1P93A

Crystal structure of the agonist form of glucocorticoid receptor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
250
structure length
247
Chain Sequence
QLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMSLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPDMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKRSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Three-dimensional Structures of Antagonistic and Agonistic Forms of the Glucocorticoid Receptor Ligand-binding Domain: RU-486 INDUCES A TRANSCONFORMATION THAT LEADS TO ACTIVE ANTAGONISM.
pubmed doi rcsb
molecule keywords Glucocorticoid receptor
molecule tags Hormone receptor
source organism Homo sapiens
total genus 85
structure length 247
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 1p93A00
3OLLA 4ZNUA 3TY0A 2I4JA 1Y0SA 2YJDA 5ACCA 2QGWA 3UU7A 5KRIA 4MG6A 4MG8A 4OKXA 4E4QA 1T7MA 2OM9A 3G8OA 5HJPB 1UHLB 5APJA 3AUNA 5KRHA 1ZGYA 2ZK3A 1XVPA 1M13A 1XP1A 3P0UA 3X1HA 4DK8A 4O8FA 5C4OA 1GS4A 1T5ZA 3HC6A 2R6YA 4OEYA 4WPFA 4KZJA 4FN9A 3D90A 5LGAA 1QKMA 4XT9A 1SKXA 5IZ0A 3UP3A 2LBDA 3KMZA 3RUUA 3VT3A 1QKTA 2XYXA 4OEDA 4UDBA 2FVJA 4OH5A 3L0LA 3OOKA 5L11A 4REEA 5G3JA 1ZH7A 3RLJA 1R20D 2J14A 5AZVA 2ZL9A 4MG9B 4E2JA 2E2RA 2VV3A 3ERDA 2HC4A 2Q7KA 5APHA 3VRVA 3W5TA 2ZFXA 3HC5A 4QM0A 3ADXA 1P93A 4XUMA 1G5YA 4MG7A 3IXPD 5DSHA 2PINA 2GWXA 3DCUA 1OSHA 3B0TA 4QK4A 4OFUA 5DX3A 1X76A 2PJLA 3WT5A 2HAMA 3IPSA 4PP3A 1FM6A 1FM9A 1M2ZA 3VJTA 3OLSA 4B7WA 2AXAA 2VV1B 2I0JA 3BEJA 3W0CA 4OEZA 2PNUA 1S9PA 3CDSA 5DL4A 4WHFA 4RE8A 2XKWA 1UPVA 1NHZA 3V9YA 4E4KA 4RZFA 5DV8A 2P15A 5KCUA 1XZXX 3OKIA 1LBDA 4OC7A 1R1KD 5AAVB 5E7VA 4IS8A 1P8DA 5HJPA 1RKGA 3ET0A 5GT4A 1UHLA 3SP9A 1G2NA 2R40D 5DY8A 3H0AA 4EM9A 3AURA 4JGVA 3OMQA 1RKHA 5KCEA 1YMTA 2YATA 4K4JA 3B0WA 3ZRAA 1H9UA 1EXXA 2ZBSA 2VSRA 1R5KA 3F5CB 4NUFA 1T7TA 4OIUA 4S0SA 3OZ0A 5G42A 2AA7A 3V9VA 2GIUA 2ACLB 3B3KA 3OGTA 4MG9A 1PQCA 3W5PA 4G20A 2Q7LA 2QMVA 4APUA 2Q59B 1A28A 2PIRA 3OS9A 4MGDB 2FAIA 3TKCA 3PEQA 5HCVA 3AN3A 3HO0A 4P6WA 1N83A 1ZDUA 4J5WC 4IUIA 3GBKA 5KRJA 2ZASA 3AN4A 2PIPL 1DKFB 2Q1VA 1NUOA 4A2JA 1XP6A 3SP6A 1PQ9A 4OFRA 4XHDA 3VT5A 4J24A 2VV1A 4JL4A 4ZNWA 3VJHA 5E0WA 5L7EA 5KCDA 1YIMA 1SJ0A 5DUEA 3BC5A 3DCTA 4OJ9A 3MNEA 3U9QA 2P7ZA 2QGTA 4OZTU 2QSEA 3LMPA 3NSQA 3HLVA 5DXPA 1SQNA 4K7AA 3RUTA 3VTDA 4UDCA 4ZN9A 3ZQTA 5AAVA 4G1YA 4ZI1A 3AZ1A 5HYRA 3ADVA 3P88A 5FQRA 5FQTA 4IA7A 3RLLA 2NXXE 5DYDA 2Q5SA 5DIDA 3E00A 5DZ0A 5K13A 3G9EA 4IW6A 2QNVA 2PIXA 2AA2A 3OAPA 2OVMA 4MGBB 5E15A 2ABIA 3VI8A 5DKBA 3F5CA 5DVSA 5G46A 3FLIA 5E1CA 3BQDA 