AWH A;  5AAU A;  2PIN A;  2ZBS A;  1LBD A;  3W0H A;  1G2N A;  1T79 A;  4M8E A;  3OMQ A;  2OUZ A;  4MGD A;  2QGW A;  3CWD A;  2B50 A;  3MNP A;  4LNW A;  2QGT A;  3H52 A;  4QJR A;  4DQM A;  1K7L A;  2V0V A;  4ZN7 A;  3KWY A;  3W0Y A;  1L2I A;  3K8S A;  4X1G A;  5L7H A;  1ZDU A;  2I4Z A;  4MG7 A;  4N8R A;  2Q8S A;  1SJ0 A;  3F5C A;  5KCU A;  1X78 A;  5AWJ A;  1QKU A;  2PJL A;  2ZL9 A;  1KNU A;  4JL4 A;  5B41 A;  4XLD A;  1UHL B;  2OCF A;  4PVU A;  1GS4 A;  5DX3 B;  5APJ A;  5EI1 A;  3MNO A;  5AZV A;  3KPZ A;  3Q95 A;  4LTW A;  1T73 A;  2Z4B A;  1RKG A;  4G2I A;  1T5Z A;  2VSR A;  3ILZ A;  1XVP A;  4J24 A;  1EXX A;  1XAP A;  1K4W A;  5H1E A;  4OAR A;  2Q5S A;  5G44 A;  4IWF A;  1NYX A;  3UU7 A;  3OMP A;  5KRL A;  1FCZ A;  3VT4 A;  5DSH A;  2PIU A;  3O1D A;  3OSI A;  1ZGY A;  3B65 A;  4YT1 A;  5HYK A;  2J4A A;  3ET1 A;  2GPU A;  2O4R A;  3AZ3 A;  3IA6 A;  3AUN A;  4PLD A;  1YIN A;  3DZY D;  5DXK A;  4RUJ A;  4RZF A;  1NQ7 A;  2QNV A;  4G1Y A;  1Q4X A;  3AN3 A;  1YIM A;  2JFA B;  3A9E B;  3N00 A;  5B5B A;  3UUA B;  3V3E A;  4OED A;  4ZNT A;  1M2Z A;  3WFG A;  1OSV A;  3W5Q A;  2XYX A;  4UDC A;  3BEJ A;  3P89 A;  4BCR A;  4L96 A;  5KRC A;  2VV1 B;  1YP0 A;  5IZ0 A;  4N73 A;  5FQV A;  3R5N A;  4DK8 A;  3ERT A;  5KYJ A;  1TXI A;  4IA3 A;  5DL4 A;  4Q13 A;  2O9I A;  1UHL A;  3OS8 C;  3A2J A;  5DX3 A;  3FEJ A;  2Q61 A;  1X7E A;  4X1F A;  2OZ7 A;  5LWP A;  2AA6 A;  2Q6R A;  1NAX A;  4MG5 A;  5KD9 A;  3E00 D;  2A3I A;  2ZFX A;  1HG4 A;  3CQV A;  3B0Q A;  2I4J A;  1PQ6 A;  2OM9 A;  2AA7 A;  3H0A D;  4RFW A;  4RMD A;  1ERR A;  5HZC A;  4KZJ A;  3VJS A;  4CI4 A;  5EC9 A;  5KRI A;  1GWQ A;  1QKN A;  5DXB B;  5E14 A;  2Q6S A;  1T74 A;  4OKW A;  2ZLA A;  2Q59 B;  4MG8 B;  4E2J A;  1U3R A;  2QW4 A;  3KMR A;  1ZAF A;  3DCT A;  5DIG A;  5KRA A;  2P7A A;  3VT7 A;  3VSO A;  3HLV A;  3VT5 A;  2E2R A;  4OJ4 A;  3A3Z X;  4CSJ A;  4MG9 B;  3IMY A;  2HBH A;  4IA2 A;  4ITE A;  4QE8 A;  2QSE A;  1MZN A;  1SKX A;  1DB1 A;  2ZK4 A;  3A9E A;  4PLE A;  4WHF A;  2FVJ A;  3UUA A;  5KCT A;  3L1B A;  3W5R A;  2Q7L A;  2XHS A;  4ZJR A;  3VI8 A;  4OH5 A;  5K13 A;  5DXM A;  3O1E A;  5DUG A;  5GIC A;  3S9S A;  4G21 A;  3GBK A;  4ZNS A;  4POJ A;  3GWS X;  5E0W A;  3VTB A;  3G8O A;  3SP6 A;  1I7I A;  2AMB A;  2I0J A;  4APU A;  3TX7 B;  2Q7K A;  1Z95 A;  4IW6 A;  4UDA A;  3DZY A;  3KDT A;  5ICK A;  4OKB A;  1XJ7 A;  3TY0 A;  3F7D A;  3OOF A;  5DZ0 A;  2I4P A;  2H77 A;  2J7Y A;  2Q70 A;  3CS6 A;  4XTA A;  3X1H A;  4OEZ A;  3WWR A;  4IVW A;  4ITF A;  2QMV A; 
#chains in the Genus database with same CATH topology
