1FM6D

The 2.1 angstrom resolution crystal structure of the heterodimer of the human rxralpha and ppargamma ligand binding domains respectively bound with 9-cis retinoic acid and rosiglitazone and co-activator peptides.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
272
structure length
272
Chain Sequence
PESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asymmetry in the PPARgamma/RXRalpha crystal structure reveals the molecular basis of heterodimerization among nuclear receptors.
pubmed doi rcsb
molecule keywords RETINOIC ACID RECEPTOR RXR-ALPHA
molecule tags Transcription
source organism Homo sapiens
total genus 100
structure length 272
sequence length 272
chains with identical sequence X
ec nomenclature
pdb deposition date 2000-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 1fm6D00
5G43A 2QE4A 2R40D 5APJA 2QH6A 2LBDA 4X1FA 2GP7A 5DKSA 2YFEA 2ZASA 5DX3A 3G0WA 3U9QA 3OSAA 3UVVB 2AAXA 2ACLB 1XP9A 3B1MA 4L96A 5AWJA 4RE8A 1KKQA 3DCTA 2Q5PA 3HM1A 3P89A 1FM9D 4LTWA 3L0LA 1QKNA 1TFCA 4K6IA 3WMHA 1YJEA 5DU5A 2ABIA 2GPUA 3AFRA 4FN9A 5DZIA 5E14A 2G0GA 5AVIA 4WHFA 3AZ3A 3S9SA 1QKMA 3L3XA 2QABA 3HVLA 4N5GA 4IVWA 3ZRAA 3OLLA 3OLSA 5IXKA 5L7GA 1L2IA 3H52A 4ZJRA 3IXPD 1VJBA 3L1BA 1ILGA 1G5YA 4OHAA 5JJMB 2AYRA 4RMCA 3TX7B 5DL4A 2Q59B 5I4VA 1FM6D 1G2NA 1ZGYA 2IOGA 3GBKA 4OJBA 5LWPA 4PPSA 4REFA 1RK3A 3UUCA 4CI4A 2Q5SA 5DKBA 2B1VA 3B68A 2I4JA 5DXBA 1FCZA 1UPWA 2HWRA 3WT6A 5KRKA 1RDTD 1X78A 3ADWA 4OEYA 2AWHA 2I4ZA 1G1UA 1ZDTA 4P6WA 5HCVA 4REEA 5IZ0A 5DSHA 3UU7B 3UP0A 2VV1B 2PRGA 4OIUA 5B5BA 1PCGA 3ADUA 4YT1A 2GIUA 5DVVA 4WLBA 1I7IA 2ZK5A 1NQ0A 2QR9A 4RZFA 5G44A 3AN4A 5A86A 4IW6A 3R8AA 5L7EA 1I7GA 5DZHA 3R5NA 4OARA 5C4OA 1T73A 2Q1HA 1M2ZA 4HLWA 4XI3A 1XJ7A 2XHSA 2XYJA 1S0ZA 2ZK3A 3O1DA 4J5XA 4NB6A 3WT5A 3A40X 3GZ9A 3DZYA 2Q7IA 4XUMA 4DM6A 5DYBA 4MGCA 2NV7A 1KNUA 5DZ3A 5APKA 2ACLA 2PIVA 3VTBA 4JGVA 2AA5A 3OSWA 2J7YA 2POGA 2I0JA 3B0TA 2OVMA 4K7AA 3GN8A 4OILA 3PRGA 4ZNWA 3MNPA 4FHIA 1I37A 4XT9A 3AZ1A 1T76A 2Q60A 3FALA 5C4TA 1XB7A 3B67A 5JI0D 2ZFXA 2E2RA 4HEEX 4G2IA 1XP1A 3TKMA 4OKBA 1R5KA 4IS8A 3VSPA 3WJ5A 1I38A 2OZ7A 5G42A 3L0JA 5DXPA 2P54A 4RUPA 1K74A 2QMVA 2YJDA 4MGDB 2OM9A 2FVJA 1ZUCA 1YMTA 3CJWA 3VT7A 5JJMA 1ERRA 2REWA 2ZKCA 5DIEA 2Q59A 3B0RA 4E2JA 4ZNSA 5HJPB 5DVSA 3AUQA 3FEIA 3VRVA 3VT8A 3OMQA 1OSHA 3FS1A 5DVCA 1RKGA 4S0SA 5DV8A 3V49A 5AAVA 3W0IA 1NAVA 4DK8A 1XOWA 5DWGA 1MV9A 3OAPA 2H77A 1SQNA 3K22A 3FURA 3PLZA 4P6XA 4ZNHA 1YOWA 2AB2A 2XYWA 3A2JA 4PRGA 3GD2A 2YATA 2OAXA 1H9UA 4J5WC 3L03A 4ZNTA 1DKFA 1X7BA 2HVCA 4NUFA 3W0HA 2HWQA 3VT3A 4OFUA 5DYDA 2Q6JA 5GIEA 2QA6A 3W5QA 1YINA 5E1CA 5KROA 5DKEA 4UDDA 5FQSA 4WPFA 4OH5A 4MG5A 4UDBA 4PWLA 1Z5XU 3F5CB 1T65A 1YY4A 3D90A 1EXXA 4ZO1B 1NAXA 1ZAFA 2H79A 2HBHA 3GWSX 4MG7A 4OZRE 3ADXA 4OZRU 4PF3A 3WJ4A 2ZXNA 3PBAA 1WM0X 2Q5GA 3W5RA 2IOKA 2P7GA 5G45A 1QKTA 4LNWA 4MG9B 3Q95B 3NSPA 2ZVTA 3ERTA 1E3KA 4PP3A 1YP0A 1IE9A 5EGVA 5DRJA 3E00D 4Q50A 3QT0A 3IA6A 4JYGA 4PP6A 3JZBA 2QZOB 1X7RA 5DKGA 5E0XA 3R8DA 4FNEA 4LNXA 1R1KD 5KRCA 3DZUD 4PPPA 2PNUA 1A52A 5KCDA 2P1TA 1LBDA 4RUOX 2GL8A 2ZL9A 3VI8A 2HAMA 1T7RA 3OGTA 4ZN7A 1PK5A 3LBDA 2Z4JA 5HJPA 3IPUA 5DZ0A 4YMQA 1XV9B 2HB8A 2G0HA 1NQ2A 4A4WA 5ETHA 2ZMJA 3A2IA 1UHLA 2P1VA 3G9EA 4PVUA 4E4KA 4NQAB 5DI7A 4FGYA 4G21A 3PEQA 1FCYA 1XIUA 3OMPA 3R29A 2Q6SA 3OMMA 4KZJA 4S0TA 2QW4A 1N83A 3H0AA 1NRLA 4M8EA 3D57A 1RKHA 4IUIA 4S14A 5G46A 1FD0A 5KCWA 2ZXMA 4CSJA 3FXVA 1R20A 2P1UA 4QM0A 5DUGA 3VJTA 3VTDA 5DY8A 1Z95A 2NXXA 1Y0SA 3ADSA 2YLYA 4DORA 4ZI1A 1T74A 2BJ4B 4JYIA 2AX9A 2HFPA 1X76A 2YLOA 3B0QA 3R8IA 4DQMA 3R5MA 3WTQA 3X1HA 3F5CA 1GWXA 4J24A 5CJ6A 4YNKA 5E0WA 5AAUA 1BSXA 1T7TA 3HC6A 1T63A 2FAIA 2PIXA 3E94A 3L3ZA 2HB7A 5KRJA 1XP6A 2NPAA 1MVCA 2ZK2A 4R06A 1YUCA 2V7CA 2XYXA 3NOAA 3K8SA 2XKWA 1S19A 2W8YA 2ZK6A 2GPOA 3W0GA 5M96A 4XHDA 3Q95A 4OIVA 3D5FA 2QNVA 1T79A 1ZKYA 5AZVA 2AX6A 4ZNUA 1ILHA 3G8IA 4J5WA 3VTCA 1XAPA 1E3GA 4NIEA 3ET1A 4TV1A 3RUUA 5K13A 3EYBA 4IVYA 5KRLA 2JF9A 2QXSA 3CS6A 5DXQA 1S9QA 3H0AD 4N73A 2P7ZA 1PRGA 5DWLA 3UP3A 5GT4A 1QKUA 4N8RA 2Q70A 1HG4A 3UUDB 1M13A 1M7WA 1R20D 3HZFA 4UDAA 5DWJA 4MGBB 3CDSA 4MG8B 5DIDA 5DXMA 1NQ7A 1XLSA 4OJ4A 5AWKA 1L2JA 3UVVA 4Y29A 2IHQA 1LV2A 2AA2A 2OUZA 3KYTA 1XV9A 5E15A 1XVPB 3M7RA 5DXKA 3OKHA 3ADVA 3KMZA 2B50A 3A9EB 1Y9RA 5KYAA 3ERDA 4G20A 5KCFA 2OCFA 4IA2A 3K6PA 3VT4A 1XNXA 2P15A 3O1EA 2GPPA 1U3RA 1OSVA 1T5ZA 4WQPA 3W0YA 4G2HA 4ZJWA 3KMRA 1U3QA 1UPVA 2B23A 3CTBA 2ZMIA 5DZ1A 3WGPA 3HC5A 4XUHA 4L98A 2BJ4A 3P0UA 2QXMA 4QE6A 1GS4A 4UDCA 2EWPA 2PIQA 2QSEA 3ET3A 3W5PA 2Q1VA 3KMGA 3W0CA 4EM9A 3FEJA 2R6WA 3UUAB 4APUA 2AX7A 1YOKA 3KDTA 1GWRA 2YLQA 4ZOMA 2Q61A 3DZYD 1NQ1A 2ZNPA 4PLEA 4IA1A 5E19A 5DMCA 3UU7A 2ATHA 5DLRA 4DK7A 1FCXA 2VV1A 3OOKA 1XDKB 3LMPA 4OKXA 5EHJA 3SP9A 1OT7A 4DM8A 5DRMA 4QL8A 3K23A 4EMAA 2PKLA 5B41A 4OFRA 1ZEOA 2AM9A 4MG6A 2VV3A 2A3IA 1S9PA 2AO6A 2I0GA 5AZTA 3WFGA 3R2AA 4IV2A 2VSTA 3A78A 3RUTA 3KFCA 4ZO1X 4IW8A 4POJA 1NDEA 1R6GA 2ZY0A 5KRMA 4ONIA 2GTKA 2YJAB 2ZNNA 4MGBA 5DIGA 3B3KA 2BAWA 1SJ0A 4POHA 4X1GA 1K74D 3VN2A 5JY3A 5KR9A 3OKIA 1YYEA 4G1ZA 5GICA 1PDUA 2VV0A 2Q6RA 3ILZA 3L0EA 4OH6A 3P8XA 1SKXA 4R6SA 5DUEA 4ITFA 2HARA 3WFFA 4DOSA 3IMYA 3TKCA 2VV4B 5DXRA 5L11A 3PO9A 2V0VA 5KRIA 2ZNQA 4R2UA 4OEAA 3VHWA 3VHUA 1FM9A 1NHZA 4KZIA 2G5OA 3HODA 4JYHA 1ZH7A 4MGDA 4MGAB 3V9YA 4OJ9A 2QPYA 4ZNVA 1N46A 5L7HA 3VHVA 4IWFA 2VSRA 4OLMA 1MZNA 5H1EA 1ZDUA 2Q8SA 3IXPA 4Q13A 5ACCA 5DXGA 3OMKA 3P88A 4WVDA 1FM6A 3V3EA 1TXIA 4QE8A 3B0WA 3VT6A 2ZMHA 2PIRA 1Q4XA 3ET2A 4XTAA 4OC7A 4N1YA 3KWYA 2PITA 5DMFA 5DV3A 5HJSA 4A2JA 1RDTA 2PJLA 3BEJA 2ZK1A 2QGTA 1OVLB 4S15A 4Q0AC 5ICKA 1T7MA 2J7XA 2Q7KA 5AYGA 1Y0XX 2POBA 3OLFA 1RJKA 2AMBA 3AN3A 2AA7A 3A2HA 2P4YA 4RMDA 4WHGA 3CS8A 3ZR7A 1G50A 3AZ2A 2P7AA 3D6DA 4G1DA 2R6YA 3V9TA 2ZNOA 3T03A 3OOFA 3OZJA 3V4AA 4B7WA 3FALB 3HO0A 2JFAB 4TUZB 1K4WA 1P93A 3RY9A 4MG9A 1XZXX 3MNEA 4PXMA 2VV4A 2YHDA 3A3ZX 4O8FA 5LGAA 4E4QA 3N00A 1KV6A 3FC6B 2AXAA 2AX8A 3NSQA 1U3SA 3RLLA 3RLJA 1S0XA 1SR7A 2QZOA 3B66A 3DT3A 5KD9A 5DP0A 3VJIA 3KBAA 3IPQA 4MGAA 2I4PA 3B65A 4LBDA 4IA7A 3VRUA 5DXEA 1PQ9A 3W0JA 1YIMA 4XAOA 5AAVB 5KCCA 1NYXA 2ZXZA 1UOMA 2HCDA 5DUHA 3WWRA 2JJ3A 3IPSA 4K4JA 4NY9A 4RFWA 4IQRA 4IU7A 1T7FA 3BC5A 3HLVA 3D24A 3TY0A 2PIUA 1DKFB 2QTUA 3OS8C 5DWIA 1DB1A 5FQRA 3KDUA 5APHA 4PP5A 3VRWA 1XQ3A 1XQCA 4CI5A 4OKTA 1NUOA 2J14A 2PIWA 3B5RA 3GWXA 4ITEA 3KPZA 5KRAA 3SZ1A 3VT5A 2NW4A 4KZMA 1YA3A 4FHHA 5AK2A 5E7VA 3X36A 2ZK4A 1U9EA 