2Q7JA 3W0GA 1OSVA 5E0XA 3VT7A 3R8IA 5H1EA 2PIQA 1ZEOA 4R6SA 2G44A 2ACLA 2XYWA 1K7LA 1TFCA 4LBDA 5GICA 3GD2A 5DI7A 2HWQA 3R8DA 1XNXA 1HG4A 5DVCA 2Q59A 4PRGA 5C4TA 1T76A 5KCCA 4MGDA 3T03A 4L98A 5B5BA 1Z5XE 3CJWA 4ZO1X 2GPOA 3VHWA 1S19A 3VTBA 2OCFA 3B0RA 1L2JA 4TV1B 1NQ2A 4QE8A 3HM1A 3VSPA 1XLSA 5DXGA 3KFCA 1DKFA 2ZMIA 4IA1A 2QA8B 3IPUA 3ZRBA 2J7YA 3WFFA 1FCYA 1N46A 2A3IA 2NW4A 2OVHA 1YINA 4LSJA 3MNPA 2AB2A 4IV2A 3AZ3A 5DUGA 3E94A 1K74D 3GYTA 5DXRA 5LWPA 2HB7A 4QE6A 1GWRA 1T79A 3A2IA 2ZXMA 3WFGA 5AVLA 3PCUA 1T65A 4MDDA 3AUQA 2HWRA 2VV2A 3W5RA 1OT7A 2GP7A 5DWLA 5DVVA 4YNKA 3ADWA 5G43A 4ITEA 3GN8A 4N73A 4MGBA 1YYEA 1FCZA 1Z5XU 3LBDA 4X1GA 4RUOX 5AYGA 1T73A 5C4UA 4R06A 3OMMA 5EJVA 3R29A 3UP0A 4PPSA 1YP0A 5AWKA 3G8IA 2AA6A 4JAZA 5EC9A 1Y9RA 5CJ6A 3H52A 2NV7A 4ZOMA 5ICKA 4J5XA 4EMAA 1XDKB 1S9QA 5E19A 3OS8A 3X1IA 1FD0A 1NQ7A 4Q50A 1E3GA 4OKWA 4S15A 5DV6A 4G1DA 2B50A 5AVIA 4PP6A 1FM9D 2GTKA 2Q60A 4IU7A 4LNWA 3O1EA 1XV9B 4QJRA 2OAXA 4TV1A 5DMFA 3VHVA 2HB8A 1XAPA 1XQ3A 2ZNQA 4OGHA 1MZNA 5AWJA 2QR9A 3L0JA 1KNUA 1I37A 2I4PA 2QA8A 2QTUA 4OJBA 5HZCA 5KRCA 3AX8A 3K8SA 4F9MA 2ZLCA 4G1ZA 5APKA 4ZJWA 5JJMB 4IVWA 3CQVA 3PO9A 4G2HA 4HLWA 1XLSE 1PRGA 3VT6A 1XJ7A 5FQPA 1R20A 3B66A 1ILGA 1ZKYA 1E3KA 2AX8A 2ZLAA 3ADTA 3ADUA 4P6XA 4ZO1B 1N4HA 1I7IA 1YOKA 3HQ5A 3IXPA 3WMHA 3D57A 1NYXA 5DKSA 1YUCA 3CLDA 3HZFA 3WJ4A 4DMAA 3R2AA 3R5NA 4OZTE 3UUDB 4OKBA 3D6DA 1PCGA 2VV0A 3FALB 4RUJA 3V4AA 1U9EA 4J26A 5G45A 5SYZA 4IA3A 3VHUA 4S14A 5DU5A 4PLEA 4POHA 1PK5A 1XPCA 3KMRA 1XDKA 4ZNVA 5G5WA 1HJ1A 3ADSA 1UPWA 2Q5PA 4ZNTA 4IA2A 2HCDA 1R6GA 1RDTD 2VV4B 3O1DA 4XAOA 3VT4A 1DB1A 1EXAA 1G1UA 2PKLA 2OZ7A 1XV9A 2YFEA 2R40A 2QXSA 1I7GA 1ZDTA 2P54A 2PRGA 5JY3A 2QZOB 2P4YA 2G0HA 3VSOA 3AFRA 4RMCA 5JJMA 5AK2A 2V7CA 4Q0AC 3UUAB 4RMEA 4QL8A 1UOMA 4FHIA 4R2UA 4WQPA 4J5WA 4OIVA 3KPZA 3TKMA 4MGAA 4S0TA 1A52A 3IA6A 2F4BA 5E14A 3V3EA 2YHDA 1S0XA 5L7GA 2O9IA 1XIUA 1Y0XX 2AMBA 2AWHA 4KZMA 4M8HA 5DKEA 5KRAA 4YPQA 1ERRA 4DM8A 4IWFA 4JYGA 3OSWA 4N8RA 3DZUD 1FCXA 1U3QA 5DV3A 3UUDA 4MGCA 3WGPA 1SR7A 4IVYA 3VRTA 3FALA 3IPQA 5KRFA 3A40X 5KCTA 1RK3A 2ZY0A 3KDUA 5DZHA 3L3XA 5KCWA 4DQMA 4NY9A 1YJEA 3A9EB 3V3QA 4A4WA 3FEJA 3KBAA 4KZIA 4IQRA 4FNEA 3GWSX 4PF3A 2GPUA 1I38A 3R5MA 3V9TA 4PPPA 2QXMA 5IAWA 4PLDA 3CDPA 3X36A 4MG5A 4OZRU 3DZYD 3VTCA 2R6WA 1OVLB 2VV4A 2QW4A 3HODA 2IOKA 1S0ZA 5F9BA 2YLYA 2P1TA 3A2HA 5DRJA 3CTBA 4RWVA 2POGA 3P8XA 4ZJRA 3PLZA 4M8EA 2QZOA 2ATHA 3KDTA 3CS6A 1GWXA 4RMDA 5AZTA 4POJA 4REFA 1BSXA 2G0GA 4IWCA 3L3ZA 5FQSA 2P1UA 3UUAA 3WJ5A 4CI4A 2W8YA 5A86A 3OLFA 2Q6RA 3IMYA 2Q5GA 1ILHA 1X7BA 1M7WA 