 2G0G A;  1UOM A;  5AZT A;  3WMH A;  1XOW A;  2AX9 A;  2ZY0 A;  4B7W A;  3KMG A;  3GN8 A;  4DM6 A;  2REW A;  4QL8 A;  5DXG A;  3D24 A;  2POG A;  4JYI A;  5G5W A;  3F5C B;  3ADX A;  1YJE A;  2P7Z A;  2VV3 A;  5G45 A;  3IXP D;  1NAV A;  3SZ1 A;  1S0Z A;  2YFE A;  4A2J A;  1I37 A;  1RDT D;  4PPP A;  3VTD A;  4OEY A;  5CJ6 A;  5DXB A;  4OGH A;  4RWV A;  5F9B A;  3V9Y A;  3JZC A;  2HAM A;  1R5K A;  2QR9 A;  1XDK B;  3WJ5 A;  4RMC A;  3PBA A;  4REF A;  5M96 A;  4FGY A;  3GYT A;  3E00 A;  2AXA A;  4S15 A;  2Q60 A;  2VV0 A;  3CDP A;  3FEI A;  1X7R A;  4IU7 A;  5DXE A;  3VTC A;  2QAB A;  3AFR A;  3H0A A;  4MG6 A;  5I4V A;  3TKM A;  2VST A;  5DV8 A;  3RLL A;  1FD0 A;  3ZQT A;  4OHA A;  4IA1 A;  5E1C A;  5G42 A;  3OKI A;  1DKF A;  2I0G A;  5DZ3 A;  3R8D A;  2IOG A;  5AVI A;  4NB6 A;  4M8H A;  4CI5 A;  1OSH A;  2GPP A;  3ZRA A;  2VV4 A;  4FNE A;  1U3Q A;  3UUC A;  3VRU A;  3PLZ A;  3OLF A;  1NUO A;  1XP6 A;  3KYT A;  4PF3 A;  3M7R A;  3DT3 A;  3PCU A;  2ZK6 A;  2ZK3 A;  3KMZ A;  3A2H A;  5DZH A;  2JJ3 A;  3G0W A;  1T7F A;  2Z4J A;  5DP0 A;  1A52 A;  2ZK5 A;  3D90 A;  5DKB A;  2ZNP A;  3DY6 A;  3R8A A;  4OFU A;  1U3S A;  5AVL A;  2GPV A;  3OGT A;  1E3G A;  4FHI A;  5DXQ A;  3ZR7 A;  5DVC A;  1FM6 D;  1PQC A;  1NDE A;  1XDK A;  3HOD A;  3MNE A;  3OSW A;  4IW8 A;  4ZNW A;  5DMC A;  1XIU A;  3T03 A;  2PKL A;  1XLS E;  2ABI A;  1N46 A;  4IS8 A;  4NUF A;  4PP6 A;  2YLQ A;  5EHJ A;  4EM9 A;  4N1Y A;  1Y0X X;  5DRJ A;  5KRJ A;  2NPA A;  1S19 A;  3VHV A;  1X7B A;  1KKQ A;  3IXP A;  4RE8 A;  2P1U A;  1Z5X E;  5DZ1 A;  1RDT A;  3RY9 A;  1FCX A;  3KFC A;  3IPU A;  4REE A;  4E4Q A;  1X76 A;  3D6D A;  3CLD A;  3L3Z A;  1UPV A;  2QA8 B;  2ZNN A;  3HO0 A;  4OC7 A;  5JY3 A;  4IUI A;  2R40 D;  3VJI A;  2YHD A;  4JGV A;  3X36 A;  4UDB A;  5DLR A;  3P0U A;  1H9U A;  1NHZ A;  2HCD A;  1XLS A;  3BQD A;  4ZNH A;  3RVF A;  4DK7 A;  5L11 A;  3PO9 A;  3X31 A;  1PQ9 A;  1X7J A;  2AX7 A;  2AYR A;  2ZXN A;  4QK4 A;  1MVC A;  2GTK A;  4OZR E;  5DVV A;  3GD2 A;  5AK2 A;  4RZE A;  4YPQ A;  3WJ4 A;  1A28 A;  3GWX A;  2HWQ A;  2QE4 A;  4DM8 A;  4YNK A;  3VSP A;  5A86 A;  3B0T A;  5HJP A;  1G50 A;  4PXM A;  2XYW A;  1XV9 B;  3PRG A;  5DWJ A;  4G2H A;  4J5W A;  4XHD A;  4WPF A;  2BJ4 B;  2HFP A;  3CDS A;  5DUH A;  4HEE X;  1NQ0 A;  1ILH A;  1NQ2 A;  1PZL A;  2QTU A;  1SQN A;  3A40 X;  5DZI A;  4ZI1 A;  2NV7 A;  1T7R A;  3GZ9 A;  5DV3 A;  5DXP A;  4G1Z A;  5DWI A;  3W0C A;  4DOS A;  1TFC A;  2XKW A;  3AZ1 A;  2ZLC A;  3A78 A;  4K6I A;  2H79 A;  4OLM A;  3ERD A;  4OJ9 A;  2AB2 A;  5AAV B;  5L7G A;  2GPO A;  4F9M A;  1FM6 A;  2QA8 A;  1P93 A;  3CTB A;  3VHW A;  2QXS A;  5DRM A;  1R20 D;  4OFR A;  4S14 A;  5APH A;  5DI7 A;  3P88 A;  5FQT A;  4JAZ A;  5DWL A;  2O4J A;  1RK3 A;  4QE6 A;  4ZOM A;  2AX8 A;  3LMP A;  3P8X A;  4QM0 A;  3RLJ A;  4FN9 A;  3OMK A;  1DKF B;  4Y29 A;  4S0T A;  2B1Z A;  4A4W A;  5GIE A;  3RUU A;  4IV4 A;  5DXR A;  1Y0S A;  2P1T A;  4J26 A;  5DKS A;  1K74 D;  1U9E A;  3W0A A;  3SP9 A;  2VV4 B;  3EYB A;  5KRK A;  2YLO A;  3DZU D;  4G1D