3G8OA 1OVLA 4MG7B 2OVHA 4JAZA 4OGHA 2ZLAA 1PQ6A 5HYRA 3JZCA 2QA8B 5AVLA 4G1YA 1PQCA 1FBYA 3E7CA 5FQPA 1GWQA 4QJRA 2J4AA 5EITA 4XLDA 4BCRA 2Q3YA 3ZRBA 5FQVA 3VJHA 4RZEA 2FSZA 4OEDA 5EI1A 2JFAA 3X31A 4TUZA 2F4BA 1HJ1A 4OEZA 5G3JA 2O4JA 3OS9A 4RAKA 2Z4BA 2NXXE 2ZLCA 1EXAA 3HQ5A 4OZTE 2QGWA 3FC6A 2ZK0A 4OZTU 3ZQTA 3CQVA 5DX3B 2HASA 4ZN9A 3GYUA 3ET0A 1EREA 1N4HA 1XPCA 4QK4A 2ZBSA 3ADTA 4MDDA 5HZCA 3CLDA 4M8HA 1UHLB 2VV2A 3UUDA 3E00A 3AUNA 3CS4A 4IV4A 4MG8A 2HC4A 4JL4A 3RVFA 3CDPA 3OSIA 5SYZA 4DMAA 2GPVA 5DWEA 3V9VA 1R1KA 1X7JA 2YLPA 3DZUA 3FUGA 1XVPA 2O4RA 3DCUA 2R40A 4J26A 3A9EA 5KCUA 5EJVA 1P8DA 5KCEA 5IAWA 2B1ZA 5KCTA 3GYTA 4LSJA 2Q7JA 3SP6A 3DY6A 5DK9A 5C4UA 1Z5XE 2PINA 3AURA 3F7DA 2O9IA 4OK1A 4J5XC 4RMEA 3BQDA 2G44A 5KRFA 2PIOA 3VJSA 3OMOA 1IE8A 1XLSE 5F9BA 5DXBB 4YPQA 5EC9A 3VSOA 1K7LA 3DR1A 4OKWA 3V3QA 5DV6A 3CWDA 4PLDA 5C4SA 5FQTA 4A4VA 5HYKA 5GIDA 2Q7LA 2QA8A 4IWCA 3W5TA 4F9MA 1PZLA 3MNOA 4RZGA 3UUAA 3VT9A 2AMAA 3W0AA 3AX8A 4TV1B 5DTVA 3OZ0A 3VRTA 2PIPL 3OS8A 5KRHA 3WT7A 2GWXA 3FLIA 4IA3A 3X1IA 4RWVA 1A28A 4RUJA 1XDKA 1X7EA 5G5WA 5KYJA 2AA6A 1XNNA 3PCUA
chains in the Genus database with same CATH superfamily
5G43A 2QE4A 2R40D 5APJA 2QH6A 2LBDA 4X1FA 2GP7A 5DKSA 2YFEA 2ZASA 5DX3A 3G0WA 3U9QA 3OSAA 3UVVB 2AAXA 2ACLB 1XP9A 3B1MA 4L96A 5AWJA 4RE8A 1KKQA 3DCTA 2Q5PA 3HM1A 3P89A 1FM9D 4LTWA 3L0LA 1QKNA 1TFCA 4K6IA 3WMHA 1YJEA 5DU5A 2ABIA 2GPUA 3AFRA 4FN9A 5DZIA 5E14A 2G0GA 5AVIA 4WHFA 3AZ3A 3S9SA 1QKMA 3L3XA 2QABA 3HVLA 4N5GA 4IVWA 3ZRAA 3OLLA 3OLSA 5IXKA 5L7GA 1L2IA 3H52A 4ZJRA 3IXPD 1VJBA 3L1BA 1ILGA 1G5YA 4OHAA 5JJMB 2AYRA 4RMCA 3TX7B 5DL4A 2Q59B 5I4VA 1FM6D 1G2NA 1ZGYA 2IOGA 3GBKA 4OJBA 5LWPA 4PPSA 4REFA 1RK3A 3UUCA 4CI4A 2Q5SA 5DKBA 2B1VA 3B68A 2I4JA 5DXBA 1FCZA 1UPWA 2HWRA 3WT6A 5KRKA 1RDTD 1X78A 3ADWA 4OEYA 2AWHA 2I4ZA 1G1UA 1ZDTA 4P6WA 5HCVA 4REEA 5IZ0A 5DSHA 3UU7B 3UP0A 2VV1B 2PRGA 4OIUA 5B5BA 1PCGA 3ADUA 4YT1A 2GIUA 5DVVA 4WLBA 1I7IA 2ZK5A 1NQ0A 2QR9A 4RZFA 5G44A 3AN4A 5A86A 4IW6A 3R8AA 5L7EA 1I7GA 5DZHA 3R5NA 4OARA 5C4OA 1T73A 2Q1HA 1M2ZA 4HLWA 4XI3A 1XJ7A 2XHSA 2XYJA 1S0ZA 2ZK3A 3O1DA 4J5XA 4NB6A 3WT5A 3A40X 3GZ9A 3DZYA 2Q7IA 4XUMA 4DM6A 5DYBA 4MGCA 2NV7A 1KNUA 5DZ3A 5APKA 2ACLA 2PIVA 3VTBA 4JGVA 2AA5A 3OSWA 2J7YA 2POGA 2I0JA 3B0TA 2OVMA 4K7AA 3GN8A 4OILA 3PRGA 4ZNWA 3MNPA 4FHIA 1I37A 4XT9A 3AZ1A 1T76A 2Q60A 3FALA 5C4TA 1XB7A 3B67A 5JI0D 2ZFXA 2E2RA 4HEEX 4G2IA 1XP1A 3TKMA 4OKBA 1R5KA 4IS8A 3VSPA 3WJ5A 1I38A 2OZ7A 5G42A 3L0JA 5DXPA 2P54A 4RUPA 1K74A 2QMVA 2YJDA 4MGDB 2OM9A 2FVJA 1ZUCA 1YMTA 3CJWA 3VT7A 5JJMA 1ERRA 2REWA 2ZKCA 5DIEA 2Q59A 3B0RA 4E2JA 4ZNSA 5HJPB 5DVSA 3AUQA 3FEIA 3VRVA 3VT8A 3OMQA 1OSHA 3FS1A 5DVCA 1RKGA 4S0SA 5DV8A 3V49A 5AAVA 3W0IA 1NAVA 4DK8A 1XOWA 5DWGA 1MV9A 3OAPA 2H77A 1SQNA 3K22A 3FURA 3PLZA 4P6XA 4ZNHA 1YOWA 2AB2A 2XYWA 3A2JA 4PRGA 3GD2A 2YATA 2OAXA 1H9UA 4J5WC 3L03A 4ZNTA 1DKFA 1X7BA 2HVCA 4NUFA 3W0HA 2HWQA 3VT3A 4OFUA 5DYDA 2Q6JA 5GIEA 2QA6A 3W5QA 1YINA 5E1CA 5KROA 5DKEA 4UDDA 5FQSA 4WPFA 4OH5A 4MG5A 4UDBA 4PWLA 1Z5XU 3F5CB 1T65A 1YY4A 3D90A 1EXXA 4ZO1B 1NAXA 1ZAFA 2H79A 2HBHA 3GWSX 4MG7A 4OZRE 3ADXA 4OZRU 4PF3A 3WJ4A 2ZXNA 3PBAA 1WM0X 2Q5GA 3W5RA 2IOKA 2P7GA 5G45A 1QKTA 4LNWA 4MG9B 3Q95B 3NSPA 2ZVTA 3ERTA 1E3KA 4PP3A 1YP0A 1IE9A 5EGVA 5DRJA 3E00D 4Q50A 3QT0A 3IA6A 4JYGA 4PP6A 3JZBA 2QZOB 1X7RA 5DKGA 5E0XA 3R8DA 4FNEA 4LNXA 1R1KD 5KRCA 3DZUD 4PPPA 2PNUA 1A52A 5KCDA 2P1TA 1LBDA 4RUOX 2GL8A 2ZL9A 3VI8A 2HAMA 1T7RA 3OGTA 4ZN7A 1PK5A 3LBDA 2Z4JA 5HJPA 3IPUA 5DZ0A 4YMQA 1XV9B 2HB8A 2G0HA 1NQ2A 4A4WA 5ETHA 2ZMJA 3A2IA 1UHLA 2P1VA 3G9EA 4PVUA 4E4KA 4NQAB 5DI7A 4FGYA 4G21A 3PEQA 1FCYA 1XIUA 3OMPA 3R29A 2Q6SA 3OMMA 4KZJA 4S0TA 2QW4A 1N83A 3H0AA 1NRLA 4M8EA 3D57A 1RKHA 4IUIA 4S14A 5G46A 1FD0A 5KCWA 2ZXMA 4CSJA 3FXVA 1R20A 2P1UA 4QM0A 5DUGA 3VJTA 3VTDA 5DY8A 1Z95A 2NXXA 1Y0SA 3ADSA 2YLYA 4DORA 4ZI1A 1T74A 2BJ4B 4JYIA 2AX9A 2HFPA 1X76A 2YLOA 3B0QA 3R8IA 4DQMA 3R5MA 3WTQA 3X1HA 3F5CA 1GWXA 4J24A 5CJ6A 4YNKA 5E0WA 5AAUA 1BSXA 1T7TA 3HC6A 1T63A 2FAIA 2PIXA 3E94A 3L3ZA 2HB7A 5KRJA 1XP6A 2NPAA 1MVCA 2ZK2A 4R06A 1YUCA 2V7CA 2XYXA 3NOAA 3K8SA 2XKWA 1S19A 2W8YA 2ZK6A 2GPOA 3W0GA 5M96A 4XHDA 3Q95A 4OIVA 3D5FA 2QNVA 1T79A 1ZKYA 5AZVA 2AX6A 4ZNUA 1ILHA 3G8IA 4J5WA 3VTCA 1XAPA 1E3GA 4NIEA 3ET1A 4TV1A 3RUUA 5K13A 3EYBA 4IVYA 5KRLA 2JF9A 2QXSA 3CS6A 5DXQA 1S9QA 3H0AD 4N73A 2P7ZA 1PRGA 5DWLA 3UP3A 5GT4A 1QKUA 4N8RA 2Q70A 1HG4A 3UUDB 1M13A 1M7WA 1R20D 3HZFA 4UDAA 5DWJA 4MGBB 3CDSA 4MG8B 5DIDA 5DXMA 1NQ7A 1XLSA 4OJ4A 5AWKA 1L2JA 3UVVA 4Y29A 2IHQA 1LV2A 2AA2A 2OUZA 3KYTA 1XV9A 5E15A 1XVPB 3M7RA 5DXKA 3OKHA 3ADVA 3KMZA 2B50A 3A9EB 1Y9RA 5KYAA 3ERDA 4G20A 5KCFA 2OCFA 4IA2A 3K6PA 3VT4A 1XNXA 2P15A 3O1EA 2GPPA 1U3RA 1OSVA 1T5ZA 4WQPA 3W0YA 4G2HA 4ZJWA 3KMRA 1U3QA 1UPVA 2B23A 3CTBA 2ZMIA 5DZ1A 3WGPA 3HC5A 4XUHA 4L98A 2BJ4A 3P0UA 2QXMA 4QE6A 1GS4A 4UDCA 2EWPA 2PIQA 2QSEA 3ET3A 3W5PA 2Q1VA 3KMGA 3W0CA 4EM9A 3FEJA 2R6WA 3UUAB 4APUA 2AX7A 1YOKA 3KDTA 1GWRA 2YLQA 4ZOMA 2Q61A 3DZYD 1NQ1A 2ZNPA 4PLEA 4IA1A 5E19A 5DMCA 3UU7A 2ATHA 5DLRA 4DK7A 1FCXA 2VV1A 3OOKA 1XDKB 3LMPA 4OKXA 5EHJA 3SP9A 1OT7A 4DM8A 5DRMA 4QL8A 3K23A 4EMAA 2PKLA 5B41A 4OFRA 1ZEOA 2AM9A 4MG6A 2VV3A 2A3IA 1S9PA 2AO6A 2I0GA 5AZTA 3WFGA 3R2AA 4IV2A 2VSTA 3A78A 3RUTA 3KFCA 4ZO1X 4IW8A 4POJA 1NDEA 1R6GA 2ZY0A 5KRMA 4ONIA 2GTKA 2YJAB 2ZNNA 4MGBA 5DIGA 3B3KA 2BAWA 1SJ0A 4POHA 4X1GA 1K74D 3VN2A 5JY3A 5KR9A 3OKIA 1YYEA 4G1ZA 5GICA 1PDUA 2VV0A 2Q6RA 3ILZA 3L0EA 4OH6A 3P8XA 1SKXA 4R6SA 5DUEA 4ITFA 2HARA 3WFFA 4DOSA 3IMYA 3TKCA 2VV4B 5DXRA 5L11A 3PO9A 2V0VA 5KRIA 2ZNQA 4R2UA 4OEAA 3VHWA 3VHUA 1FM9A 1NHZA 4KZIA 2G5OA 3HODA 4JYHA 1ZH7A 4MGDA 4MGAB 3V9YA 4OJ9A 2QPYA 4ZNVA 1N46A 5L7HA 3VHVA 4IWFA 2VSRA 4OLMA 1MZNA 5H1EA 1ZDUA 2Q8SA 3IXPA 4Q13A 5ACCA 5DXGA 3OMKA 3P88A 4WVDA 1FM6A 3V3EA 1TXIA 4QE8A 3B0WA 3VT6A 2ZMHA 2PIRA 1Q4XA 3ET2A 4XTAA 4OC7A 4N1YA 3KWYA 2PITA 5DMFA 5DV3A 5HJSA 4A2JA 1RDTA 2PJLA 3BEJA 2ZK1A 2QGTA 1OVLB 4S15A 4Q0AC 5ICKA 1T7MA 2J7XA 2Q7KA 5AYGA 1Y0XX 2POBA 3OLFA 1RJKA 2AMBA 3AN3A 2AA7A 3A2HA 2P4YA 4RMDA 4WHGA 3CS8A 3ZR7A 1G50A 3AZ2A 2P7AA 3D6DA 4G1DA 2R6YA 3V9TA 2ZNOA 3T03A 3OOFA 3OZJA 3V4AA 4B7WA 3FALB 3HO0A 2JFAB 4TUZB 1K4WA 1P93A 3RY9A 4MG9A 1XZXX 3MNEA 4PXMA 2VV4A 2YHDA 3A3ZX 4O8FA 5LGAA 4E4QA 3N00A 1KV6A 3FC6B 2AXAA 2AX8A 3NSQA 1U3SA 3RLLA 3RLJA 1S0XA 1SR7A 2QZOA 3B66A 3DT3A 5KD9A 5DP0A 3VJIA 3KBAA 3IPQA 4MGAA 2I4PA 3B65A 4LBDA 4IA7A 3VRUA 5DXEA 1PQ9A 3W0JA 1YIMA 4XAOA 5AAVB 