4OARA 5DZ3A 4DORA 4TUZA 2PIVA 3DR1A 3SZ1A 4NQAB 5DKGA 3FUGA 3GYUA 4XTAA 2ZNNA 4ITFA 3VJSA 1FBYA 1LV2A 1U3SA 2ZMHA 5ETHA 4X1FA 2OUZA 1Q4XA 2HARA 3WT7A 2O4RA 4XI3A 5C4SA 1IE9A 4RZEA 5KRLA 2ZNPA 2BAWA 5DUHA 1PDUA 4FHHA 4LTWA 4Q13A 4DK7A 2G5OA 1U3RA 3D24A 5I4VA 2QABA 5KCFA 5AAUA 5DXQA 5HJSA 1IE8A 3WT6A 2H79A 2HVCA 3A9EA 3L03A 1NDEA 4PWLA 5DP0A 3NOAA 1YY4A 3M7RA 3UUCA 4RZGA 3RY9A 1QKNA 4OKTA 1K74A 4FGYA 2EWPA 1XNNA 2XYJA 5GIEA 2NPAA 2Q8SA 1OVLA 2ZK1A 3N00A 2ZK0A 4N5GA 5FQVA 1FM6D 4A4VA 2Z4BA 3V49A 5DIEA 2ZVTA 4G21A 4J5XC 1QKUA 3ET1A 5DXKA 3B1MA 2AA5A 2ZK2A 3CS4A 3OS8C 4OEAA 4UDAA 5KRMA 2YLQA 2ZKCA 2YJAB 3P89A 3OSIA 4ZNHA 5DWJA 4CI5A 3L1BA 2Q3YA 2ZXZA 3OKHA 4RFWA 4YT1A 4WHGA 2YLOA 3KMGA 4ONIA 1PQ6A 2ZK5A 3CS8A 2ZNOA 5IXKA 1XP9A 2ZK6A 4MGAB 1MVCA 5M96A 4OHAA 1T74A 3OSAA 5DXEA 1K4WA 1KKQA 2JF9A 3PRGA 5DTVA 5KYJA 2PIWA 4HEEX 3H0AD 3X31A 2AX9A 3VRWA 3G0WA 1XQCA 3ZR7A 5JI0D 3TX7B 1Z95A 4K6IA 3FXVA 3W0JA 1ZAFA 2Q1HA 3Q95B 1ZUCA 3OMPA 3VT9A 3WWRA 5DRMA 5EGVA 4OLMA 3GWXA 2JFAB 4DOSA 3MNOA 3A78A 2QA6A 3PBAA 2AAXA 1MV9A 2B1ZA 2PITA 2NXXA 2V0VA 5KRKA 3ERTA 4OILA 1NQ0A 1YA3A 2AM9A 2AMAA 1TXIA 2I0GA 2PIOA 2PIUA 4IW8A 4OJ4A 1R1KA 2BJ4B 2ZXNA 3FURA 2YLPA 2HFPA 4UDDA 1NQ1A 3QT0A 5KYAA 5DXBB 5KD9A 1T7FA 1VJBA 1WM0X 1NRLA 2O4JA 1NAVA 2REWA 2JJ3A 3HVLA 4PP5A 5DIGA 5DWEA 5GIDA 1PZLA 5G44A 4WLBA 4PXMA 3D5FA 3JZCA 3VT8A 2Q6SA 4OZRE 4XLDA 3W0IA 3FS1A 3B5RA 2QE4A 1L2IA 4TUZB 3W0YA 3L0EA 2GL8A 3OMKA 4LNXA 3NSPA 3B0QA 1XOWA 4NB6A 3K6PA 3E00D 2P7GA 5DYBA 3F7DA 4ZN7A 3W5QA 2J4AA 1RDTA 5DLRA 3RVFA 3Q95A 3UVVB 1YOWA 3B65A 3E7CA 3A2JA 3FC6B 4L96A 2QH6A 2ZK4A 2IHQA 4ZNSA 5DMCA 3R8AA 3VRUA 2JFAA 2Q70A 2IOGA 1X7JA 3ILZA 3WTQA 5HYKA 3K22A 3S9SA 2FSZA 3GZ9A 2GPPA 4NIEA 4YMQA 4PVUA 2XHSA 4WVDA 3UU7B 4MG8B 2POBA 2Z4JA 3A3ZX 5KROA 1KV6A 3ET3A 4G2IA 3B68A 2HBHA 5DZ1A 2BJ4A 3W0HA 1XVPB 3DY6A 2I4ZA 2AX7A 1EREA 1X7RA 5DXBA 3OOFA 4JYIA 1NAXA 5EI1A 3JZBA 2GPVA 3VN2A 4BCRA 2AYRA 5KR9A 3K23A 3DZUA 5DWGA 3DT3A 2J7XA 1XB7A 5L7HA 3CWDA 3KYTA 4CSJA 3W0AA 4JYHA 2ZMJA 2B23A 1G50A 2H77A 4XUHA 2P7AA 5DZIA 2AX6A 3EYBA 2Q61A 1T63A 3FEIA 4MG7B 3OZJA 2VSTA 5EHJA 4OK1A 2AO6A 4N1YA 4OH6A 5DXMA 5DX3B 2Q7IA 3DZYA 1GWQA 1X7EA 1X78A 4RAKA 1T7RA 5EITA 3ET2A 4IV4A 3AZ2A 3VJIA 3OMOA 4DM6A 3UVVA 2HASA 4Y29A 5DWIA 5DK9A 3B67A 1RJKA 2Q6JA 2B1VA 4RUPA 3FC6A 5B41A 2QPYA 3KWYA 2P1VA
chains in the Genus database with same CATH superfamily