A;  1UPW A;  5DID A;  5G46 A;  2R40 A;  3W5T A;  3V9T A;  2ZMJ A;  4WQP A;  3HZF A;  2ZXZ A;  4HLW A;  5DV6 A;  5E15 A;  5C4S A;  4R6S A;  1XV9 A;  2HB7 A;  5KRH A;  2BJ4 A;  2QZO B;  2GWX A;  5AWK A;  5KRF A;  5FQS A;  2ZNQ A;  2P4Y A;  1T7M A;  4MGB B;  3VHU A;  1QKM A;  5IAW A;  5E19 A;  3DCU A;  1XQC A;  4ZNU A;  1HJ1 A;  2Q1V A;  4OEA A;  5DTV A;  2ZK0 A;  3WT5 A;  3OOK A;  5AAV A;  1EXA A;  5ETH A;  3AN4 A;  4TV1 B;  2ZXM A;  2ACL B;  2AO6 A;  2P54 A;  5C4T A;  2HAR A;  2PIQ A;  2YJA B;  3OS9 A;  4IVY A;  1PDU A;  3W0I A;  4XUH A;  2YAT A;  5HCV A;  3D5F A;  1SR7 A;  3X1I A;  4OIU A;  3WT6 A;  5FQP A;  5KCD A;  2HAS A;  3ADS A;  4FHH A;  3B0R A;  4Q50 A;  4RUP A;  2W8Y A;  4OKX A;  3V3Q A;  1OVL B;  2Q3Y A;  2J14 A;  5EJV A;  3WFF A;  1IE9 A;  2ATH A;  5KCE A;  1YY4 A;  1XB7 A;  3D57 A;  2Q7I A;  5DKG A;  1Z5X U;  2NW4 A;  1LV2 A;  3FUG A;  2PNU A;  5G43 A;  1RJK A;  2PIW A;  2ZNO A;  1I7G A;  2QZO A;  1NQ1 A;  1ZUC A;  1N4H A;  3BC5 A;  1R6G A;  2JF9 A;  3ET2 A;  4MGB A;  5E7V A;  1GWX A;  3NOA A;  1ZH7 A;  3PEQ A;  4RME A;  1K74 A;  4KZM A;  3G9E A;  2Q7J A;  3VT3 A;  2Q5G A;  2Q1H A;  4P6W A;  5DKE A;  3WGP A;  2P7G A;  5HJP B;  2R6Y A;  3CJW A;  4MGC A;  1PRG A;  4ZNV A;  1FM9 D;  4POH A;  3DZU A;  5DYD A;  4WLB A;  3R2A A;  1E3K A;  5E0X A;  2XYJ A;  4TV1 A;  5C4O A;  4OZR U;  2ACL A;  3FC6 B;  3FUR A;  3HC6 A;  2GL8 A;  3OZJ A;  4LNX A;  1FBY A;  4N5G A;  1N83 A;  3AUQ A;  5KCW A;  1S9P A;  2P15 A;  2Q6J A;  3IPQ A;  3V49 A;  2HVC A;  1ILG A;  3OMO A;  5JJM B;  2IOK A;  2R6W A;  3AUR A;  4R06 A;  3VT8 A;  3VJH A;  4J5W C;  4XUM A;  1OVL A;  4ZO1 X;  2J7X A;  4K7A A;  1XZX X;  2G5O A;  4WHG A;  1M7W A;  1QKT A;  4TUZ B;  4XI3 A;  1OT7 A;  3G8I A;  3ZRB A;  2ZVT A;  2HC4 A;  3VRW A;  1YOW A;  3K6P A;  3FXV A;  2ZMH A;  3JZB A;  4OKT A;  4JYG A;  2PIO A;  4OZT E;  5DWE A;  3WTQ A;  4NIE A;  4JYH A;  3GYU A;  4O8F A;  4R2U A;  3VT6 A;  3FAL A;  4L98 A;  1I38 A;  1S0X A;  2LBD A;  1YOK A;  1XP1 A;  1XPC A;  2QA6 A;  2PRG A;  4E4K A;  3OKH A;  5DMF A;  2PIP L;  1T63 A;  5GT4 A;  2IHQ A;  3UP3 A;  5KCF A;  5ACC A;  4LBD A;  5DY8 A;  2P1V A;  2ZAS A;  2YLY A;  4OH6 A;  1BSX A;  3B67 A;  4PRG A;  3UUD B;  5GID A;  3V9V A;  2OVM A;  3DR1 A;  3W0G A;  4NQA B;  3FC6 A;  1R1K D;  1XNX A;  2Q5P A;  2OAX A;  2V7C A;  2PIV A;  4PWL A;  3E7C A;  2G0H A;  5G3J A;  3R5M A;  5JJM A;  3L03 A;  3V4A A;  5DUE A;  4ONI A;  3CS4 A;  5DK9 A;  5HJS A;  3OAP A;  1FM9 A;  1GWR A;  3L0L A;  1YUC A;  2AA2 A;  4WVD A;  3VJT A;  1ZDT A;  1RKH A;  1ZEO A;  3ADT A;  4OJB A;  4TUZ A;  4XT9 A;  3B0W A;  5KCC A;  4ZN9 A;  3WT7 A;  4UDD A;  2AX6 A;  3HM1 A;  5SYZ A;  1YYE A;  3ET0 A;  4IQR A;  1VJB A;  3OLS A;  3OMM A;  4NY9 A;  5APK A;  5IXK A;  2NXX E;  1NRL A;  4J5X C;  2G44 A;  1G1U A;  3AZ2 A;  1YMT A;  5JI0 