5KCCA 1NYXA 2ZXZA 1UOMA 2HCDA 5DUHA 3WWRA 2JJ3A 3IPSA 4K4JA 4NY9A 4RFWA 4IQRA 4IU7A 1T7FA 3BC5A 3HLVA 3D24A 3TY0A 2PIUA 1DKFB 2QTUA 3OS8C 5DWIA 1DB1A 5FQRA 3KDUA 5APHA 4PP5A 3VRWA 1XQ3A 1XQCA 4CI5A 4OKTA 1NUOA 2J14A 2PIWA 3B5RA 3GWXA 4ITEA 3KPZA 5KRAA 3SZ1A 3VT5A 2NW4A 4KZMA 1YA3A 4FHHA 5AK2A 5E7VA 3X36A 2ZK4A 1U9EA 3G8OA 1OVLA 4MG7B 2OVHA 4JAZA 4OGHA 2ZLAA 1PQ6A 5HYRA 3JZCA 2QA8B 5AVLA 4G1YA 1PQCA 1FBYA 3E7CA 5FQPA 1GWQA 4QJRA 2J4AA 5EITA 4XLDA 4BCRA 2Q3YA 3ZRBA 5FQVA 3VJHA 4RZEA 2FSZA 4OEDA 5EI1A 2JFAA 3X31A 4TUZA 2F4BA 1HJ1A 4OEZA 5G3JA 2O4JA 3OS9A 4RAKA 2Z4BA 2NXXE 2ZLCA 1EXAA 3HQ5A 4OZTE 2QGWA 3FC6A 2ZK0A 4OZTU 3ZQTA 3CQVA 5DX3B 2HASA 4ZN9A 3GYUA 3ET0A 1EREA 1N4HA 1XPCA 4QK4A 2ZBSA 3ADTA 4MDDA 5HZCA 3CLDA 4M8HA 1UHLB 2VV2A 3UUDA 3E00A 3AUNA 3CS4A 4IV4A 4MG8A 2HC4A 4JL4A 3RVFA 3CDPA 3OSIA 5SYZA 4DMAA 2GPVA 5DWEA 3V9VA 1R1KA 1X7JA 2YLPA 3DZUA 3FUGA 1XVPA 2O4RA 3DCUA 2R40A 4J26A 3A9EA 5KCUA 5EJVA 1P8DA 5KCEA 5IAWA 2B1ZA 5KCTA 3GYTA 4LSJA 2Q7JA 3SP6A 3DY6A 5DK9A 5C4UA 1Z5XE 2PINA 3AURA 3F7DA 2O9IA 4OK1A 4J5XC 4RMEA 3BQDA 2G44A 5KRFA 2PIOA 3VJSA 3OMOA 1IE8A 1XLSE 5F9BA 5DXBB 4YPQA 5EC9A 3VSOA 1K7LA 3DR1A 4OKWA 3V3QA 5DV6A 3CWDA 4PLDA 5C4SA 5FQTA 4A4VA 5HYKA 5GIDA 2Q7LA 2QA8A 4IWCA 3W5TA 4F9MA 1PZLA 3MNOA 4RZGA 3UUAA 3VT9A 2AMAA 3W0AA 3AX8A 4TV1B 5DTVA 3OZ0A 3VRTA 2PIPL 3OS8A 5KRHA 3WT7A 2GWXA 3FLIA 4IA3A 3X1IA 4RWVA 1A28A 4RUJA 1XDKA 1X7EA 5G5WA 5KYJA 2AA6A 1XNNA 3PCUA
chains in the Genus database with same CATH topology
5G43A 2QE4A 2R40D 5APJA 2QH6A 2LBDA 4X1FA 2GP7A 5DKSA 2YFEA 2ZASA 5DX3A 3G0WA 3U9QA 3OSAA 3UVVB 2AAXA 2ACLB 1XP9A 3B1MA 4L96A 5AWJA 4RE8A 1KKQA 3DCTA 2Q5PA 3HM1A 3P89A 1FM9D 4LTWA 3L0LA 1QKNA 1TFCA 4K6IA 3WMHA 1YJEA 5DU5A 2ABIA 2GPUA 3AFRA 4FN9A 5DZIA 5E14A 2G0GA 5AVIA 4WHFA 3AZ3A 3S9SA 1QKMA 3L3XA 2QABA 3HVLA 4N5GA 4IVWA 3ZRAA 3OLLA 3OLSA 5IXKA 5L7GA 1L2IA 3H52A 4ZJRA 3IXPD 1VJBA 3L1BA 1ILGA 1G5YA 4OHAA 5JJMB 2AYRA 4RMCA 3TX7B 5DL4A 2Q59B 5I4VA 1FM6D 1G2NA 1ZGYA 2IOGA 3GBKA 4OJBA 5LWPA 4PPSA 4REFA 1RK3A 3UUCA 4CI4A 2Q5SA 5DKBA 2B1VA 3B68A 2I4JA 5DXBA 1FCZA 1UPWA 2HWRA 3WT6A 5KRKA 1RDTD 1X78A 3ADWA 4OEYA 2AWHA 2I4ZA 1G1UA 1ZDTA 4P6WA 5HCVA 4REEA 5IZ0A 5DSHA 3UU7B 3UP0A 2VV1B 2PRGA 4OIUA 5B5BA 1PCGA 3ADUA 4YT1A 2GIUA 5DVVA 4WLBA 1I7IA 2ZK5A 1NQ0A 2QR9A 4RZFA 5G44A 3AN4A 5A86A 4IW6A 3R8AA 5L7EA 1I7GA 5DZHA 3R5NA 4OARA 5C4OA 1T73A 2Q1HA 1M2ZA 4HLWA 4XI3A 1XJ7A 2XHSA 2XYJA 1S0ZA 2ZK3A 3O1DA 4J5XA 4NB6A 3WT5A 3A40X 3GZ9A 3DZYA 2Q7IA 4XUMA 4DM6A 5DYBA 4MGCA 2NV7A 1KNUA 5DZ3A 5APKA 2ACLA 2PIVA 3VTBA 4JGVA 2AA5A 3OSWA 2J7YA 2POGA 2I0JA 3B0TA 2OVMA 4K7AA 3GN8A 4OILA 3PRGA 4ZNWA 3MNPA 4FHIA 1I37A 4XT9A 3AZ1A 1T76A 2Q60A 3FALA 5C4TA 1XB7A 3B67A 5JI0D 2ZFXA 2E2RA 4HEEX 4G2IA 1XP1A 3TKMA 4OKBA 1R5KA 4IS8A 3VSPA 3WJ5A 1I38A 2OZ7A 5G42A 3L0JA 5DXPA 2P54A 4RUPA 1K74A 2QMVA 2YJDA 4MGDB 2OM9A 2FVJA 1ZUCA 1YMTA 3CJWA 3VT7A 5JJMA 1ERRA 2REWA 2ZKCA 5DIEA 2Q59A 3B0RA 4E2JA 4ZNSA 5HJPB 5DVSA 3AUQA 3FEIA 3VRVA 3VT8A 3OMQA 1OSHA 3FS1A 5DVCA 1RKGA 4S0SA 5DV8A 3V49A 5AAVA 3W0IA 1NAVA 4DK8A 1XOWA 5DWGA 1MV9A 3OAPA 2H77A 1SQNA 3K22A 3FURA 3PLZA 4P6XA 4ZNHA 1YOWA 2AB2A 2XYWA 3A2JA 4PRGA 3GD2A 2YATA 2OAXA 1H9UA 4J5WC 3L03A 4ZNTA 1DKFA 1X7BA 2HVCA 4NUFA 3W0HA 2HWQA 3VT3A 4OFUA 5DYDA 2Q6JA 5GIEA 2QA6A 3W5QA 1YINA 5E1CA 5KROA 5DKEA 4UDDA 5FQSA 4WPFA 4OH5A 4MG5A 4UDBA 4PWLA 1Z5XU 3F5CB 1T65A 1YY4A 3D90A 1EXXA 4ZO1B 1NAXA 1ZAFA 2H79A 2HBHA 3GWSX 4MG7A 4OZRE 3ADXA 4OZRU 4PF3A 3WJ4A 2ZXNA 3PBAA 1WM0X 2Q5GA 3W5RA 2IOKA 2P7GA 5G45A 1QKTA 4LNWA 4MG9B 3Q95B 3NSPA 2ZVTA 3ERTA 1E3KA 4PP3A 1YP0A 1IE9A 5EGVA 5DRJA 3E00D 4Q50A 3QT0A 3IA6A 4JYGA 4PP6A 3JZBA 2QZOB 1X7RA 5DKGA 5E0XA 3R8DA 4FNEA 4LNXA 1R1KD 5KRCA 3DZUD 4PPPA 2PNUA 1A52A 5KCDA 2P1TA 1LBDA 4RUOX 2GL8A 2ZL9A 3VI8A 2HAMA 1T7RA 3OGTA 4ZN7A 1PK5A 3LBDA 2Z4JA 5HJPA 3IPUA 5DZ0A 4YMQA 1XV9B 2HB8A 2G0HA 1NQ2A 4A4WA 5ETHA 2ZMJA 3A2IA 1UHLA 2P1VA 3G9EA 4PVUA 4E4KA 4NQAB 5DI7A 4FGYA 4G21A 3PEQA 1FCYA 1XIUA 3OMPA 3R29A 2Q6SA 3OMMA 4KZJA 4S0TA 2QW4A 1N83A 3H0AA 1NRLA 4M8EA 3D57A 1RKHA 4IUIA 4S14A 5G46A 1FD0A 5KCWA 2ZXMA 4CSJA 3FXVA 1R20A 2P1UA 4QM0A 5DUGA 3VJTA 3VTDA 5DY8A 1Z95A 2NXXA 1Y0SA 3ADSA 2YLYA 4DORA 4ZI1A 1T74A 2BJ4B 4JYIA 2AX9A 2HFPA 1X76A 2YLOA 3B0QA 3R8IA 4DQMA 3R5MA 3WTQA 3X1HA 3F5CA 1GWXA 4J24A 5CJ6A 4YNKA 5E0WA 5AAUA 1BSXA 1T7TA 3HC6A 1T63A 2FAIA 2PIXA 3E94A 3L3ZA 2HB7A 5KRJA 1XP6A 2NPAA 1MVCA 2ZK2A 4R06A 1YUCA 2V7CA 2XYXA 3NOAA 3K8SA 2XKWA 1S19A 2W8YA 2ZK6A 2GPOA 3W0GA 5M96A 4XHDA 3Q95A 4OIVA 3D5FA 2QNVA 1T79A 1ZKYA 5AZVA 2AX6A 4ZNUA 1ILHA 3G8IA 4J5WA 3VTCA 1XAPA 1E3GA 4NIEA 3ET1A 4TV1A 3RUUA 5K13A 3EYBA 4IVYA 5KRLA 2JF9A 2QXSA 3CS6A 5DXQA 1S9QA 3H0AD 4N73A 2P7ZA 1PRGA 5DWLA 3UP3A 5GT4A 1QKUA 4N8RA 2Q70A 1HG4A 3UUDB 1M13A 1M7WA 1R20D 3HZFA 4UDAA 5DWJA 4MGBB 3CDSA 4MG8B 5DIDA 5DXMA 1NQ7A 1XLSA 4OJ4A 5AWKA 1L2JA 3UVVA 4Y29A 2IHQA 1LV2A 2AA2A 2OUZA 3KYTA 1XV9A 5E15A 1XVPB 3M7RA 5DXKA 3OKHA 3ADVA 3KMZA 2B50A 3A9EB 1Y9RA 5KYAA 3ERDA 4G20A 5KCFA 2OCFA 4IA2A 3K6PA 3VT4A 1XNXA 2P15A 3O1EA 2GPPA 1U3RA 1OSVA 1T5ZA 4WQPA 3W0YA 4G2HA 4ZJWA 3KMRA 1U3QA 1UPVA 2B23A 3CTBA 2ZMIA 5DZ1A 3WGPA 3HC5A 4XUHA 4L98A 2BJ4A 3P0UA 2QXMA 4QE6A 1GS4A 4UDCA 2EWPA 2PIQA 2QSEA 3ET3A 3W5PA 2Q1VA 3KMGA 3W0CA 4EM9A 3FEJA 2R6WA 3UUAB 4APUA 2AX7A 1YOKA 3KDTA 1GWRA 2YLQA 4ZOMA 2Q61A 3DZYD 1NQ1A 2ZNPA 4PLEA 4IA1A 5E19A 5DMCA 3UU7A 2ATHA 5DLRA 4DK7A 1FCXA 2VV1A 3OOKA 1XDKB 3LMPA 4OKXA 5EHJA 3SP9A 1OT7A 4DM8A 5DRMA 4QL8A 3K23A 4EMAA 2PKLA 5B41A 4OFRA 1ZEOA 2AM9A 4MG6A 2VV3A 2A3IA 1S9PA 2AO6A 2I0GA 5AZTA 3WFGA 3R2AA 4IV2A 2VSTA 3A78A 3RUTA 3KFCA 4ZO1X 4IW8A 4POJA 1NDEA 1R6GA 2ZY0A 5KRMA 4ONIA 2GTKA 2YJAB 2ZNNA 4MGBA 5DIGA 3B3KA 2BAWA 1SJ0A 4POHA 4X1GA 1K74D 3VN2A 5JY3A 5KR9A 3OKIA 1YYEA 4G1ZA 5GICA 1PDUA 2VV0A 2Q6RA 3ILZA 3L0EA 4OH6A 3P8XA 1SKXA 4R6SA 5DUEA 4ITFA 2HARA 3WFFA 4DOSA 3IMYA 3TKCA 2VV4B 5DXRA 5L11A 3PO9A 2V0VA 5KRIA 2ZNQA 4R2UA 4OEAA 3VHWA 3VHUA 1FM9A 1NHZA 4KZIA 2G5OA 3HODA 4JYHA 1ZH7A 4MGDA 4MGAB 3V9YA 4OJ9A 2QPYA 4ZNVA 1N46A 5L7HA 3VHVA 4IWFA 2VSRA 4OLMA 1MZNA 5H1EA 1ZDUA 2Q8SA 3IXPA 4Q13A 5ACCA 5DXGA 3OMKA 3P88A 4WVDA 1FM6A 3V3EA 1TXIA 4QE8A 3B0WA 3VT6A 2ZMHA 2PIRA 1Q4XA 3ET2A 4XTAA 4OC7A 4N1YA 3KWYA 2PITA 5DMFA 5DV3A 5HJSA 4A2JA 1RDTA 2PJLA 3BEJA 2ZK1A 2QGTA 1OVLB 4S15A 4Q0AC 5ICKA 1T7MA 2J7XA 2Q7KA 5AYGA 1Y0XX 2POBA 3OLFA 1RJKA 2AMBA 3AN3A 2AA7A 3A2HA 2P4YA 4RMDA 4WHGA 3CS8A 3ZR7A 1G50A 3AZ2A 2P7AA 3D6DA 4G1DA 2R6YA 3V9TA 2ZNOA 3T03A 