3OLLA 4ZNUA 3TY0A 2I4JA 1Y0SA 2YJDA 5ACCA 2QGWA 3UU7A 5KRIA 4MG6A 4MG8A 4OKXA 4E4QA 1T7MA 2OM9A 3G8OA 5HJPB 1UHLB 5APJA 3AUNA 5KRHA 1ZGYA 2ZK3A 1XVPA 1M13A 1XP1A 3P0UA 3X1HA 4DK8A 4O8FA 5C4OA 1GS4A 1T5ZA 3HC6A 2R6YA 4OEYA 4WPFA 4KZJA 4FN9A 3D90A 5LGAA 1QKMA 4XT9A 1SKXA 5IZ0A 3UP3A 2LBDA 3KMZA 3RUUA 3VT3A 1QKTA 2XYXA 4OEDA 4UDBA 2FVJA 4OH5A 3L0LA 3OOKA 5L11A 4REEA 5G3JA 1ZH7A 3RLJA 1R20D 2J14A 5AZVA 2ZL9A 4MG9B 4E2JA 2E2RA 2VV3A 3ERDA 2HC4A 2Q7KA 5APHA 3VRVA 3W5TA 2ZFXA 3HC5A 4QM0A 3ADXA 1P93A 4XUMA 1G5YA 4MG7A 3IXPD 5DSHA 2PINA 2GWXA 3DCUA 1OSHA 3B0TA 4QK4A 4OFUA 5DX3A 1X76A 2PJLA 3WT5A 2HAMA 3IPSA 4PP3A 1FM6A 1FM9A 1M2ZA 3VJTA 3OLSA 4B7WA 2AXAA 2VV1B 2I0JA 3BEJA 3W0CA 4OEZA 2PNUA 1S9PA 3CDSA 5DL4A 4WHFA 4RE8A 2XKWA 1UPVA 1NHZA 3V9YA 4E4KA 4RZFA 5DV8A 2P15A 5KCUA 1XZXX 3OKIA 1LBDA 4OC7A 1R1KD 5AAVB 5E7VA 4IS8A 1P8DA 5HJPA 1RKGA 3ET0A 5GT4A 1UHLA 3SP9A 1G2NA 2R40D 5DY8A 3H0AA 4EM9A 3AURA 4JGVA 3OMQA 1RKHA 5KCEA 1YMTA 2YATA 4K4JA 3B0WA 3ZRAA 1H9UA 1EXXA 2ZBSA 2VSRA 1R5KA 3F5CB 4NUFA 1T7TA 4OIUA 4S0SA 3OZ0A 5G42A 2AA7A 3V9VA 2GIUA 2ACLB 3B3KA 3OGTA 4MG9A 1PQCA 3W5PA 4G20A 2Q7LA 2QMVA 4APUA 2Q59B 1A28A 2PIRA 3OS9A 4MGDB 2FAIA 3TKCA 3PEQA 5HCVA 3AN3A 3HO0A 4P6WA 1N83A 1ZDUA 4J5WC 4IUIA 3GBKA 5KRJA 2ZASA 3AN4A 2PIPL 1DKFB 2Q1VA 1NUOA 4A2JA 1XP6A 3SP6A 1PQ9A 4OFRA 4XHDA 3VT5A 4J24A 2VV1A 4JL4A 4ZNWA 3VJHA 5E0WA 5L7EA 5KCDA 1YIMA 1SJ0A 5DUEA 3BC5A 3DCTA 4OJ9A 3MNEA 3U9QA 2P7ZA 2QGTA 4OZTU 2QSEA 3LMPA 3NSQA 3HLVA 5DXPA 1SQNA 4K7AA 3RUTA 3VTDA 4UDCA 4ZN9A 3ZQTA 5AAVA 4G1YA 4ZI1A 3AZ1A 5HYRA 3ADVA 3P88A 5FQRA 5FQTA 4IA7A 3RLLA 2NXXE 5DYDA 2Q5SA 5DIDA 3E00A 5DZ0A 5K13A 3G9EA 4IW6A 2QNVA 2PIXA 2AA2A 3OAPA 2OVMA 4MGBB 5E15A 2ABIA 3VI8A 5DKBA 3F5CA 5DVSA 5G46A 3FLIA 5E1CA 3BQDA 2Q7JA 3W0GA 1OSVA 5E0XA 3VT7A 3R8IA 5H1EA 2PIQA 1ZEOA 4R6SA 2G44A 2ACLA 2XYWA 1K7LA 1TFCA 4LBDA 5GICA 3GD2A 5DI7A 2HWQA 3R8DA 1XNXA 1HG4A 5DVCA 2Q59A 4PRGA 5C4TA 1T76A 5KCCA 4MGDA 3T03A 4L98A 5B5BA 1Z5XE 3CJWA 4ZO1X 2GPOA 3VHWA 1S19A 3VTBA 2OCFA 3B0RA 1L2JA 4TV1B 1NQ2A 4QE8A 3HM1A 3VSPA 1XLSA 5DXGA 3KFCA 1DKFA 2ZMIA 4IA1A 2QA8B 3IPUA 3ZRBA 2J7YA 3WFFA 1FCYA 1N46A 2A3IA 2NW4A 2OVHA 1YINA 4LSJA 3MNPA 2AB2A 4IV2A 3AZ3A 5DUGA 3E94A 1K74D 3GYTA 5DXRA 5LWPA 2HB7A 4QE6A 1GWRA 1T79A 3A2IA 2ZXMA 3WFGA 5AVLA 3PCUA 1T65A 4MDDA 3AUQA 2HWRA 2VV2A 3W5RA 1OT7A 2GP7A 5DWLA 5DVVA 4YNKA 3ADWA 5G43A 4ITEA 3GN8A 4N73A 4MGBA 1YYEA 1FCZA 1Z5XU 3LBDA 4X1GA 4RUOX 5AYGA 1T73A 5C4UA 4R06A 3OMMA 5EJVA 3R29A 3UP0A 4PPSA 1YP0A 5AWKA 3G8IA 2AA6A 4JAZA 5EC9A 1Y9RA 5CJ6A 3H52A 2NV7A 4ZOMA 5ICKA 4J5XA 4EMAA 1XDKB 1S9QA 5E19A 3OS8A 3X1IA 1FD0A 1NQ7A 4Q50A 1E3GA 4OKWA 4S15A 5DV6A 4G1DA 2B50A 5AVIA 4PP6A 1FM9D 2GTKA 2Q60A 4IU7A 4LNWA 3O1EA 1XV9B 4QJRA 2OAXA 4TV1A 5DMFA 3VHVA 2HB8A 1XAPA 1XQ3A 