D;  5DWG A;  2AMA A;  2EWP A;  5L7E A;  3UVV B;  4OIV A;  3HQ5 A;  1IE8 A;  3NSP A;  3KBA A;  3AX8 A;  5AYG A;  4YMQ A;  3ADW A;  4PP3 A;  5KYA A;  4ZJW A;  5KRO A;  5LGA A;  2QPY A;  3ADV A;  1T7T A;  1PK5 A;  4S0S A;  3LBD A;  5FQR A;  2POB A;  3ADU A;  3OLL A;  1MV9 A;  3ET3 A;  4MGA B;  3K22 A;  3UUD A;  2PIR A;  2PIT A;  2JFA A;  1PCG A;  1T65 A;  3FLI A;  5EGV A;  3KDU A;  4IV2 A;  1KV6 A;  1P8D A;  3OS8 A;  4XAO A;  1M13 A;  2NXX A;  2B1V A;  3VRV A;  4P6X A;  3R8I A;  3FS1 A;  3VN2 A;  2VV1 A;  2FAI A;  5DYB A;  2ZMI A;  4A4V A;  1ERE A;  3E94 A;  3K23 A;  5DIE A;  4J5X A;  2PIX A;  2GP7 A;  2AA5 A;  2YLP A;  4IA7 A;  2AAX A;  1XQ3 A;  2ZKC A;  3HC5 A;  1T76 A;  4MGD B;  3W0J A;  1FCY A;  1R1K A;  5EIT A;  1G5Y A;  3IPS A;  4G20 A;  1Y9R A;  4PPS A;  4MDD A;  3L0J A;  4OK1 A;  5DU5 A;  4MG7 B;  3HVL A;  3QT0 A;  3CS8 A;  4RAK A;  2OVH A;  4RZG A;  1ZKY A;  1L2J A;  3OSA A;  5KRM A;  3UVV A;  2YJD A;  4EMA A;  3NSQ A;  3A2I A;  3B66 A;  3Q95 B;  2Q59 A;  4MG8 A;  1YA3 A;  4Q0A C;  5DVS A;  5C4U A;  5HYR A;  2HWR A;  2ZK2 A;  4K4J A;  1WM0 X;  1XNN A;  3B5R A;  2BAW A;  1R20 A;  3B1M A;  3L3X A;  1S9Q A;  1XVP B;  4MGA A;  4MG9 A;  4OIL A;  3B68 A;  3L0E A;  2GIU A;  2HB8 A;  3R29 A;  2AM9 A;  2B23 A;  3UU7 B;  5KR9 A;  2QXM A;  3VT9 A;  3FAL B;  4IWC A;  2QH6 A;  3TKC A;  3RUT A;  2FSZ A;  2ZK1 A;  3B3K A;  4DOR A;  4DMA A;  3UP0 A;  1XP9 A;  3U9Q A;  3OZ0 A;  3W5P A;  4PP5 A;  4KZI A;  2F4B A;  3VRT A;  4LSJ A;  4RUO X;  2VV2 A;  4OZT U;  4ZO1 B;  2AWH A;  5AAU A;  2PIN A;  2ZBS A;  1LBD A;  3W0H A;  1G2N A;  1T79 A;  4M8E A;  3OMQ A;  2OUZ A;  4MGD A;  2QGW A;  3CWD A;  2B50 A;  3MNP A;  4LNW A;  2QGT A;  3H52 A;  4QJR A;  4DQM A;  1K7L A;  2V0V A;  4ZN7 A;  3KWY A;  3W0Y A;  1L2I A;  3K8S A;  4X1G A;  5L7H A;  1ZDU A;  2I4Z A;  4MG7 A;  4N8R A;  2Q8S A;  1SJ0 A;  3F5C A;  5KCU A;  1X78 A;  5AWJ A;  1QKU A;  2PJL A;  2ZL9 A;  1KNU A;  4JL4 A;  5B41 A;  4XLD A;  1UHL B;  2OCF A;  4PVU A;  1GS4 A;  5DX3 B;  5APJ A;  5EI1 A;  3MNO A;  5AZV A;  3KPZ A;  3Q95 A;  4LTW A;  1T73 A;  2Z4B A;  1RKG A;  4G2I A;  1T5Z A;  2VSR A;  3ILZ A;  1XVP A;  4J24 A;  1EXX A;  1XAP A;  1K4W A;  5H1E A;  4OAR A;  2Q5S A;  5G44 A;  4IWF A;  1NYX A;  3UU7 A;  3OMP A;  5KRL A;  1FCZ A;  3VT4 A;  5DSH A;  2PIU A;  3O1D A;  3OSI A;  1ZGY A;  3B65 A;  4YT1 A;  5HYK A;  2J4A A;  3ET1 A;  2GPU A;  2O4R A;  3AZ3 A;  3IA6 A;  3AUN A;  4PLD A;  1YIN A;  3DZY D;  5DXK A;  4RUJ A;  4RZF A;  1NQ7 A;  2QNV A;  4G1Y A;  1Q4X A;  3AN3 A;  1YIM A;  2JFA B;  3A9E B;  3N00 A;  5B5B A;  3UUA B;  3V3E A;  4OED A;  4ZNT A;  1M2Z A;  3WFG A;  1OSV A;  3W5Q A;  2XYX A;  4UDC A;  3BEJ A;  3P89 A;  4BCR A;  4L96 A;  5KRC A;  2VV1 B;  1YP0 A;  5IZ0 A;  4N73 A;  5FQV A;  3R5N A;  4DK8 A;  3ERT A;  5KYJ A;  1TXI A;  4IA3 A;  5DL4 