3OOFA 3OZJA 3V4AA 4B7WA 3FALB 3HO0A 2JFAB 4TUZB 1K4WA 1P93A 3RY9A 4MG9A 1XZXX 3MNEA 4PXMA 2VV4A 2YHDA 3A3ZX 4O8FA 5LGAA 4E4QA 3N00A 1KV6A 3FC6B 2AXAA 2AX8A 3NSQA 1U3SA 3RLLA 3RLJA 1S0XA 1SR7A 2QZOA 3B66A 3DT3A 5KD9A 5DP0A 3VJIA 3KBAA 3IPQA 4MGAA 2I4PA 3B65A 4LBDA 4IA7A 3VRUA 5DXEA 1PQ9A 3W0JA 1YIMA 4XAOA 5AAVB 5KCCA 1NYXA 2ZXZA 1UOMA 2HCDA 5DUHA 3WWRA 2JJ3A 3IPSA 4K4JA 4NY9A 4RFWA 4IQRA 4IU7A 1T7FA 3BC5A 3HLVA 3D24A 3TY0A 2PIUA 1DKFB 2QTUA 3OS8C 5DWIA 1DB1A 5FQRA 3KDUA 5APHA 4PP5A 3VRWA 1XQ3A 1XQCA 4CI5A 4OKTA 1NUOA 2J14A 2PIWA 3B5RA 3GWXA 4ITEA 3KPZA 5KRAA 3SZ1A 3VT5A 2NW4A 4KZMA 1YA3A 4FHHA 5AK2A 5E7VA 3X36A 2ZK4A 1U9EA 3G8OA 1OVLA 4MG7B 2OVHA 4JAZA 4OGHA 2ZLAA 1PQ6A 5HYRA 3JZCA 2QA8B 5AVLA 4G1YA 1PQCA 1FBYA 3E7CA 5FQPA 1GWQA 4QJRA 2J4AA 5EITA 4XLDA 4BCRA 2Q3YA 3ZRBA 5FQVA 3VJHA 4RZEA 2FSZA 4OEDA 5EI1A 2JFAA 3X31A 4TUZA 2F4BA 1HJ1A 4OEZA 5G3JA 2O4JA 3OS9A 4RAKA 2Z4BA 2NXXE 2ZLCA 1EXAA 3HQ5A 4OZTE 2QGWA 3FC6A 2ZK0A 4OZTU 3ZQTA 3CQVA 5DX3B 2HASA 4ZN9A 3GYUA 3ET0A 1EREA 1N4HA 1XPCA 4QK4A 2ZBSA 3ADTA 4MDDA 5HZCA 3CLDA 4M8HA 1UHLB 2VV2A 3UUDA 3E00A 3AUNA 3CS4A 4IV4A 4MG8A 2HC4A 4JL4A 3RVFA 3CDPA 3OSIA 5SYZA 4DMAA 2GPVA 5DWEA 3V9VA 1R1KA 1X7JA 2YLPA 3DZUA 3FUGA 1XVPA 2O4RA 3DCUA 2R40A 4J26A 3A9EA 5KCUA 5EJVA 1P8DA 5KCEA 5IAWA 2B1ZA 5KCTA 3GYTA 4LSJA 2Q7JA 3SP6A 3DY6A 5DK9A 5C4UA 1Z5XE 2PINA 3AURA 3F7DA 2O9IA 4OK1A 4J5XC 4RMEA 3BQDA 2G44A 5KRFA 2PIOA 3VJSA 3OMOA 1IE8A 1XLSE 5F9BA 5DXBB 4YPQA 5EC9A 3VSOA 1K7LA 3DR1A 4OKWA 3V3QA 5DV6A 3CWDA 4PLDA 5C4SA 5FQTA 4A4VA 5HYKA 5GIDA 2Q7LA 2QA8A 4IWCA 3W5TA 4F9MA 1PZLA 3MNOA 4RZGA 3UUAA 3VT9A 2AMAA 3W0AA 3AX8A 4TV1B 5DTVA 3OZ0A 3VRTA 2PIPL 3OS8A 5KRHA 3WT7A 2GWXA 3FLIA 4IA3A 3X1IA 4RWVA 1A28A 4RUJA 1XDKA 1X7EA 5G5WA 5KYJA 2AA6A 1XNNA 3PCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G43 A;  2QE4 A;  2R40 D;  5APJ A;  2QH6 A;  2LBD A;  4X1F A;  2GP7 A;  5DKS A;  2YFE A;  2ZAS A;  5DX3 A;  3G0W A;  3U9Q A;  3OSA A;  3UVV B;  2AAX A;  2ACL B;  1XP9 A;  3B1M A;  4L96 A;  5AWJ A;  4RE8 A;  1KKQ A;  3DCT A;  2Q5P A;  3HM1 A;  3P89 A;  1FM9 D;  4LTW A;  3L0L A;  1QKN A;  1TFC A;  4K6I A;  3WMH A;  1YJE A;  5DU5 A;  2ABI A;  2GPU A;  3AFR A;  4FN9 A;  5DZI A;  5E14 A;  2G0G A;  5AVI A;  4WHF A;  3AZ3 A;  3S9S A;  1QKM A;  3L3X A;  2QAB A;  3HVL A;  4N5G A;  4IVW A;  3ZRA A;  3OLL A;  3OLS A;  5IXK A;  5L7G A;  1L2I A;  3H52 A;  4ZJR A;  3IXP D;  1VJB A;  3L1B A;  1ILG A;  1G5Y A;  4OHA A;  5JJM B;  2AYR A;  4RMC A;  3TX7 B;  5DL4 A;  2Q59 B;  5I4V A;  1FM6 D;  1G2N A;  1ZGY A;  2IOG A;  3GBK A;  4OJB A;  5LWP A;  4PPS A;  4REF A;  1RK3 A;  3UUC A;  4CI4 A;  2Q5S A;  5DKB A;  2B1V A;  3B68 A;  2I4J A;  5DXB A;  1FCZ A;  1UPW A;  2HWR A;  3WT6 A;  5KRK A;  1RDT D;  1X78 A;  3ADW A;  4OEY A;  2AWH A;  2I4Z A;  1G1U A;  1ZDT A;  4P6W A;  5HCV A;  4REE A;  5IZ0 A;  5DSH A;  3UU7 B;  3UP0 A;  2VV1 B;  2PRG A;  4OIU A;  5B5B A;  1PCG A;  3ADU A;  4YT1 A;  2GIU A;  5DVV A;  4WLB A;  1I7I A;  2ZK5 A;  1NQ0 A;  2QR9 A;  4RZF A;  5G44 A;  3AN4 A;  5A86 A;  4IW6 A;  3R8A A;  5L7E A;  1I7G A;  5DZH A;  3R5N A;  4OAR A;  5C4O A;  1T73 A;  2Q1H A;  1M2Z A;  4HLW A;  4XI3 A;  1XJ7 A;  2XHS A;  2XYJ A;  1S0Z A;  2ZK3 A;  3O1D A;  4J5X A;  4NB6 A;  3WT5 A;  3A40 X;  3GZ9 A;  3DZY A;  2Q7I A;  4XUM A;  4DM6 A;  5DYB A;  4MGC A;  2NV7 A;  1KNU A;  5DZ3 A;  5APK A;  2ACL A;  2PIV A;  3VTB A;  4JGV A;  2AA5 A;  3OSW A;  2J7Y A;  2POG A;  2I0J A;  3B0T A;  2OVM A;  4K7A A;  3GN8 A;  4OIL A;  3PRG A;  4ZNW A;  3MNP A;  4FHI A;  1I37 A;  4XT9 A;  3AZ1 A;  1T76 A;  2Q60 A;  3FAL A;  5C4T A;  1XB7 A;  3B67 A;  5JI0 D;  2ZFX A;  2E2R A;  4HEE X;  4G2I A;  1XP1 A;  3TKM A;  4OKB A;  1R5K A;  4IS8 A;  3VSP A;  3WJ5 A;  1I38 A;  2OZ7 A;  5G42 A;  3L0J A;  5DXP A;  2P54 A;  4RUP A;  1K74 A;  2QMV A;  2YJD A;  4MGD B;  2OM9 A;  2FVJ A;  1ZUC A;  1YMT A;  3CJW A;  3VT7 A;  5JJM A;  1ERR A;  2REW A;  2ZKC A;  5DIE A;  2Q59 A;  3B0R A;  4E2J A;  4ZNS A;  5HJP B;  5DVS A;  3AUQ A;  3FEI A;  3VRV A;  3VT8 A;  3OMQ A;  1OSH A;  3FS1 A;  5DVC A;  1RKG A;  4S0S A;  5DV8 A;  3V49 A;  5AAV A;  3W0I A;  1NAV A;  4DK8 A;  1XOW A;  5DWG A;  1MV9 A;  3OAP A;  2H77 A;  1SQN A;  3K22 A;  3FUR A;  3PLZ A;  4P6X A;  4ZNH A;  1YOW A;  2AB2 A;  2XYW A;  3A2J A;  4PRG A;  3GD2 A;  2YAT A;  2OAX A;  1H9U A;  4J5W C;  3L03 A;  4ZNT A;  1DKF A;  1X7B A;  2HVC A;  4NUF A;  3W0H A;  2HWQ A;  3VT3 A;  4OFU A;  5DYD A;  2Q6J A;  5GIE A;  2QA6 A;  3W5Q A;  1YIN A;  5E1C A;  5KRO A;  5DKE A;  4UDD A;  5FQS A;  4WPF A;  4OH5 A;  4MG5 A;  4UDB A;  4PWL A;  1Z5X U;  3F5C B;  1T65 A;  1YY4 A;  3D90 A;  1EXX A;  4ZO1 B;  1NAX A;  1ZAF A;  2H79 A;  2HBH A;  3GWS X;  4MG7 A;  4OZR E;  3ADX A;  4OZR U;  4PF3 A;  3WJ4 A;  2ZXN A;  3PBA A;  1WM0 X;  2Q5G A;  3W5R A;  2IOK A;  2P7G A;  5G45 A;  1QKT A;  4LNW A;  4MG9 B;  3Q95 B;  3NSP A;  2ZVT A;  3ERT A;  1E3K A;  4PP3 A;  1YP0 A;  1IE9 A;  5EGV A;  5DRJ A;  3E00 D;  4Q50 A;  3QT0 A;  3IA6 A;  4JYG A;  4PP6 A;  3JZB A;  2QZO B;  1X7R A;  5DKG A;  5E0X A;  3R8D A;  4FNE A;  4LNX A;  1R1K D;  5KRC A;  3DZU D;  4PPP A;  2PNU A;  1A52 A;  5KCD A;  2P1T A;  1LBD A;  4RUO X;  2GL8 A;  2ZL9 A;  3VI8 A;  2HAM A;  1T7R A;  3OGT A;  4ZN7 A;  1PK5 A;  3LBD A;  2Z4J A;  5HJP A;  3IPU A;  5DZ0 A;  4YMQ A;  1XV9 B;  2HB8 A;  2G0H A;  1NQ2 A;  4A4W A;  5ETH A;  2ZMJ A;  3A2I A;  1UHL A;  2P1V A;  3G9E A;  4PVU A;  4E4K A;  4NQA B;  5DI7 A;  4FGY A;  4G21 A;  3PEQ A;  1FCY A;  1XIU A;  3OMP A;  3R29 A;  2Q6S A;  3OMM A;  4KZJ A;  4S0T A;  2QW4 A;  1N83 A;  3H0A A;  1NRL A;  4M8E A;  3D57 A;  1RKH A;  4IUI A;  4S14 A;  5G46 A;  1FD0 A;  5KCW A;  2ZXM A;  4CSJ A;  3FXV A;  1R20 A;  2P1U A;  4QM0 A;  5DUG A;  3VJT A;  3VTD A;  5DY8 A;  1Z95 A;  2NXX A;  1Y0S A;  3ADS A;  2YLY A;  4DOR A;  4ZI1 A;  1T74 A;  2BJ4 B;  4JYI A;  2AX9 A;  2HFP A;  1X76 A;  2YLO A;  3B0Q A;  3R8I A;  4DQM A;  3R5M A;  3WTQ A;  3X1H A;  3F5C A;  1GWX A;  4J24 A;  5CJ6 A;  4YNK A;  5E0W A;  5AAU A;  1BSX A;  1T7T A;  3HC6 A;  1T63 A;  2FAI A;  2PIX A;  3E94 A;  3L3Z A;  2HB7 A;  5KRJ A;  1XP6 A;  2NPA A;  1MVC A;  2ZK2 A;  4R06 A;  1YUC A;  2V7C A;  2XYX A;  3NOA A;  3K8S A;  2XKW A;  1S19 A;  2W8Y A;  2ZK6 A;  2GPO A;  3W0G A;  5M96 A;  4XHD A;  3Q95 A;  4OIV A;  3D5F A;  2QNV A;  1T79 A;  1ZKY A;  5AZV A;  2AX6 A;  4ZNU A;  1ILH A;  3G8I A;  4J5W A;  3VTC A;  1XAP A;  1E3G A;  