2ZNQA 4OGHA 1MZNA 5AWJA 2QR9A 3L0JA 1KNUA 1I37A 2I4PA 2QA8A 2QTUA 4OJBA 5HZCA 5KRCA 3AX8A 3K8SA 4F9MA 2ZLCA 4G1ZA 5APKA 4ZJWA 5JJMB 4IVWA 3CQVA 3PO9A 4G2HA 4HLWA 1XLSE 1PRGA 3VT6A 1XJ7A 5FQPA 1R20A 3B66A 1ILGA 1ZKYA 1E3KA 2AX8A 2ZLAA 3ADTA 3ADUA 4P6XA 4ZO1B 1N4HA 1I7IA 1YOKA 3HQ5A 3IXPA 3WMHA 3D57A 1NYXA 5DKSA 1YUCA 3CLDA 3HZFA 3WJ4A 4DMAA 3R2AA 3R5NA 4OZTE 3UUDB 4OKBA 3D6DA 1PCGA 2VV0A 3FALB 4RUJA 3V4AA 1U9EA 4J26A 5G45A 5SYZA 4IA3A 3VHUA 4S14A 5DU5A 4PLEA 4POHA 1PK5A 1XPCA 3KMRA 1XDKA 4ZNVA 5G5WA 1HJ1A 3ADSA 1UPWA 2Q5PA 4ZNTA 4IA2A 2HCDA 1R6GA 1RDTD 2VV4B 3O1DA 4XAOA 3VT4A 1DB1A 1EXAA 1G1UA 2PKLA 2OZ7A 1XV9A 2YFEA 2R40A 2QXSA 1I7GA 1ZDTA 2P54A 2PRGA 5JY3A 2QZOB 2P4YA 2G0HA 3VSOA 3AFRA 4RMCA 5JJMA 5AK2A 2V7CA 4Q0AC 3UUAB 4RMEA 4QL8A 1UOMA 4FHIA 4R2UA 4WQPA 4J5WA 4OIVA 3KPZA 3TKMA 4MGAA 4S0TA 1A52A 3IA6A 2F4BA 5E14A 3V3EA 2YHDA 1S0XA 5L7GA 2O9IA 1XIUA 1Y0XX 2AMBA 2AWHA 4KZMA 4M8HA 5DKEA 5KRAA 4YPQA 1ERRA 4DM8A 4IWFA 4JYGA 3OSWA 4N8RA 3DZUD 1FCXA 1U3QA 5DV3A 3UUDA 4MGCA 3WGPA 1SR7A 4IVYA 3VRTA 3FALA 3IPQA 5KRFA 3A40X 5KCTA 1RK3A 2ZY0A 3KDUA 5DZHA 3L3XA 5KCWA 4DQMA 4NY9A 1YJEA 3A9EB 3V3QA 4A4WA 3FEJA 3KBAA 4KZIA 4IQRA 4FNEA 3GWSX 4PF3A 2GPUA 1I38A 3R5MA 3V9TA 4PPPA 2QXMA 5IAWA 4PLDA 3CDPA 3X36A 4MG5A 4OZRU 3DZYD 3VTCA 2R6WA 1OVLB 2VV4A 2QW4A 3HODA 2IOKA 1S0ZA 5F9BA 2YLYA 2P1TA 3A2HA 5DRJA 3CTBA 4RWVA 2POGA 3P8XA 4ZJRA 3PLZA 4M8EA 2QZOA 2ATHA 3KDTA 3CS6A 1GWXA 4RMDA 5AZTA 4POJA 4REFA 1BSXA 2G0GA 4IWCA 3L3ZA 5FQSA 2P1UA 3UUAA 3WJ5A 4CI4A 2W8YA 5A86A 3OLFA 2Q6RA 3IMYA 2Q5GA 1ILHA 1X7BA 1M7WA 4OARA 5DZ3A 4DORA 4TUZA 2PIVA 3DR1A 3SZ1A 4NQAB 5DKGA 3FUGA 3GYUA 4XTAA 2ZNNA 4ITFA 3VJSA 1FBYA 1LV2A 1U3SA 2ZMHA 5ETHA 4X1FA 2OUZA 1Q4XA 2HARA 3WT7A 2O4RA 4XI3A 5C4SA 1IE9A 4RZEA 5KRLA 2ZNPA 2BAWA 5DUHA 1PDUA 4FHHA 4LTWA 4Q13A 4DK7A 2G5OA 1U3RA 3D24A 5I4VA 2QABA 5KCFA 5AAUA 5DXQA 5HJSA 1IE8A 3WT6A 2H79A 2HVCA 3A9EA 3L03A 1NDEA 4PWLA 5DP0A 3NOAA 1YY4A 3M7RA 3UUCA 4RZGA 3RY9A 1QKNA 4OKTA 1K74A 4FGYA 2EWPA 1XNNA 2XYJA 5GIEA 2NPAA 2Q8SA 1OVLA 2ZK1A 3N00A 2ZK0A 4N5GA 5FQVA 1FM6D 4A4VA 2Z4BA 3V49A 5DIEA 2ZVTA 4G21A 4J5XC 1QKUA 3ET1A 5DXKA 3B1MA 2AA5A 2ZK2A 3CS4A 3OS8C 4OEAA 4UDAA 5KRMA 2YLQA 2ZKCA 2YJAB 3P89A 3OSIA 4ZNHA 5DWJA 4CI5A 3L1BA 2Q3YA 2ZXZA 3OKHA 4RFWA 4YT1A 4WHGA 2YLOA 3KMGA 4ONIA 1PQ6A 2ZK5A 3CS8A 2ZNOA 5IXKA 1XP9A 2ZK6A 4MGAB 1MVCA 5M96A 4OHAA 1T74A 3OSAA 5DXEA 1K4WA 1KKQA 2JF9A 3PRGA 5DTVA 5KYJA 2PIWA 4HEEX 3H0AD 3X31A 2AX9A 3VRWA 3G0WA 1XQCA 3ZR7A 5JI0D 3TX7B 1Z95A 4K6IA 3FXVA 3W0JA 1ZAFA 2Q1HA 3Q95B 1ZUCA 3OMPA 3VT9A 3WWRA 5DRMA 5EGVA 4OLMA 3GWXA 