A;  4Q13 A;  2O9I A;  1UHL A;  3OS8 C;  3A2J A;  5DX3 A;  3FEJ A;  2Q61 A;  1X7E A;  4X1F A;  2OZ7 A;  5LWP A;  2AA6 A;  2Q6R A;  1NAX A;  4MG5 A;  5KD9 A;  3E00 D;  2A3I A;  2ZFX A;  1HG4 A;  3CQV A;  3B0Q A;  2I4J A;  1PQ6 A;  2OM9 A;  2AA7 A;  3H0A D;  4RFW A;  4RMD A;  1ERR A;  5HZC A;  4KZJ A;  3VJS A;  4CI4 A;  5EC9 A;  5KRI A;  1GWQ A;  1QKN A;  5DXB B;  5E14 A;  2Q6S A;  1T74 A;  4OKW A;  2ZLA A;  2Q59 B;  4MG8 B;  4E2J A;  1U3R A;  2QW4 A;  3KMR A;  1ZAF A;  3DCT A;  5DIG A;  5KRA A;  2P7A A;  3VT7 A;  3VSO A;  3HLV A;  3VT5 A;  2E2R A;  4OJ4 A;  3A3Z X;  4CSJ A;  4MG9 B;  3IMY A;  2HBH A;  4IA2 A;  4ITE A;  4QE8 A;  2QSE A;  1MZN A;  1SKX A;  1DB1 A;  2ZK4 A;  3A9E A;  4PLE A;  4WHF A;  2FVJ A;  3UUA A;  5KCT A;  3L1B A;  3W5R A;  2Q7L A;  2XHS A;  4ZJR A;  3VI8 A;  4OH5 A;  5K13 A;  5DXM A;  3O1E A;  5DUG A;  5GIC A;  3S9S A;  4G21 A;  3GBK A;  4ZNS A;  4POJ A;  3GWS X;  5E0W A;  3VTB A;  3G8O A;  3SP6 A;  1I7I A;  2AMB A;  2I0J A;  4APU A;  3TX7 B;  2Q7K A;  1Z95 A;  4IW6 A;  4UDA A;  3DZY A;  3KDT A;  5ICK A;  4OKB A;  1XJ7 A;  3TY0 A;  3F7D A;  3OOF A;  5DZ0 A;  2I4P A;  2H77 A;  2J7Y A;  2Q70 A;  3CS6 A;  4XTA A;  3X1H A;  4OEZ A;  3WWR A;  4IVW A;  4ITF A;  2QMV A; 
#chains in the Genus database with same CATH homology
 2G0G A;  1UOM A;  5AZT A;  3WMH A;  1XOW A;  2AX9 A;  2ZY0 A;  4B7W A;  3KMG A;  3GN8 A;  4DM6 A;  2REW A;  4QL8 A;  5DXG A;  3D24 A;  2POG A;  4JYI A;  5G5W A;  3F5C B;  3ADX A;  1YJE A;  2P7Z A;  2VV3 A;  5G45 A;  3IXP D;  1NAV A;  3SZ1 A;  1S0Z A;  2YFE A;  4A2J A;  1I37 A;  1RDT D;  4PPP A;  3VTD A;  4OEY A;  5CJ6 A;  5DXB A;  4OGH A;  4RWV A;  5F9B A;  3V9Y A;  3JZC A;  2HAM A;  1R5K A;  2QR9 A;  1XDK B;  3WJ5 A;  4RMC A;  3PBA A;  4REF A;  5M96 A;  4FGY A;  3GYT A;  3E00 A;  2AXA A;  4S15 A;  2Q60 A;  2VV0 A;  3CDP A;  3FEI A;  1X7R A;  4IU7 A;  5DXE A;  3VTC A;  2QAB A;  3AFR A;  3H0A A;  4MG6 A;  5I4V A;  3TKM A;  2VST A;  5DV8 A;  3RLL A;  1FD0 A;  3ZQT A;  4OHA A;  4IA1 A;  5E1C A;  5G42 A;  3OKI A;  1DKF A;  2I0G A;  5DZ3 A;  3R8D A;  2IOG A;  5AVI A;  4NB6 A;  4M8H A;  4CI5 A;  1OSH A;  2GPP A;  3ZRA A;  2VV4 A;  4FNE A;  1U3Q A;  3UUC A;  3VRU A;  3PLZ A;  3OLF A;  1NUO A;  1XP6 A;  3KYT A;  4PF3 A;  3M7R A;  3DT3 A;  3PCU A;  2ZK6 A;  2ZK3 A;  3KMZ A;  3A2H A;  5DZH A;  2JJ3 A;  3G0W A;  1T7F A;  2Z4J A;  5DP0 A;  1A52 A;  2ZK5 A;  3D90 A;  5DKB A;  2ZNP A;  3DY6 A;  3R8A A;  4OFU A;  1U3S A;  5AVL A;  2GPV A;  3OGT A;  1E3G A;  4FHI A;  5DXQ A;  3ZR7 A;  5DVC A;  1FM6 D;  1PQC A;  1NDE A;  1XDK A;  3HOD A;  3MNE A;  3OSW A;  4IW8 A;  4ZNW A;  5DMC A;  1XIU A;  3T03 A;  2PKL A;  1XLS E;  2ABI A;  1N46 A;  4IS8 A;  4NUF A;  4PP6 A;  2YLQ A;  5EHJ A;  4EM9 A;  4N1Y A;  1Y0X X;  5DRJ A;  5KRJ A;  2NPA A;  1S19 A;  3VHV A;  1X7B A;  1KKQ A;  