4NIE A;  3ET1 A;  4TV1 A;  3RUU A;  5K13 A;  3EYB A;  4IVY A;  5KRL A;  2JF9 A;  2QXS A;  3CS6 A;  5DXQ A;  1S9Q A;  3H0A D;  4N73 A;  2P7Z A;  1PRG A;  5DWL A;  3UP3 A;  5GT4 A;  1QKU A;  4N8R A;  2Q70 A;  1HG4 A;  3UUD B;  1M13 A;  1M7W A;  1R20 D;  3HZF A;  4UDA A;  5DWJ A;  4MGB B;  3CDS A;  4MG8 B;  5DID A;  5DXM A;  1NQ7 A;  1XLS A;  4OJ4 A;  5AWK A;  1L2J A;  3UVV A;  4Y29 A;  2IHQ A;  1LV2 A;  2AA2 A;  2OUZ A;  3KYT A;  1XV9 A;  5E15 A;  1XVP B;  3M7R A;  5DXK A;  3OKH A;  3ADV A;  3KMZ A;  2B50 A;  3A9E B;  1Y9R A;  5KYA A;  3ERD A;  4G20 A;  5KCF A;  2OCF A;  4IA2 A;  3K6P A;  3VT4 A;  1XNX A;  2P15 A;  3O1E A;  2GPP A;  1U3R A;  1OSV A;  1T5Z A;  4WQP A;  3W0Y A;  4G2H A;  4ZJW A;  3KMR A;  1U3Q A;  1UPV A;  2B23 A;  3CTB A;  2ZMI A;  5DZ1 A;  3WGP A;  3HC5 A;  4XUH A;  4L98 A;  2BJ4 A;  3P0U A;  2QXM A;  4QE6 A;  1GS4 A;  4UDC A;  2EWP A;  2PIQ A;  2QSE A;  3ET3 A;  3W5P A;  2Q1V A;  3KMG A;  3W0C A;  4EM9 A;  3FEJ A;  2R6W A;  3UUA B;  4APU A;  2AX7 A;  1YOK A;  3KDT A;  1GWR A;  2YLQ A;  4ZOM A;  2Q61 A;  3DZY D;  1NQ1 A;  2ZNP A;  4PLE A;  4IA1 A;  5E19 A;  5DMC A;  3UU7 A;  2ATH A;  5DLR A;  4DK7 A;  1FCX A;  2VV1 A;  3OOK A;  1XDK B;  3LMP A;  4OKX A;  5EHJ A;  3SP9 A;  1OT7 A;  4DM8 A;  5DRM A;  4QL8 A;  3K23 A;  4EMA A;  2PKL A;  5B41 A;  4OFR A;  1ZEO A;  2AM9 A;  4MG6 A;  2VV3 A;  2A3I A;  1S9P A;  2AO6 A;  2I0G A;  5AZT A;  3WFG A;  3R2A A;  4IV2 A;  2VST A;  3A78 A;  3RUT A;  3KFC A;  4ZO1 X;  4IW8 A;  4POJ A;  1NDE A;  1R6G A;  2ZY0 A;  5KRM A;  4ONI A;  2GTK A;  2YJA B;  2ZNN A;  4MGB A;  5DIG A;  3B3K A;  2BAW A;  1SJ0 A;  4POH A;  4X1G A;  1K74 D;  3VN2 A;  5JY3 A;  5KR9 A;  3OKI A;  1YYE A;  4G1Z A;  5GIC A;  1PDU A;  2VV0 A;  2Q6R A;  3ILZ A;  3L0E A;  4OH6 A;  3P8X A;  1SKX A;  4R6S A;  5DUE A;  4ITF A;  2HAR A;  3WFF A;  4DOS A;  3IMY A;  3TKC A;  2VV4 B;  5DXR A;  5L11 A;  3PO9 A;  2V0V A;  5KRI A;  2ZNQ A;  4R2U A;  4OEA A;  3VHW A;  3VHU A;  1FM9 A;  1NHZ A;  4KZI A;  2G5O A;  3HOD A;  4JYH A;  1ZH7 A;  4MGD A;  4MGA B;  3V9Y A;  4OJ9 A;  2QPY A;  4ZNV A;  1N46 A;  5L7H A;  3VHV A;  4IWF A;  2VSR A;  4OLM A;  1MZN A;  5H1E A;  1ZDU A;  2Q8S A;  3IXP A;  4Q13 A;  5ACC A;  5DXG A;  3OMK A;  3P88 A;  4WVD A;  1FM6 A;  3V3E A;  1TXI A;  4QE8 A;  3B0W A;  3VT6 A;  2ZMH A;  2PIR A;  1Q4X A;  3ET2 A;  4XTA A;  4OC7 A;  4N1Y A;  3KWY A;  2PIT A;  5DMF A;  5DV3 A;  5HJS A;  4A2J A;  1RDT A;  2PJL A;  3BEJ A;  2ZK1 A;  2QGT A;  1OVL B;  4S15 A;  4Q0A C;  5ICK A;  1T7M A;  2J7X A;  2Q7K A;  5AYG A;  1Y0X X;  2POB A;  3OLF A;  1RJK A;  2AMB A;  3AN3 A;  2AA7 A;  3A2H A;  2P4Y A;  4RMD A;  4WHG A;  3CS8 A;  3ZR7 A;  1G50 A;  3AZ2 A;  2P7A A;  3D6D A;  4G1D A;  2R6Y A;  3V9T A;  2ZNO A;  3T03 A;  3OOF A;  3OZJ A;  3V4A A;  4B7W A;  3FAL B;  3HO0 A;  2JFA B;  4TUZ B;  1K4W A;  1P93 A;  3RY9 A;  4MG9 A;  1XZX X;  3MNE A;  4PXM A;  2VV4 A;  2YHD A;  3A3Z X;  4O8F A;  5LGA A;  4E4Q A;  3N00 A;  1KV6 A;  3FC6 B;  2AXA A;  2AX8 A;  3NSQ A;  1U3S A;  3RLL A;  3RLJ A;  1S0X A;  1SR7 A;  2QZO A;  3B66 A;  3DT3 A;  5KD9 A;  5DP0 A;  3VJI A;  3KBA A;  3IPQ A;  4MGA A;  2I4P A;  3B65 A;  4LBD A;  4IA7 A;  3VRU A;  5DXE A;  1PQ9 A;  3W0J A;  1YIM A;  4XAO A;  5AAV B;  5KCC A;  1NYX A;  2ZXZ A;  1UOM A;  2HCD A;  5DUH A;  3WWR A;  2JJ3 A;  3IPS A;  4K4J A;  4NY9 A;  4RFW A;  4IQR A;  4IU7 A;  1T7F A;  3BC5 A;  3HLV A;  3D24 A;  3TY0 A;  2PIU A;  1DKF B;  2QTU A;  3OS8 C;  5DWI A;  1DB1 A;  5FQR A;  3KDU A;  5APH A;  4PP5 A;  3VRW A;  1XQ3 A;  1XQC A;  4CI5 A;  4OKT A;  1NUO A;  2J14 A;  2PIW A;  3B5R A;  3GWX A;  4ITE A;  3KPZ A;  5KRA A;  3SZ1 A;  3VT5 A;  2NW4 A;  4KZM A;  1YA3 A;  4FHH A;  5AK2 A;  5E7V A;  3X36 A;  2ZK4 A;  1U9E A;  3G8O A;  1OVL A;  4MG7 B;  2OVH A;  4JAZ A;  4OGH A;  2ZLA A;  1PQ6 A;  5HYR A;  3JZC A;  2QA8 B;  5AVL A;  4G1Y A;  1PQC A;  1FBY A;  3E7C A;  5FQP A;  1GWQ A;  4QJR A;  2J4A A;  5EIT A;  4XLD A;  4BCR A;  2Q3Y A;  3ZRB A;  5FQV A;  3VJH A;  4RZE A;  2FSZ A;  4OED A;  5EI1 A;  2JFA A;  3X31 A;  4TUZ A;  2F4B A;  1HJ1 A;  4OEZ A;  5G3J A;  2O4J A;  3OS9 A;  4RAK A;  2Z4B A;  2NXX E;  2ZLC A;  1EXA A;  3HQ5 A;  4OZT E;  2QGW A;  3FC6 A;  2ZK0 A;  4OZT U;  3ZQT A;  3CQV A;  5DX3 B;  2HAS A;  4ZN9 A;  3GYU A;  3ET0 A;  1ERE A;  1N4H A;  1XPC A;  4QK4 A;  2ZBS A;  3ADT A;  4MDD A;  5HZC A;  3CLD A;  4M8H A;  1UHL B;  2VV2 A;  3UUD A;  3E00 A;  3AUN A;  3CS4 A;  4IV4 A;  4MG8 A;  2HC4 A;  4JL4 A;  3RVF A;  3CDP A;  3OSI A;  5SYZ A;  4DMA A;  2GPV A;  5DWE A;  3V9V A;  1R1K A;  1X7J A;  2YLP A;  3DZU A;  3FUG A;  1XVP A;  2O4R A;  3DCU A;  2R40 A;  4J26 A;  3A9E A;  5KCU A;  5EJV A;  1P8D A;  5KCE A;  5IAW A;  2B1Z A;  5KCT A;  3GYT A;  4LSJ A;  2Q7J A;  3SP6 A;  3DY6 A;  5DK9 A;  5C4U A;  1Z5X E;  2PIN A;  3AUR A;  3F7D A;  2O9I A;  4OK1 A;  4J5X C;  4RME A;  3BQD A;  2G44 A;  5KRF A;  2PIO A;  3VJS A;  3OMO A;  1IE8 A;  1XLS E;  5F9B A;  5DXB B;  4YPQ A;  5EC9 A;  3VSO A;  1K7L A;  3DR1 A;  4OKW A;  3V3Q A;  5DV6 A;  3CWD A;  4PLD A;  5C4S A;  5FQT A;  4A4V A;  5HYK A;  5GID A;  2Q7L A;  2QA8 A;  4IWC A;  3W5T A;  4F9M A;  1PZL A;  3MNO A;  4RZG A;  3UUA A;  3VT9 A;  2AMA A;  3W0A A;  3AX8 A;  4TV1 B;  5DTV A;  3OZ0 A;  3VRT A;  2PIP L;  3OS8 A;  5KRH A;  3WT7 A;  2GWX A;  3FLI A;  4IA3 A;  3X1I A;  4RWV A;  1A28 A;  4RUJ A;  1XDK A;  1X7E A;  5G5W A;  5KYJ A;  2AA6 A;  1XNN A;  3PCU A; 
#chains in the Genus database with same CATH topology