2JFAB 4DOSA 3MNOA 3A78A 2QA6A 3PBAA 2AAXA 1MV9A 2B1ZA 2PITA 2NXXA 2V0VA 5KRKA 3ERTA 4OILA 1NQ0A 1YA3A 2AM9A 2AMAA 1TXIA 2I0GA 2PIOA 2PIUA 4IW8A 4OJ4A 1R1KA 2BJ4B 2ZXNA 3FURA 2YLPA 2HFPA 4UDDA 1NQ1A 3QT0A 5KYAA 5DXBB 5KD9A 1T7FA 1VJBA 1WM0X 1NRLA 2O4JA 1NAVA 2REWA 2JJ3A 3HVLA 4PP5A 5DIGA 5DWEA 5GIDA 1PZLA 5G44A 4WLBA 4PXMA 3D5FA 3JZCA 3VT8A 2Q6SA 4OZRE 4XLDA 3W0IA 3FS1A 3B5RA 2QE4A 1L2IA 4TUZB 3W0YA 3L0EA 2GL8A 3OMKA 4LNXA 3NSPA 3B0QA 1XOWA 4NB6A 3K6PA 3E00D 2P7GA 5DYBA 3F7DA 4ZN7A 3W5QA 2J4AA 1RDTA 5DLRA 3RVFA 3Q95A 3UVVB 1YOWA 3B65A 3E7CA 3A2JA 3FC6B 4L96A 2QH6A 2ZK4A 2IHQA 4ZNSA 5DMCA 3R8AA 3VRUA 2JFAA 2Q70A 2IOGA 1X7JA 3ILZA 3WTQA 5HYKA 3K22A 3S9SA 2FSZA 3GZ9A 2GPPA 4NIEA 4YMQA 4PVUA 2XHSA 4WVDA 3UU7B 4MG8B 2POBA 2Z4JA 3A3ZX 5KROA 1KV6A 3ET3A 4G2IA 3B68A 2HBHA 5DZ1A 2BJ4A 3W0HA 1XVPB 3DY6A 2I4ZA 2AX7A 1EREA 1X7RA 5DXBA 3OOFA 4JYIA 1NAXA 5EI1A 3JZBA 2GPVA 3VN2A 4BCRA 2AYRA 5KR9A 3K23A 3DZUA 5DWGA 3DT3A 2J7XA 1XB7A 5L7HA 3CWDA 3KYTA 4CSJA 3W0AA 4JYHA 2ZMJA 2B23A 1G50A 2H77A 4XUHA 2P7AA 5DZIA 2AX6A 3EYBA 2Q61A 1T63A 3FEIA 4MG7B 3OZJA 2VSTA 5EHJA 4OK1A 2AO6A 4N1YA 4OH6A 5DXMA 5DX3B 2Q7IA 3DZYA 1GWQA 1X7EA 1X78A 4RAKA 1T7RA 5EITA 3ET2A 4IV4A 3AZ2A 3VJIA 3OMOA 4DM6A 3UVVA 2HASA 4Y29A 5DWIA 5DK9A 3B67A 1RJKA 2Q6JA 2B1VA 4RUPA 3FC6A 5B41A 2QPYA 3KWYA 2P1VA
chains in the Genus database with same CATH topology
3OLLA 4ZNUA 3TY0A 2I4JA 1Y0SA 2YJDA 5ACCA 2QGWA 3UU7A 5KRIA 4MG6A 4MG8A 4OKXA 4E4QA 1T7MA 2OM9A 3G8OA 5HJPB 1UHLB 5APJA 3AUNA 5KRHA 1ZGYA 2ZK3A 1XVPA 1M13A 1XP1A 3P0UA 3X1HA 4DK8A 4O8FA 5C4OA 1GS4A 1T5ZA 3HC6A 2R6YA 4OEYA 4WPFA 4KZJA 4FN9A 3D90A 5LGAA 1QKMA 4XT9A 1SKXA 5IZ0A 3UP3A 2LBDA 3KMZA 3RUUA 3VT3A 1QKTA 2XYXA 4OEDA 4UDBA 2FVJA 4OH5A 3L0LA 3OOKA 5L11A 4REEA 5G3JA 1ZH7A 3RLJA 1R20D 2J14A 5AZVA 2ZL9A 4MG9B 4E2JA 2E2RA 2VV3A 3ERDA 2HC4A 2Q7KA 5APHA 3VRVA 3W5TA 2ZFXA 3HC5A 4QM0A 3ADXA 1P93A 4XUMA 1G5YA 4MG7A 3IXPD 5DSHA 2PINA 2GWXA 3DCUA 1OSHA 3B0TA 4QK4A 4OFUA 5DX3A 1X76A 2PJLA 3WT5A 2HAMA 3IPSA 4PP3A 1FM6A 1FM9A 1M2ZA 3VJTA 3OLSA 4B7WA 2AXAA 2VV1B 2I0JA 3BEJA 3W0CA 4OEZA 2PNUA 1S9PA 3CDSA 5DL4A 4WHFA 4RE8A 2XKWA 1UPVA 1NHZA 3V9YA 4E4KA 4RZFA 5DV8A 2P15A 5KCUA 1XZXX 3OKIA 1LBDA 4OC7A 1R1KD 5AAVB 5E7VA 4IS8A 1P8DA 5HJPA 1RKGA 3ET0A 5GT4A 1UHLA 3SP9A 1G2NA 2R40D 5DY8A 3H0AA 4EM9A 3AURA 4JGVA 3OMQA 1RKHA 5KCEA 1YMTA 2YATA 4K4JA 3B0WA 3ZRAA 1H9UA 1EXXA 2ZBSA 2VSRA 1R5KA 3F5CB 4NUFA 1T7TA 4OIUA 4S0SA 3OZ0A 5G42A 2AA7A 3V9VA 2GIUA 2ACLB 3B3KA 3OGTA 4MG9A 1PQCA 3W5PA 4G20A 2Q7LA 2QMVA 4APUA 2Q59B 1A28A 2PIRA 3OS9A 4MGDB 2FAIA 3TKCA 3PEQA 5HCVA 