3IXP A;  4RE8 A;  2P1U A;  1Z5X E;  5DZ1 A;  1RDT A;  3RY9 A;  1FCX A;  3KFC A;  3IPU A;  4REE A;  4E4Q A;  1X76 A;  3D6D A;  3CLD A;  3L3Z A;  1UPV A;  2QA8 B;  2ZNN A;  3HO0 A;  4OC7 A;  5JY3 A;  4IUI A;  2R40 D;  3VJI A;  2YHD A;  4JGV A;  3X36 A;  4UDB A;  5DLR A;  3P0U A;  1H9U A;  1NHZ A;  2HCD A;  1XLS A;  3BQD A;  4ZNH A;  3RVF A;  4DK7 A;  5L11 A;  3PO9 A;  3X31 A;  1PQ9 A;  1X7J A;  2AX7 A;  2AYR A;  2ZXN A;  4QK4 A;  1MVC A;  2GTK A;  4OZR E;  5DVV A;  3GD2 A;  5AK2 A;  4RZE A;  4YPQ A;  3WJ4 A;  1A28 A;  3GWX A;  2HWQ A;  2QE4 A;  4DM8 A;  4YNK A;  3VSP A;  5A86 A;  3B0T A;  5HJP A;  1G50 A;  4PXM A;  2XYW A;  1XV9 B;  3PRG A;  5DWJ A;  4G2H A;  4J5W A;  4XHD A;  4WPF A;  2BJ4 B;  2HFP A;  3CDS A;  5DUH A;  4HEE X;  1NQ0 A;  1ILH A;  1NQ2 A;  1PZL A;  2QTU A;  1SQN A;  3A40 X;  5DZI A;  4ZI1 A;  2NV7 A;  1T7R A;  3GZ9 A;  5DV3 A;  5DXP A;  4G1Z A;  5DWI A;  3W0C A;  4DOS A;  1TFC A;  2XKW A;  3AZ1 A;  2ZLC A;  3A78 A;  4K6I A;  2H79 A;  4OLM A;  3ERD A;  4OJ9 A;  2AB2 A;  5AAV B;  5L7G A;  2GPO A;  4F9M A;  1FM6 A;  2QA8 A;  1P93 A;  3CTB A;  3VHW A;  2QXS A;  5DRM A;  1R20 D;  4OFR A;  4S14 A;  5APH A;  5DI7 A;  3P88 A;  5FQT A;  4JAZ A;  5DWL A;  2O4J A;  1RK3 A;  4QE6 A;  4ZOM A;  2AX8 A;  3LMP A;  3P8X A;  4QM0 A;  3RLJ A;  4FN9 A;  3OMK A;  1DKF B;  4Y29 A;  4S0T A;  2B1Z A;  4A4W A;  5GIE A;  3RUU A;  4IV4 A;  5DXR A;  1Y0S A;  2P1T A;  4J26 A;  5DKS A;  1K74 D;  1U9E A;  3W0A A;  3SP9 A;  2VV4 B;  3EYB A;  5KRK A;  2YLO A;  3DZU D;  4G1D A;  1UPW A;  5DID A;  5G46 A;  2R40 A;  3W5T A;  3V9T A;  2ZMJ A;  4WQP A;  3HZF A;  2ZXZ A;  4HLW A;  5DV6 A;  5E15 A;  5C4S A;  4R6S A;  1XV9 A;  2HB7 A;  5KRH A;  2BJ4 A;  2QZO B;  2GWX A;  5AWK A;  5KRF A;  5FQS A;  2ZNQ A;  2P4Y A;  1T7M A;  4MGB B;  3VHU A;  1QKM A;  5IAW A;  5E19 A;  3DCU A;  1XQC A;  4ZNU A;  1HJ1 A;  2Q1V A;  4OEA A;  5DTV A;  2ZK0 A;  3WT5 A;  3OOK A;  5AAV A;  1EXA A;  5ETH A;  3AN4 A;  4TV1 B;  2ZXM A;  2ACL B;  2AO6 A;  2P54 A;  5C4T A;  2HAR A;  2PIQ A;  2YJA B;  3OS9 A;  4IVY A;  1PDU A;  3W0I A;  4XUH A;  2YAT A;  5HCV A;  3D5F A;  1SR7 A;  3X1I A;  4OIU A;  3WT6 A;  5FQP A;  5KCD A;  2HAS A;  3ADS A;  4FHH A;  3B0R A;  4Q50 A;  4RUP A;  2W8Y A;  4OKX A;  3V3Q A;  1OVL B;  2Q3Y A;  2J14 A;  5EJV A;  3WFF A;  1IE9 A;  2ATH A;  5KCE A;  1YY4 A;  1XB7 A;  3D57 A;  2Q7I A;  5DKG A;  1Z5X U;  2NW4 A;  1LV2 A;  3FUG A;  2PNU A;  5G43 A;  1RJK A;  2PIW A;  2ZNO A;  1I7G A;  2QZO A;  1NQ1 A;  1ZUC A;  1N4H A;  3BC5 A;  1R6G A;  2JF9 A;  3ET2 A;  4MGB A;  5E7V A;  1GWX A;  3NOA A;  1ZH7 A;  3PEQ A;  4RME A;  1K74 A;  4KZM A;  3G9E A;  2Q7J A;  3VT3 A;  2Q5G A;  2Q1H A;  4P6W A;  5DKE A;  3WGP A;  2P7G A;  5HJP B;  2R6Y A;  3CJW A;  4MGC A;  1PRG A;  4ZNV A;  1FM9 D;  4POH A;  3DZU A;  5DYD A;  4WLB A;  3R2A A;  