 5G43 A;  2QE4 A;  2R40 D;  5APJ A;  2QH6 A;  2LBD A;  4X1F A;  2GP7 A;  5DKS A;  2YFE A;  2ZAS A;  5DX3 A;  3G0W A;  3U9Q A;  3OSA A;  3UVV B;  2AAX A;  2ACL B;  1XP9 A;  3B1M A;  4L96 A;  5AWJ A;  4RE8 A;  1KKQ A;  3DCT A;  2Q5P A;  3HM1 A;  3P89 A;  1FM9 D;  4LTW A;  3L0L A;  1QKN A;  1TFC A;  4K6I A;  3WMH A;  1YJE A;  5DU5 A;  2ABI A;  2GPU A;  3AFR A;  4FN9 A;  5DZI A;  5E14 A;  2G0G A;  5AVI A;  4WHF A;  3AZ3 A;  3S9S A;  1QKM A;  3L3X A;  2QAB A;  3HVL A;  4N5G A;  4IVW A;  3ZRA A;  3OLL A;  3OLS A;  5IXK A;  5L7G A;  1L2I A;  3H52 A;  4ZJR A;  3IXP D;  1VJB A;  3L1B A;  1ILG A;  1G5Y A;  4OHA A;  5JJM B;  2AYR A;  4RMC A;  3TX7 B;  5DL4 A;  2Q59 B;  5I4V A;  1FM6 D;  1G2N A;  1ZGY A;  2IOG A;  3GBK A;  4OJB A;  5LWP A;  4PPS A;  4REF A;  1RK3 A;  3UUC A;  4CI4 A;  2Q5S A;  5DKB A;  2B1V A;  3B68 A;  2I4J A;  5DXB A;  1FCZ A;  1UPW A;  2HWR A;  3WT6 A;  5KRK A;  1RDT D;  1X78 A;  3ADW A;  4OEY A;  2AWH A;  2I4Z A;  1G1U A;  1ZDT A;  4P6W A;  5HCV A;  4REE A;  5IZ0 A;  5DSH A;  3UU7 B;  3UP0 A;  2VV1 B;  2PRG A;  4OIU A;  5B5B A;  1PCG A;  3ADU A;  4YT1 A;  2GIU A;  5DVV A;  4WLB A;  1I7I A;  2ZK5 A;  1NQ0 A;  2QR9 A;  4RZF A;  5G44 A;  3AN4 A;  5A86 A;  4IW6 A;  3R8A A;  5L7E A;  1I7G A;  5DZH A;  3R5N A;  4OAR A;  5C4O A;  1T73 A;  2Q1H A;  1M2Z A;  4HLW A;  4XI3 A;  1XJ7 A;  2XHS A;  2XYJ A;  1S0Z A;  2ZK3 A;  3O1D A;  4J5X A;  4NB6 A;  3WT5 A;  3A40 X;  3GZ9 A;  3DZY A;  2Q7I A;  4XUM A;  4DM6 A;  5DYB A;  4MGC A;  2NV7 A;  1KNU A;  5DZ3 A;  5APK A;  2ACL A;  2PIV A;  3VTB A;  4JGV A;  2AA5 A;  3OSW A;  2J7Y A;  2POG A;  2I0J A;  3B0T A;  2OVM A;  4K7A A;  3GN8 A;  4OIL A;  3PRG A;  4ZNW A;  3MNP A;  4FHI A;  1I37 A;  4XT9 A;  3AZ1 A;  1T76 A;  2Q60 A;  3FAL A;  5C4T A;  1XB7 A;  3B67 A;  5JI0 D;  2ZFX A;  2E2R A;  4HEE X;  4G2I A;  1XP1 A;  3TKM A;  4OKB A;  1R5K A;  4IS8 A;  3VSP A;  3WJ5 A;  1I38 A;  2OZ7 A;  5G42 A;  3L0J A;  5DXP A;  2P54 A;  4RUP A;  1K74 A;  2QMV A;  2YJD A;  4MGD B;  2OM9 A;  2FVJ A;  1ZUC A;  1YMT A;  3CJW A;  3VT7 A;  5JJM A;  1ERR A;  2REW A;  2ZKC A;  5DIE A;  2Q59 A;  3B0R A;  4E2J A;  4ZNS A;  5HJP B;  5DVS A;  3AUQ A;  3FEI A;  3VRV A;  3VT8 A;  3OMQ A;  1OSH A;  3FS1 A;  5DVC A;  1RKG A;  4S0S A;  5DV8 A;  3V49 A;  5AAV A;  3W0I A;  1NAV A;  4DK8 A;  1XOW A;  5DWG A;  1MV9 A;  3OAP A;  2H77 A;  1SQN A;  3K22 A;  3FUR A;  3PLZ A;  4P6X A;  4ZNH A;  1YOW A;  2AB2 A;  2XYW A;  3A2J A;  4PRG A;  3GD2 A;  2YAT A;  2OAX A;  1H9U A;  4J5W C;  3L03 A;  4ZNT A;  1DKF A;  1X7B A;  2HVC A;  4NUF A;  3W0H A;  2HWQ A;  3VT3 A;  4OFU A;  5DYD A;  2Q6J A;  5GIE A;  2QA6 A;  3W5Q A;  1YIN A;  5E1C A;  5KRO A;  5DKE A;  4UDD A;  5FQS A;  4WPF A;  4OH5 A;  4MG5 A;  4UDB A;  4PWL A;  1Z5X U;  3F5C B;  1T65 A;  1YY4 A;  3D90 A;  1EXX A;  4ZO1 B;  1NAX A;  1ZAF A;  2H79 A;  2HBH A;  3GWS X;  4MG7 A;  4OZR E;  3ADX A;  4OZR U;  4PF3 A;  3WJ4 A;  2ZXN A;  3PBA A;  1WM0 X;  2Q5G A;  3W5R A;  2IOK A;  2P7G A;  5G45 A;  1QKT A;  4LNW A;  4MG9 B;  3Q95 B;  3NSP A;  2ZVT A;  3ERT A;  1E3K A;  4PP3 A;  1YP0 A;  1IE9 A;  5EGV A;  5DRJ A;  3E00 D;  4Q50 A;  3QT0 A;  3IA6 A;  4JYG A;  4PP6 A;  3JZB A;  2QZO B;  1X7R A;  5DKG A;  5E0X A;  3R8D A;  4FNE A;  4LNX A;  1R1K D;  5KRC A;  3DZU D;  4PPP A;  2PNU A;  1A52 A;  5KCD A;  2P1T A;  1LBD A;  4RUO X;  2GL8 A;  2ZL9 A;  3VI8 A;  2HAM A;  1T7R A;  3OGT A;  4ZN7 A;  1PK5 A;  3LBD A;  2Z4J A;  5HJP A;  3IPU A;  5DZ0 A;  4YMQ A;  1XV9 B;  2HB8 A;  2G0H A;  1NQ2 A;  4A4W A;  5ETH A;  2ZMJ A;  3A2I A;  1UHL A;  2P1V A;  3G9E A;  4PVU A;  4E4K A;  4NQA B;  5DI7 A;  4FGY A;  4G21 A;  3PEQ A;  1FCY A;  1XIU A;  3OMP A;  3R29 A;  2Q6S A;  3OMM A;  4KZJ A;  4S0T A;  2QW4 A;  1N83 A;  3H0A A;  1NRL A;  4M8E A;  3D57 A;  1RKH A;  4IUI A;  4S14 A;  5G46 A;  1FD0 A;  5KCW A;  2ZXM A;  4CSJ A;  3FXV A;  1R20 A;  2P1U A;  4QM0 A;  5DUG A;  3VJT A;  3VTD A;  5DY8 A;  1Z95 A;  2NXX A;  1Y0S A;  3ADS A;  2YLY A;  4DOR A;  4ZI1 A;  1T74 A;  2BJ4 B;  4JYI A;  2AX9 A;  2HFP A;  1X76 A;  2YLO A;  3B0Q A;  3R8I A;  4DQM A;  3R5M A;  3WTQ A;  3X1H A;  3F5C A;  1GWX A;  4J24 A;  5CJ6 A;  4YNK A;  5E0W A;  5AAU A;  1BSX A;  1T7T A;  3HC6 A;  1T63 A;  2FAI A;  2PIX A;  3E94 A;  3L3Z A;  2HB7 A;  5KRJ A;  1XP6 A;  2NPA A;  1MVC A;  2ZK2 A;  4R06 A;  1YUC A;  2V7C A;  2XYX A;  3NOA A;  3K8S A;  2XKW A;  1S19 A;  2W8Y A;  2ZK6 A;  2GPO A;  3W0G A;  5M96 A;  4XHD A;  3Q95 A;  4OIV A;  3D5F A;  2QNV A;  1T79 A;  1ZKY A;  5AZV A;  2AX6 A;  4ZNU A;  1ILH A;  3G8I A;  4J5W A;  3VTC A;  1XAP A;  1E3G A;  4NIE A;  3ET1 A;  4TV1 A;  3RUU A;  5K13 A;  3EYB A;  4IVY A;  5KRL A;  2JF9 A;  2QXS A;  3CS6 A;  5DXQ A;  1S9Q A;  3H0A D;  4N73 A;  2P7Z A;  1PRG A;  5DWL A;  3UP3 A;  5GT4 A;  1QKU A;  4N8R A;  2Q70 A;  1HG4 A;  3UUD B;  1M13 A;  1M7W A;  1R20 D;  3HZF A;  4UDA A;  5DWJ A;  4MGB B;  3CDS A;  4MG8 B;  5DID A;  5DXM A;  1NQ7 A;  1XLS A;  4OJ4 A;  5AWK A;  1L2J A;  3UVV A;  4Y29 A;  2IHQ A;  1LV2 A;  2AA2 A;  2OUZ A;  3KYT A;  1XV9 A;  5E15 A;  1XVP B;  3M7R A;  5DXK A;  3OKH A;  3ADV A;  3KMZ A;  2B50 A;  3A9E B;  1Y9R A;  5KYA A;  3ERD A;  4G20 A;  5KCF A;  2OCF A;  4IA2 A;  3K6P A;  3VT4 A;  1XNX A;  2P15 A;  3O1E A;  2GPP A;  1U3R A;  1OSV A;  1T5Z A;  4WQP A;  3W0Y A;  4G2H A;  4ZJW A;  3KMR A;  1U3Q A;  1UPV A;  2B23 A;  3CTB A;  2ZMI A;  5DZ1 A;  3WGP A;  3HC5 A;  4XUH A;  4L98 A;  2BJ4 A;  3P0U A;  2QXM A;  4QE6 A;  1GS4 A;  4UDC A;  2EWP A;  2PIQ A;  2QSE A;  3ET3 A;  3W5P A;  2Q1V A;  3KMG A;  3W0C A;  4EM9 A;  3FEJ A;  2R6W A;  3UUA B;  4APU A;  2AX7 A;  1YOK A;  3KDT A;  1GWR A;  2YLQ A;  4ZOM A;  2Q61 A;  3DZY D;  1NQ1 A;  2ZNP A;  4PLE A;  4IA1 A;  5E19 A;  5DMC A;  3UU7 A;  2ATH A;  5DLR A;  4DK7 A;  1FCX A;  2VV1 A;  3OOK A;  1XDK B;  3LMP A;  4OKX A;  5EHJ A;  3SP9 A;  1OT7 A;  4DM8 A;  5DRM A;  4QL8 A;  3K23 A;  4EMA A;  2PKL A;  5B41 A;  4OFR A;  1ZEO A;  2AM9 A;  4MG6 A;  2VV3 A;  2A3I A;  1S9P A;  2AO6 A;  2I0G A;  5AZT A;  3WFG A;  3R2A A;  4IV2 A;  2VST A;  3A78 A;  3RUT A;  3KFC A;  4ZO1 X;  4IW8 A;  4POJ A;  1NDE A;  1R6G A;  2ZY0 A;  5KRM A;  4ONI A;  2GTK A;  2YJA B;  2ZNN A;  4MGB A;  5DIG A;  3B3K A;  2BAW A;  1SJ0 A;  4POH A;  4X1G A;  1K74 D;  3VN2 A;  5JY3 A;  5KR9 A;  3OKI A;  1YYE A;  4G1Z A;  5GIC A;  1PDU A;  2VV0 A;  2Q6R A;  3ILZ A;  3L0E A;  4OH6 A;  3P8X A;  1SKX A;  4R6S A;  5DUE A;  4ITF A;  2HAR A;  3WFF A;  4DOS A;  3IMY A;  3TKC A;  2VV4 B;  5DXR A;  5L11 A;  3PO9 A;  2V0V A;  5KRI A;  2ZNQ A;  4R2U A;  4OEA A;  3VHW A;  3VHU A;  1FM9 A;  1NHZ A;  4KZI A;  2G5O A;  3HOD A;  4JYH A;  1ZH7 A;  4MGD A;  4MGA B;  3V9Y A;  4OJ9 A;  2QPY A;  4ZNV A;  1N46 A;  5L7H A;  3VHV A;  4IWF A;  2VSR A;  4OLM A;  1MZN A;  5H1E A;  1ZDU A;  2Q8S A;  3IXP A;  4Q13 A;  5ACC A;  5DXG A;  3OMK A;  3P88 A;  4WVD A;  1FM6 A;  3V3E A;  1TXI A;  4QE8 A;  3B0W A;  3VT6 A;  2ZMH A;  2PIR A;  1Q4X A;  3ET2 A;  4XTA A;  4OC7 A;  4N1Y A;  3KWY A;  2PIT A;  5DMF A;  5DV3 A;  5HJS A;  4A2J A;  1RDT A;  2PJL A;  3BEJ A;  2ZK1 A;  2QGT A;  1OVL B;  4S15 A;  4Q0A C;  5ICK A;  1T7M A;  2J7X A;  2Q7K A;  5AYG A;  1Y0X X;  2POB A;  3OLF A;  1RJK A;  2AMB A;  3AN3 A;  2AA7 A;  3A2H A;  2P4Y A;  4RMD A;  4WHG A;  3CS8 A;  3ZR7 A;  1G50 A;  3AZ2 A;  2P7A A;  3D6D A;  4G1D A;  2R6Y