3AN3A 3HO0A 4P6WA 1N83A 1ZDUA 4J5WC 4IUIA 3GBKA 5KRJA 2ZASA 3AN4A 2PIPL 1DKFB 2Q1VA 1NUOA 4A2JA 1XP6A 3SP6A 1PQ9A 4OFRA 4XHDA 3VT5A 4J24A 2VV1A 4JL4A 4ZNWA 3VJHA 5E0WA 5L7EA 5KCDA 1YIMA 1SJ0A 5DUEA 3BC5A 3DCTA 4OJ9A 3MNEA 3U9QA 2P7ZA 2QGTA 4OZTU 2QSEA 3LMPA 3NSQA 3HLVA 5DXPA 1SQNA 4K7AA 3RUTA 3VTDA 4UDCA 4ZN9A 3ZQTA 5AAVA 4G1YA 4ZI1A 3AZ1A 5HYRA 3ADVA 3P88A 5FQRA 5FQTA 4IA7A 3RLLA 2NXXE 5DYDA 2Q5SA 5DIDA 3E00A 5DZ0A 5K13A 3G9EA 4IW6A 2QNVA 2PIXA 2AA2A 3OAPA 2OVMA 4MGBB 5E15A 2ABIA 3VI8A 5DKBA 3F5CA 5DVSA 5G46A 3FLIA 5E1CA 3BQDA 2Q7JA 3W0GA 1OSVA 5E0XA 3VT7A 3R8IA 5H1EA 2PIQA 1ZEOA 4R6SA 2G44A 2ACLA 2XYWA 1K7LA 1TFCA 4LBDA 5GICA 3GD2A 5DI7A 2HWQA 3R8DA 1XNXA 1HG4A 5DVCA 2Q59A 4PRGA 5C4TA 1T76A 5KCCA 4MGDA 3T03A 4L98A 5B5BA 1Z5XE 3CJWA 4ZO1X 2GPOA 3VHWA 1S19A 3VTBA 2OCFA 3B0RA 1L2JA 4TV1B 1NQ2A 4QE8A 3HM1A 3VSPA 1XLSA 5DXGA 3KFCA 1DKFA 2ZMIA 4IA1A 2QA8B 3IPUA 3ZRBA 2J7YA 3WFFA 1FCYA 1N46A 2A3IA 2NW4A 2OVHA 1YINA 4LSJA 3MNPA 2AB2A 4IV2A 3AZ3A 5DUGA 3E94A 1K74D 3GYTA 5DXRA 5LWPA 2HB7A 4QE6A 1GWRA 1T79A 3A2IA 2ZXMA 3WFGA 5AVLA 3PCUA 1T65A 4MDDA 3AUQA 2HWRA 2VV2A 3W5RA 1OT7A 2GP7A 5DWLA 5DVVA 4YNKA 3ADWA 5G43A 4ITEA 3GN8A 4N73A 4MGBA 1YYEA 1FCZA 1Z5XU 3LBDA 4X1GA 4RUOX 5AYGA 1T73A 5C4UA 4R06A 3OMMA 5EJVA 3R29A 3UP0A 4PPSA 1YP0A 5AWKA 3G8IA 2AA6A 4JAZA 5EC9A 1Y9RA 5CJ6A 3H52A 2NV7A 4ZOMA 5ICKA 4J5XA 4EMAA 1XDKB 1S9QA 5E19A 3OS8A 3X1IA 1FD0A 1NQ7A 4Q50A 1E3GA 4OKWA 4S15A 5DV6A 4G1DA 2B50A 5AVIA 4PP6A 1FM9D 2GTKA 2Q60A 4IU7A 4LNWA 3O1EA 1XV9B 4QJRA 2OAXA 4TV1A 5DMFA 3VHVA 2HB8A 1XAPA 1XQ3A 2ZNQA 4OGHA 1MZNA 5AWJA 2QR9A 3L0JA 1KNUA 1I37A 2I4PA 2QA8A 2QTUA 4OJBA 5HZCA 5KRCA 3AX8A 3K8SA 4F9MA 2ZLCA 4G1ZA 5APKA 4ZJWA 5JJMB 4IVWA 3CQVA 3PO9A 4G2HA 4HLWA 1XLSE 1PRGA 3VT6A 1XJ7A 5FQPA 1R20A 3B66A 1ILGA 1ZKYA 1E3KA 2AX8A 2ZLAA 3ADTA 3ADUA 4P6XA 4ZO1B 1N4HA 1I7IA 1YOKA 3HQ5A 3IXPA 3WMHA 3D57A 1NYXA 5DKSA 1YUCA 3CLDA 3HZFA 3WJ4A 4DMAA 3R2AA 3R5NA 4OZTE 3UUDB 4OKBA 3D6DA 1PCGA 2VV0A 3FALB 4RUJA 3V4AA 1U9EA 4J26A 5G45A 5SYZA 4IA3A 3VHUA 4S14A 5DU5A 4PLEA 4POHA 1PK5A 1XPCA 3KMRA 1XDKA 4ZNVA 5G5WA 1HJ1A 3ADSA 1UPWA 2Q5PA 4ZNTA 4IA2A 2HCDA 1R6GA 1RDTD 2VV4B 3O1DA 4XAOA 3VT4A 1DB1A 1EXAA 1G1UA 2PKLA 2OZ7A 1XV9A 2YFEA 2R40A 2QXSA 1I7GA 1ZDTA 2P54A 2PRGA 5JY3A 2QZOB 2P4YA 2G0HA 3VSOA 3AFRA 4RMCA 5JJMA 5AK2A 2V7CA 4Q0AC 3UUAB 4RMEA 4QL8A 1UOMA 4FHIA 4R2UA 4WQPA 4J5WA 4OIVA 3KPZA 3TKMA 4MGAA 4S0TA 1A52A 3IA6A 2F4BA 5E14A 3V3EA 2YHDA 1S0XA 5L7GA 2O9IA 1XIUA 1Y0XX 2AMBA 2AWHA 4KZMA 4M8HA 5DKEA 5KRAA 4YPQA 1ERRA 4DM8A 4IWFA 4JYGA 3OSWA 4N8RA 3DZUD 1FCXA 1U3QA 5DV3A 3UUDA 