1E3K A;  5E0X A;  2XYJ A;  4TV1 A;  5C4O A;  4OZR U;  2ACL A;  3FC6 B;  3FUR A;  3HC6 A;  2GL8 A;  3OZJ A;  4LNX A;  1FBY A;  4N5G A;  1N83 A;  3AUQ A;  5KCW A;  1S9P A;  2P15 A;  2Q6J A;  3IPQ A;  3V49 A;  2HVC A;  1ILG A;  3OMO A;  5JJM B;  2IOK A;  2R6W A;  3AUR A;  4R06 A;  3VT8 A;  3VJH A;  4J5W C;  4XUM A;  1OVL A;  4ZO1 X;  2J7X A;  4K7A A;  1XZX X;  2G5O A;  4WHG A;  1M7W A;  1QKT A;  4TUZ B;  4XI3 A;  1OT7 A;  3G8I A;  3ZRB A;  2ZVT A;  2HC4 A;  3VRW A;  1YOW A;  3K6P A;  3FXV A;  2ZMH A;  3JZB A;  4OKT A;  4JYG A;  2PIO A;  4OZT E;  5DWE A;  3WTQ A;  4NIE A;  4JYH A;  3GYU A;  4O8F A;  4R2U A;  3VT6 A;  3FAL A;  4L98 A;  1I38 A;  1S0X A;  2LBD A;  1YOK A;  1XP1 A;  1XPC A;  2QA6 A;  2PRG A;  4E4K A;  3OKH A;  5DMF A;  2PIP L;  1T63 A;  5GT4 A;  2IHQ A;  3UP3 A;  5KCF A;  5ACC A;  4LBD A;  5DY8 A;  2P1V A;  2ZAS A;  2YLY A;  4OH6 A;  1BSX A;  3B67 A;  4PRG A;  3UUD B;  5GID A;  3V9V A;  2OVM A;  3DR1 A;  3W0G A;  4NQA B;  3FC6 A;  1R1K D;  1XNX A;  2Q5P A;  2OAX A;  2V7C A;  2PIV A;  4PWL A;  3E7C A;  2G0H A;  5G3J A;  3R5M A;  5JJM A;  3L03 A;  3V4A A;  5DUE A;  4ONI A;  3CS4 A;  5DK9 A;  5HJS A;  3OAP A;  1FM9 A;  1GWR A;  3L0L A;  1YUC A;  2AA2 A;  4WVD A;  3VJT A;  1ZDT A;  1RKH A;  1ZEO A;  3ADT A;  4OJB A;  4TUZ A;  4XT9 A;  3B0W A;  5KCC A;  4ZN9 A;  3WT7 A;  4UDD A;  2AX6 A;  3HM1 A;  5SYZ A;  1YYE A;  3ET0 A;  4IQR A;  1VJB A;  3OLS A;  3OMM A;  4NY9 A;  5APK A;  5IXK A;  2NXX E;  1NRL A;  4J5X C;  2G44 A;  1G1U A;  3AZ2 A;  1YMT A;  5JI0 D;  5DWG A;  2AMA A;  2EWP A;  5L7E A;  3UVV B;  4OIV A;  3HQ5 A;  1IE8 A;  3NSP A;  3KBA A;  3AX8 A;  5AYG A;  4YMQ A;  3ADW A;  4PP3 A;  5KYA A;  4ZJW A;  5KRO A;  5LGA A;  2QPY A;  3ADV A;  1T7T A;  1PK5 A;  4S0S A;  3LBD A;  5FQR A;  2POB A;  3ADU A;  3OLL A;  1MV9 A;  3ET3 A;  4MGA B;  3K22 A;  3UUD A;  2PIR A;  2PIT A;  2JFA A;  1PCG A;  1T65 A;  3FLI A;  5EGV A;  3KDU A;  4IV2 A;  1KV6 A;  1P8D A;  3OS8 A;  4XAO A;  1M13 A;  2NXX A;  2B1V A;  3VRV A;  4P6X A;  3R8I A;  3FS1 A;  3VN2 A;  2VV1 A;  2FAI A;  5DYB A;  2ZMI A;  4A4V A;  1ERE A;  3E94 A;  3K23 A;  5DIE A;  4J5X A;  2PIX A;  2GP7 A;  2AA5 A;  2YLP A;  4IA7 A;  2AAX A;  1XQ3 A;  2ZKC A;  3HC5 A;  1T76 A;  4MGD B;  3W0J A;  1FCY A;  1R1K A;  5EIT A;  1G5Y A;  3IPS A;  4G20 A;  1Y9R A;  4PPS A;  4MDD A;  3L0J A;  4OK1 A;  5DU5 A;  4MG7 B;  3HVL A;  3QT0 A;  3CS8 A;  4RAK A;  2OVH A;  4RZG A;  1ZKY A;  1L2J A;  3OSA A;  5KRM A;  3UVV A;  2YJD A;  4EMA A;  3NSQ A;  3A2I A;  3B66 A;  3Q95 B;  2Q59 A;  4MG8 A;  1YA3 A;  4Q0A C;  5DVS A;  5C4U A;  5HYR A;  2HWR A;  2ZK2 A;  4K4J A;  1WM0 X;  1XNN A;  3B5R A;  2BAW A;  1R20 A;  3B1M A;  3L3X A;  1S9Q A;  1XVP B;  4MGA A;  4MG9 A;  4OIL A;  3B68 A;  3L0E A;  2GIU A;  2HB8 A;  3R29 A;  2AM9 A;  2B23 A;  3UU7 B;  5KR9 A;  2QXM