A;  3V9T A;  2ZNO A;  3T03 A;  3OOF A;  3OZJ A;  3V4A A;  4B7W A;  3FAL B;  3HO0 A;  2JFA B;  4TUZ B;  1K4W A;  1P93 A;  3RY9 A;  4MG9 A;  1XZX X;  3MNE A;  4PXM A;  2VV4 A;  2YHD A;  3A3Z X;  4O8F A;  5LGA A;  4E4Q A;  3N00 A;  1KV6 A;  3FC6 B;  2AXA A;  2AX8 A;  3NSQ A;  1U3S A;  3RLL A;  3RLJ A;  1S0X A;  1SR7 A;  2QZO A;  3B66 A;  3DT3 A;  5KD9 A;  5DP0 A;  3VJI A;  3KBA A;  3IPQ A;  4MGA A;  2I4P A;  3B65 A;  4LBD A;  4IA7 A;  3VRU A;  5DXE A;  1PQ9 A;  3W0J A;  1YIM A;  4XAO A;  5AAV B;  5KCC A;  1NYX A;  2ZXZ A;  1UOM A;  2HCD A;  5DUH A;  3WWR A;  2JJ3 A;  3IPS A;  4K4J A;  4NY9 A;  4RFW A;  4IQR A;  4IU7 A;  1T7F A;  3BC5 A;  3HLV A;  3D24 A;  3TY0 A;  2PIU A;  1DKF B;  2QTU A;  3OS8 C;  5DWI A;  1DB1 A;  5FQR A;  3KDU A;  5APH A;  4PP5 A;  3VRW A;  1XQ3 A;  1XQC A;  4CI5 A;  4OKT A;  1NUO A;  2J14 A;  2PIW A;  3B5R A;  3GWX A;  4ITE A;  3KPZ A;  5KRA A;  3SZ1 A;  3VT5 A;  2NW4 A;  4KZM A;  1YA3 A;  4FHH A;  5AK2 A;  5E7V A;  3X36 A;  2ZK4 A;  1U9E A;  3G8O A;  1OVL A;  4MG7 B;  2OVH A;  4JAZ A;  4OGH A;  2ZLA A;  1PQ6 A;  5HYR A;  3JZC A;  2QA8 B;  5AVL A;  4G1Y A;  1PQC A;  1FBY A;  3E7C A;  5FQP A;  1GWQ A;  4QJR A;  2J4A A;  5EIT A;  4XLD A;  4BCR A;  2Q3Y A;  3ZRB A;  5FQV A;  3VJH A;  4RZE A;  2FSZ A;  4OED A;  5EI1 A;  2JFA A;  3X31 A;  4TUZ A;  2F4B A;  1HJ1 A;  4OEZ A;  5G3J A;  2O4J A;  3OS9 A;  4RAK A;  2Z4B A;  2NXX E;  2ZLC A;  1EXA A;  3HQ5 A;  4OZT E;  2QGW A;  3FC6 A;  2ZK0 A;  4OZT U;  3ZQT A;  3CQV A;  5DX3 B;  2HAS A;  4ZN9 A;  3GYU A;  3ET0 A;  1ERE A;  1N4H A;  1XPC A;  4QK4 A;  2ZBS A;  3ADT A;  4MDD A;  5HZC A;  3CLD A;  4M8H A;  1UHL B;  2VV2 A;  3UUD A;  3E00 A;  3AUN A;  3CS4 A;  4IV4 A;  4MG8 A;  2HC4 A;  4JL4 A;  3RVF A;  3CDP A;  3OSI A;  5SYZ A;  4DMA A;  2GPV A;  5DWE A;  3V9V A;  1R1K A;  1X7J A;  2YLP A;  3DZU A;  3FUG A;  1XVP A;  2O4R A;  3DCU A;  2R40 A;  4J26 A;  3A9E A;  5KCU A;  5EJV A;  1P8D A;  5KCE A;  5IAW A;  2B1Z A;  5KCT A;  3GYT A;  4LSJ A;  2Q7J A;  3SP6 A;  3DY6 A;  5DK9 A;  5C4U A;  1Z5X E;  2PIN A;  3AUR A;  3F7D A;  2O9I A;  4OK1 A;  4J5X C;  4RME A;  3BQD A;  2G44 A;  5KRF A;  2PIO A;  3VJS A;  3OMO A;  1IE8 A;  1XLS E;  5F9B A;  5DXB B;  4YPQ A;  5EC9 A;  3VSO A;  1K7L A;  3DR1 A;  4OKW A;  3V3Q A;  5DV6 A;  3CWD A;  4PLD A;  5C4S A;  5FQT A;  4A4V A;  5HYK A;  5GID A;  2Q7L A;  2QA8 A;  4IWC A;  3W5T A;  4F9M A;  1PZL A;  3MNO A;  4RZG A;  3UUA A;  3VT9 A;  2AMA A;  3W0A A;  3AX8 A;  4TV1 B;  5DTV A;  3OZ0 A;  3VRT A;  2PIP L;  3OS8 A;  5KRH A;  3WT7 A;  2GWX A;  3FLI A;  4IA3 A;  3X1I A;  4RWV A;  1A28 A;  4RUJ A;  1XDK A;  1X7E A;  5G5W A;  5KYJ A;  2AA6 A;  1XNN A;  3PCU A; 
#chains in the Genus database with same CATH homology
 5G43 A;  2QE4 A;  2R40 D;  5APJ A;  2QH6 A;  2LBD A;  4X1F A;  2GP7 A;  5DKS A;  2YFE A;  2ZAS A;  5DX3 A;  3G0W A;  3U9Q A;  3OSA A;  3UVV B;  2AAX A;  2ACL B;  1XP9 A;  3B1M A;  4L96 A;  5AWJ A;  4RE8 A;  1KKQ A;  3DCT A;  2Q5P A;  3HM1 A;  3P89 A;  1FM9 D;  4LTW A;  3L0L A;  1QKN A;  1TFC A;  4K6I A;  3WMH A;  1YJE A;  5DU5 A;  2ABI A;  2GPU A;  3AFR A;  4FN9 A;  5DZI A;  5E14 A;  2G0G A;  5AVI A;  4WHF A;  3AZ3 A;  3S9S A;  1QKM A;  3L3X A;  2QAB A;  3HVL A;  4N5G A;  4IVW A;  3ZRA A;  3OLL A;  3OLS A;  5IXK A;  5L7G A;  1L2I A;  3H52 A;  4ZJR A;  3IXP D;  1VJB A;  3L1B A;  1ILG A;  1G5Y A;  4OHA A;  5JJM B;  2AYR A;  4RMC A;  3TX7 B;  5DL4 A;  2Q59 B;  5I4V A;  1FM6 D;  1G2N A;  1ZGY A;  2IOG A;  3GBK A;  4OJB A;  5LWP A;  4PPS A;  4REF A;  1RK3 A;  3UUC A;  4CI4 A;  2Q5S A;  5DKB A;  2B1V A;  3B68 A;  2I4J A;  5DXB A;  1FCZ A;  1UPW A;  2HWR A;  3WT6 A;  5KRK A;  1RDT D;  1X78 A;  3ADW A;  4OEY A;  2AWH A;  2I4Z A;  1G1U A;  1ZDT A;  4P6W A;  5HCV A;  4REE A;  5IZ0 A;  5DSH A;  3UU7 B;  3UP0 A;  2VV1 B;  2PRG A;  4OIU A;  5B5B A;  1PCG A;  3ADU A;  4YT1 A;  2GIU A;  5DVV A;  4WLB A;  1I7I A;  2ZK5 A;  1NQ0 A;  2QR9 A;  4RZF A;  5G44 A;  3AN4 A;  5A86 A;  4IW6 A;  3R8A A;  5L7E A;  1I7G A;  5DZH A;  3R5N A;  4OAR A;  5C4O A;  1T73 A;  2Q1H A;  1M2Z A;  4HLW A;  4XI3 A;  1XJ7 A;  2XHS A;  2XYJ A;  1S0Z A;  2ZK3 A;  3O1D A;  4J5X A;  4NB6 A;  3WT5 A;  3A40 X;  3GZ9 A;  3DZY A;  2Q7I A;  4XUM A;  4DM6 A;  5DYB A;  4MGC A;  2NV7 A;  1KNU A;  5DZ3 A;  5APK A;  2ACL A;  2PIV A;  3VTB A;  4JGV A;  2AA5 A;  3OSW A;  2J7Y A;  2POG A;  2I0J A;  3B0T A;  2OVM A;  4K7A A;  3GN8 A;  4OIL A;  3PRG A;  4ZNW A;  3MNP A;  4FHI A;  1I37 A;  4XT9 A;  3AZ1 A;  1T76 A;  2Q60 A;  3FAL A;  5C4T A;  1XB7 A;  3B67 A;  5JI0 D;  2ZFX A;  2E2R A;  4HEE X;  4G2I A;  1XP1 A;  3TKM A;  4OKB A;  1R5K A;  4IS8 A;  3VSP A;  3WJ5 A;  1I38 A;  2OZ7 A;  5G42 A;  3L0J A;  5DXP A;  2P54 A;  4RUP A;  1K74 A;  2QMV A;  2YJD A;  4MGD B;  2OM9 A;  2FVJ A;  1ZUC A;  1YMT A;  3CJW A;  3VT7 A;  5JJM A;  1ERR A;  2REW A;  2ZKC A;  5DIE A;  2Q59 A;  3B0R A;  4E2J A;  4ZNS A;  5HJP B;  5DVS A;  3AUQ A;  3FEI A;  3VRV A;  3VT8 A;  3OMQ A;  1OSH A;  3FS1 A;  5DVC A;  1RKG A;  4S0S A;  5DV8 A;  3V49 A;  5AAV A;  3W0I A;  1NAV A;  4DK8 A;  1XOW A;  5DWG A;  1MV9 A;  3OAP A;  2H77 A;  1SQN A;  3K22 A;  3FUR A;  3PLZ A;  4P6X A;  4ZNH A;  1YOW A;  2AB2 A;  2XYW A;  3A2J A;  4PRG A;  3GD2 A;  2YAT A;  2OAX A;  1H9U A;  4J5W C;  3L03 A;  4ZNT A;  1DKF A;  1X7B A;  2HVC A;  4NUF A;  3W0H A;  2HWQ A;  3VT3 A;  4OFU A;  5DYD A;  2Q6J A;  5GIE A;  2QA6 A;  3W5Q A;  1YIN A;  5E1C A;  5KRO A;  5DKE A;  4UDD A;  5FQS A;  4WPF A;  4OH5 A;  4MG5 A;  4UDB A;  4PWL A;  1Z5X U;  3F5C B;  1T65 A;  1YY4 A;  3D90 A;  1EXX A;  4ZO1 B;  1NAX A;  1ZAF A;  2H79 A;  2HBH A;  3GWS X;  4MG7 A;  4OZR E;  3ADX A;  4OZR U;  4PF3 A;  3WJ4 A;  2ZXN A;  3PBA A;  1WM0 X;  2Q5G A;  3W5R A;  2IOK A;  2P7G A;  5G45 A;  1QKT A;  4LNW A;  4MG9 B;  3Q95 B;  3NSP A;  2ZVT A;  3ERT A;  1E3K A;  4PP3 A;  1YP0 A;  1IE9 A;  5EGV A;  5DRJ A;  3E00 D;  4Q50 A;  3QT0 A;  3IA6 A;  4JYG A;  4PP6 A;  3JZB A;  2QZO B;  1X7R A;  5DKG A;  5E0X A;  3R8D A;  4FNE A;  4LNX A;  1R1K D;  5KRC A;  3DZU D;  4PPP A;  2PNU A;  1A52 A;  5KCD A;  2P1T A;  1LBD A;  4RUO X;  2GL8 A;  2ZL9 A;  3VI8 A;  2HAM A;  1T7R A;  3OGT A;  4ZN7 A;  1PK5 A;  3LBD A;  2Z4J A;  5HJP A;  3IPU A;  5DZ0 A;  4YMQ A;  1XV9 B;  2HB8 A;  2G0H A;  1NQ2 A;  4A4W A;  5ETH A;  2ZMJ A;  3A2I A;  1UHL A;  2P1V A;  3G9E A;  4PVU A;  4E4K A;  4NQA B;  5DI7 A;  4FGY A;  4G21 A;  3PEQ A;  1FCY A;  