A;  3VT9 A;  3FAL B;  4IWC A;  2QH6 A;  3TKC A;  3RUT A;  2FSZ A;  2ZK1 A;  3B3K A;  4DOR A;  4DMA A;  3UP0 A;  1XP9 A;  3U9Q A;  3OZ0 A;  3W5P A;  4PP5 A;  4KZI A;  2F4B A;  3VRT A;  4LSJ A;  4RUO X;  2VV2 A;  4OZT U;  4ZO1 B;  2AWH A;  5AAU A;  2PIN A;  2ZBS A;  1LBD A;  3W0H A;  1G2N A;  1T79 A;  4M8E A;  3OMQ A;  2OUZ A;  4MGD A;  2QGW A;  3CWD A;  2B50 A;  3MNP A;  4LNW A;  2QGT A;  3H52 A;  4QJR A;  4DQM A;  1K7L A;  2V0V A;  4ZN7 A;  3KWY A;  3W0Y A;  1L2I A;  3K8S A;  4X1G A;  5L7H A;  1ZDU A;  2I4Z A;  4MG7 A;  4N8R A;  2Q8S A;  1SJ0 A;  3F5C A;  5KCU A;  1X78 A;  5AWJ A;  1QKU A;  2PJL A;  2ZL9 A;  1KNU A;  4JL4 A;  5B41 A;  4XLD A;  1UHL B;  2OCF A;  4PVU A;  1GS4 A;  5DX3 B;  5APJ A;  5EI1 A;  3MNO A;  5AZV A;  3KPZ A;  3Q95 A;  4LTW A;  1T73 A;  2Z4B A;  1RKG A;  4G2I A;  1T5Z A;  2VSR A;  3ILZ A;  1XVP A;  4J24 A;  1EXX A;  1XAP A;  1K4W A;  5H1E A;  4OAR A;  2Q5S A;  5G44 A;  4IWF A;  1NYX A;  3UU7 A;  3OMP A;  5KRL A;  1FCZ A;  3VT4 A;  5DSH A;  2PIU A;  3O1D A;  3OSI A;  1ZGY A;  3B65 A;  4YT1 A;  5HYK A;  2J4A A;  3ET1 A;  2GPU A;  2O4R A;  3AZ3 A;  3IA6 A;  3AUN A;  4PLD A;  1YIN A;  3DZY D;  5DXK A;  4RUJ A;  4RZF A;  1NQ7 A;  2QNV A;  4G1Y A;  1Q4X A;  3AN3 A;  1YIM A;  2JFA B;  3A9E B;  3N00 A;  5B5B A;  3UUA B;  3V3E A;  4OED A;  4ZNT A;  1M2Z A;  3WFG A;  1OSV A;  3W5Q A;  2XYX A;  4UDC A;  3BEJ A;  3P89 A;  4BCR A;  4L96 A;  5KRC A;  2VV1 B;  1YP0 A;  5IZ0 A;  4N73 A;  5FQV A;  3R5N A;  4DK8 A;  3ERT A;  5KYJ A;  1TXI A;  4IA3 A;  5DL4 A;  4Q13 A;  2O9I A;  1UHL A;  3OS8 C;  3A2J A;  5DX3 A;  3FEJ A;  2Q61 A;  1X7E A;  4X1F A;  2OZ7 A;  5LWP A;  2AA6 A;  2Q6R A;  1NAX A;  4MG5 A;  5KD9 A;  3E00 D;  2A3I A;  2ZFX A;  1HG4 A;  3CQV A;  3B0Q A;  2I4J A;  1PQ6 A;  2OM9 A;  2AA7 A;  3H0A D;  4RFW A;  4RMD A;  1ERR A;  5HZC A;  4KZJ A;  3VJS A;  4CI4 A;  5EC9 A;  5KRI A;  1GWQ A;  1QKN A;  5DXB B;  5E14 A;  2Q6S A;  1T74 A;  4OKW A;  2ZLA A;  2Q59 B;  4MG8 B;  4E2J A;  1U3R A;  2QW4 A;  3KMR A;  1ZAF A;  3DCT A;  5DIG A;  5KRA A;  2P7A A;  3VT7 A;  3VSO A;  3HLV A;  3VT5 A;  2E2R A;  4OJ4 A;  3A3Z X;  4CSJ A;  4MG9 B;  3IMY A;  2HBH A;  4IA2 A;  4ITE A;  4QE8 A;  2QSE A;  1MZN A;  1SKX A;  1DB1 A;  2ZK4 A;  3A9E A;  4PLE A;  4WHF A;  2FVJ A;  3UUA A;  5KCT A;  3L1B A;  3W5R A;  2Q7L A;  2XHS A;  4ZJR A;  3VI8 A;  4OH5 A;  5K13 A;  5DXM A;  3O1E A;  5DUG A;  5GIC A;  3S9S A;  4G21 A;  3GBK A;  4ZNS A;  4POJ A;  3GWS X;  5E0W A;  3VTB A;  3G8O A;  3SP6 A;  1I7I A;  2AMB A;  2I0J A;  4APU A;  3TX7 B;  2Q7K A;  1Z95 A;  4IW6 A;  4UDA A;  3DZY A;  3KDT A;  5ICK A;  4OKB A;  1XJ7 A;  3TY0 A;  3F7D A;  3OOF A;  5DZ0 A;  2I4P A;  2H77 A;  2J7Y A;  2Q70 A;  3CS6 A;  4XTA A;  3X1H A;  4OEZ A;  3WWR A;  4IVW A;  4ITF A;  2QMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...