1XIU A;  3OMP A;  3R29 A;  2Q6S A;  3OMM A;  4KZJ A;  4S0T A;  2QW4 A;  1N83 A;  3H0A A;  1NRL A;  4M8E A;  3D57 A;  1RKH A;  4IUI A;  4S14 A;  5G46 A;  1FD0 A;  5KCW A;  2ZXM A;  4CSJ A;  3FXV A;  1R20 A;  2P1U A;  4QM0 A;  5DUG A;  3VJT A;  3VTD A;  5DY8 A;  1Z95 A;  2NXX A;  1Y0S A;  3ADS A;  2YLY A;  4DOR A;  4ZI1 A;  1T74 A;  2BJ4 B;  4JYI A;  2AX9 A;  2HFP A;  1X76 A;  2YLO A;  3B0Q A;  3R8I A;  4DQM A;  3R5M A;  3WTQ A;  3X1H A;  3F5C A;  1GWX A;  4J24 A;  5CJ6 A;  4YNK A;  5E0W A;  5AAU A;  1BSX A;  1T7T A;  3HC6 A;  1T63 A;  2FAI A;  2PIX A;  3E94 A;  3L3Z A;  2HB7 A;  5KRJ A;  1XP6 A;  2NPA A;  1MVC A;  2ZK2 A;  4R06 A;  1YUC A;  2V7C A;  2XYX A;  3NOA A;  3K8S A;  2XKW A;  1S19 A;  2W8Y A;  2ZK6 A;  2GPO A;  3W0G A;  5M96 A;  4XHD A;  3Q95 A;  4OIV A;  3D5F A;  2QNV A;  1T79 A;  1ZKY A;  5AZV A;  2AX6 A;  4ZNU A;  1ILH A;  3G8I A;  4J5W A;  3VTC A;  1XAP A;  1E3G A;  4NIE A;  3ET1 A;  4TV1 A;  3RUU A;  5K13 A;  3EYB A;  4IVY A;  5KRL A;  2JF9 A;  2QXS A;  3CS6 A;  5DXQ A;  1S9Q A;  3H0A D;  4N73 A;  2P7Z A;  1PRG A;  5DWL A;  3UP3 A;  5GT4 A;  1QKU A;  4N8R A;  2Q70 A;  1HG4 A;  3UUD B;  1M13 A;  1M7W A;  1R20 D;  3HZF A;  4UDA A;  5DWJ A;  4MGB B;  3CDS A;  4MG8 B;  5DID A;  5DXM A;  1NQ7 A;  1XLS A;  4OJ4 A;  5AWK A;  1L2J A;  3UVV A;  4Y29 A;  2IHQ A;  1LV2 A;  2AA2 A;  2OUZ A;  3KYT A;  1XV9 A;  5E15 A;  1XVP B;  3M7R A;  5DXK A;  3OKH A;  3ADV A;  3KMZ A;  2B50 A;  3A9E B;  1Y9R A;  5KYA A;  3ERD A;  4G20 A;  5KCF A;  2OCF A;  4IA2 A;  3K6P A;  3VT4 A;  1XNX A;  2P15 A;  3O1E A;  2GPP A;  1U3R A;  1OSV A;  1T5Z A;  4WQP A;  3W0Y A;  4G2H A;  4ZJW A;  3KMR A;  1U3Q A;  1UPV A;  2B23 A;  3CTB A;  2ZMI A;  5DZ1 A;  3WGP A;  3HC5 A;  4XUH A;  4L98 A;  2BJ4 A;  3P0U A;  2QXM A;  4QE6 A;  1GS4 A;  4UDC A;  2EWP A;  2PIQ A;  2QSE A;  3ET3 A;  3W5P A;  2Q1V A;  3KMG A;  3W0C A;  4EM9 A;  3FEJ A;  2R6W A;  3UUA B;  4APU A;  2AX7 A;  1YOK A;  3KDT A;  1GWR A;  2YLQ A;  4ZOM A;  2Q61 A;  3DZY D;  1NQ1 A;  2ZNP A;  4PLE A;  4IA1 A;  5E19 A;  5DMC A;  3UU7 A;  2ATH A;  5DLR A;  4DK7 A;  1FCX A;  2VV1 A;  3OOK A;  1XDK B;  3LMP A;  4OKX A;  5EHJ A;  3SP9 A;  1OT7 A;  4DM8 A;  5DRM A;  4QL8 A;  3K23 A;  4EMA A;  2PKL A;  5B41 A;  4OFR A;  1ZEO A;  2AM9 A;  4MG6 A;  2VV3 A;  2A3I A;  1S9P A;  2AO6 A;  2I0G A;  5AZT A;  3WFG A;  3R2A A;  4IV2 A;  2VST A;  3A78 A;  3RUT A;  3KFC A;  4ZO1 X;  4IW8 A;  4POJ A;  1NDE A;  1R6G A;  2ZY0 A;  5KRM A;  4ONI A;  2GTK A;  2YJA B;  2ZNN A;  4MGB A;  5DIG A;  3B3K A;  2BAW A;  1SJ0 A;  4POH A;  4X1G A;  1K74 D;  3VN2 A;  5JY3 A;  5KR9 A;  3OKI A;  1YYE A;  4G1Z A;  5GIC A;  1PDU A;  2VV0 A;  2Q6R A;  3ILZ A;  3L0E A;  4OH6 A;  3P8X A;  1SKX A;  4R6S A;  5DUE A;  4ITF A;  2HAR A;  3WFF A;  4DOS A;  3IMY A;  3TKC A;  2VV4 B;  5DXR A;  5L11 A;  3PO9 A;  2V0V A;  5KRI A;  2ZNQ A;  4R2U A;  4OEA A;  3VHW A;  3VHU A;  1FM9 A;  1NHZ A;  4KZI A;  2G5O A;  3HOD A;  4JYH A;  1ZH7 A;  4MGD A;  4MGA B;  3V9Y A;  4OJ9 A;  2QPY A;  4ZNV A;  1N46 A;  5L7H A;  3VHV A;  4IWF A;  2VSR A;  4OLM A;  1MZN A;  5H1E A;  1ZDU A;  2Q8S A;  3IXP A;  4Q13 A;  5ACC A;  5DXG A;  3OMK A;  3P88 A;  4WVD A;  1FM6 A;  3V3E A;  1TXI A;  4QE8 A;  3B0W A;  3VT6 A;  2ZMH A;  2PIR A;  1Q4X A;  3ET2 A;  4XTA A;  4OC7 A;  4N1Y A;  3KWY A;  2PIT A;  5DMF A;  5DV3 A;  5HJS A;  4A2J A;  1RDT A;  2PJL A;  3BEJ A;  2ZK1 A;  2QGT A;  1OVL B;  4S15 A;  4Q0A C;  5ICK A;  1T7M A;  2J7X A;  2Q7K A;  5AYG A;  1Y0X X;  2POB A;  3OLF A;  1RJK A;  2AMB A;  3AN3 A;  2AA7 A;  3A2H A;  2P4Y A;  4RMD A;  4WHG A;  3CS8 A;  3ZR7 A;  1G50 A;  3AZ2 A;  2P7A A;  3D6D A;  4G1D A;  2R6Y A;  3V9T A;  2ZNO A;  3T03 A;  3OOF A;  3OZJ A;  3V4A A;  4B7W A;  3FAL B;  3HO0 A;  2JFA B;  4TUZ B;  1K4W A;  1P93 A;  3RY9 A;  4MG9 A;  1XZX X;  3MNE A;  4PXM A;  2VV4 A;  2YHD A;  3A3Z X;  4O8F A;  5LGA A;  4E4Q A;  3N00 A;  1KV6 A;  3FC6 B;  2AXA A;  2AX8 A;  3NSQ A;  1U3S A;  3RLL A;  3RLJ A;  1S0X A;  1SR7 A;  2QZO A;  3B66 A;  3DT3 A;  5KD9 A;  5DP0 A;  3VJI A;  3KBA A;  3IPQ A;  4MGA A;  2I4P A;  3B65 A;  4LBD A;  4IA7 A;  3VRU A;  5DXE A;  1PQ9 A;  3W0J A;  1YIM A;  4XAO A;  5AAV B;  5KCC A;  1NYX A;  2ZXZ A;  1UOM A;  2HCD A;  5DUH A;  3WWR A;  2JJ3 A;  3IPS A;  4K4J A;  4NY9 A;  4RFW A;  4IQR A;  4IU7 A;  1T7F A;  3BC5 A;  3HLV A;  3D24 A;  3TY0 A;  2PIU A;  1DKF B;  2QTU A;  3OS8 C;  5DWI A;  1DB1 A;  5FQR A;  3KDU A;  5APH A;  4PP5 A;  3VRW A;  1XQ3 A;  1XQC A;  4CI5 A;  4OKT A;  1NUO A;  2J14 A;  2PIW A;  3B5R A;  3GWX A;  4ITE A;  3KPZ A;  5KRA A;  3SZ1 A;  3VT5 A;  2NW4 A;  4KZM A;  1YA3 A;  4FHH A;  5AK2 A;  5E7V A;  3X36 A;  2ZK4 A;  1U9E A;  3G8O A;  1OVL A;  4MG7 B;  2OVH A;  4JAZ A;  4OGH A;  2ZLA A;  1PQ6 A;  5HYR A;  3JZC A;  2QA8 B;  5AVL A;  4G1Y A;  1PQC A;  1FBY A;  3E7C A;  5FQP A;  1GWQ A;  4QJR A;  2J4A A;  5EIT A;  4XLD A;  4BCR A;  2Q3Y A;  3ZRB A;  5FQV A;  3VJH A;  4RZE A;  2FSZ A;  4OED A;  5EI1 A;  2JFA A;  3X31 A;  4TUZ A;  2F4B A;  1HJ1 A;  4OEZ A;  5G3J A;  2O4J A;  3OS9 A;  4RAK A;  2Z4B A;  2NXX E;  2ZLC A;  1EXA A;  3HQ5 A;  4OZT E;  2QGW A;  3FC6 A;  2ZK0 A;  4OZT U;  3ZQT A;  3CQV A;  5DX3 B;  2HAS A;  4ZN9 A;  3GYU A;  3ET0 A;  1ERE A;  1N4H A;  1XPC A;  4QK4 A;  2ZBS A;  3ADT A;  4MDD A;  5HZC A;  3CLD A;  4M8H A;  1UHL B;  2VV2 A;  3UUD A;  3E00 A;  3AUN A;  3CS4 A;  4IV4 A;  4MG8 A;  2HC4 A;  4JL4 A;  3RVF A;  3CDP A;  3OSI A;  5SYZ A;  4DMA A;  2GPV A;  5DWE A;  3V9V A;  1R1K A;  1X7J A;  2YLP A;  3DZU A;  3FUG A;  1XVP A;  2O4R A;  3DCU A;  2R40 A;  4J26 A;  3A9E A;  5KCU A;  5EJV A;  1P8D A;  5KCE A;  5IAW A;  2B1Z A;  5KCT A;  3GYT A;  4LSJ A;  2Q7J A;  3SP6 A;  3DY6 A;  5DK9 A;  5C4U A;  1Z5X E;  2PIN A;  3AUR A;  3F7D A;  2O9I A;  4OK1 A;  4J5X C;  4RME A;  3BQD A;  2G44 A;  5KRF A;  2PIO A;  3VJS A;  3OMO A;  1IE8 A;  1XLS E;  5F9B A;  5DXB B;  4YPQ A;  5EC9 A;  3VSO A;  1K7L A;  3DR1 A;  4OKW A;  3V3Q A;  5DV6 A;  3CWD A;  4PLD A;  5C4S A;  5FQT A;  4A4V A;  5HYK A;  5GID A;  2Q7L A;  2QA8 A;  4IWC A;  3W5T A;  4F9M A;  1PZL A;  3MNO A;  4RZG A;  3UUA A;  3VT9 A;  2AMA A;  3W0A A;  3AX8 A;  4TV1 B;  5DTV A;  3OZ0 A;  3VRT A;  2PIP L;  3OS8 A;  5KRH A;  3WT7 A;  2GWX A;  3FLI A;  4IA3 A;  3X1I A;  4RWV A;  1A28 A;  4RUJ A;  1XDK A;  1X7E A;  5G5W A;  5KYJ A;  2AA6 A;  1XNN A;  3PCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...