4MGCA 3WGPA 1SR7A 4IVYA 3VRTA 3FALA 3IPQA 5KRFA 3A40X 5KCTA 1RK3A 2ZY0A 3KDUA 5DZHA 3L3XA 5KCWA 4DQMA 4NY9A 1YJEA 3A9EB 3V3QA 4A4WA 3FEJA 3KBAA 4KZIA 4IQRA 4FNEA 3GWSX 4PF3A 2GPUA 1I38A 3R5MA 3V9TA 4PPPA 2QXMA 5IAWA 4PLDA 3CDPA 3X36A 4MG5A 4OZRU 3DZYD 3VTCA 2R6WA 1OVLB 2VV4A 2QW4A 3HODA 2IOKA 1S0ZA 5F9BA 2YLYA 2P1TA 3A2HA 5DRJA 3CTBA 4RWVA 2POGA 3P8XA 4ZJRA 3PLZA 4M8EA 2QZOA 2ATHA 3KDTA 3CS6A 1GWXA 4RMDA 5AZTA 4POJA 4REFA 1BSXA 2G0GA 4IWCA 3L3ZA 5FQSA 2P1UA 3UUAA 3WJ5A 4CI4A 2W8YA 5A86A 3OLFA 2Q6RA 3IMYA 2Q5GA 1ILHA 1X7BA 1M7WA 4OARA 5DZ3A 4DORA 4TUZA 2PIVA 3DR1A 3SZ1A 4NQAB 5DKGA 3FUGA 3GYUA 4XTAA 2ZNNA 4ITFA 3VJSA 1FBYA 1LV2A 1U3SA 2ZMHA 5ETHA 4X1FA 2OUZA 1Q4XA 2HARA 3WT7A 2O4RA 4XI3A 5C4SA 1IE9A 4RZEA 5KRLA 2ZNPA 2BAWA 5DUHA 1PDUA 4FHHA 4LTWA 4Q13A 4DK7A 2G5OA 1U3RA 3D24A 5I4VA 2QABA 5KCFA 5AAUA 5DXQA 5HJSA 1IE8A 3WT6A 2H79A 2HVCA 3A9EA 3L03A 1NDEA 4PWLA 5DP0A 3NOAA 1YY4A 3M7RA 3UUCA 4RZGA 3RY9A 1QKNA 4OKTA 1K74A 4FGYA 2EWPA 1XNNA 2XYJA 5GIEA 2NPAA 2Q8SA 1OVLA 2ZK1A 3N00A 2ZK0A 4N5GA 5FQVA 1FM6D 4A4VA 2Z4BA 3V49A 5DIEA 2ZVTA 4G21A 4J5XC 1QKUA 3ET1A 5DXKA 3B1MA 2AA5A 2ZK2A 3CS4A 3OS8C 4OEAA 4UDAA 5KRMA 2YLQA 2ZKCA 2YJAB 3P89A 3OSIA 4ZNHA 5DWJA 4CI5A 3L1BA 2Q3YA 2ZXZA 3OKHA 4RFWA 4YT1A 4WHGA 2YLOA 3KMGA 4ONIA 1PQ6A 2ZK5A 3CS8A 2ZNOA 5IXKA 1XP9A 2ZK6A 4MGAB 1MVCA 5M96A 4OHAA 1T74A 3OSAA 5DXEA 1K4WA 1KKQA 2JF9A 3PRGA 5DTVA 5KYJA 2PIWA 4HEEX 3H0AD 3X31A 2AX9A 3VRWA 3G0WA 1XQCA 3ZR7A 5JI0D 3TX7B 1Z95A 4K6IA 3FXVA 3W0JA 1ZAFA 2Q1HA 3Q95B 1ZUCA 3OMPA 3VT9A 3WWRA 5DRMA 5EGVA 4OLMA 3GWXA 2JFAB 4DOSA 3MNOA 3A78A 2QA6A 3PBAA 2AAXA 1MV9A 2B1ZA 2PITA 2NXXA 2V0VA 5KRKA 3ERTA 4OILA 1NQ0A 1YA3A 2AM9A 2AMAA 1TXIA 2I0GA 2PIOA 2PIUA 4IW8A 4OJ4A 1R1KA 2BJ4B 2ZXNA 3FURA 2YLPA 2HFPA 4UDDA 1NQ1A 3QT0A 5KYAA 5DXBB 5KD9A 1T7FA 1VJBA 1WM0X 1NRLA 2O4JA 1NAVA 2REWA 2JJ3A 3HVLA 4PP5A 5DIGA 5DWEA 5GIDA 1PZLA 5G44A 4WLBA 4PXMA 3D5FA 3JZCA 3VT8A 2Q6SA 4OZRE 4XLDA 3W0IA 3FS1A 3B5RA 2QE4A 1L2IA 4TUZB 3W0YA 3L0EA 2GL8A 3OMKA 4LNXA 3NSPA 3B0QA 1XOWA 4NB6A 3K6PA 3E00D 2P7GA 5DYBA 3F7DA 4ZN7A 3W5QA 2J4AA 1RDTA 5DLRA 3RVFA 3Q95A 3UVVB 1YOWA 3B65A 3E7CA 3A2JA 3FC6B 4L96A 2QH6A 2ZK4A 2IHQA 4ZNSA 5DMCA 3R8AA 3VRUA 2JFAA 2Q70A 2IOGA 1X7JA 3ILZA 3WTQA 5HYKA 3K22A 3S9SA 2FSZA 3GZ9A 2GPPA 4NIEA 4YMQA 4PVUA 2XHSA 4WVDA 3UU7B 4MG8B 2POBA 2Z4JA 3A3ZX 5KROA 1KV6A 3ET3A 4G2IA 3B68A 2HBHA 5DZ1A 2BJ4A 3W0HA 1XVPB 3DY6A 2I4ZA 2AX7A 1EREA 1X7RA 5DXBA 3OOFA 4JYIA 1NAXA 5EI1A 3JZBA 2GPVA 3VN2A 4BCRA 2AYRA 5KR9A 3K23A 3DZUA 5DWGA 3DT3A 2J7XA 1XB7A 5L7HA 3CWDA 3KYTA 4CSJA 3W0AA 4JYHA 2ZMJA 2B23A 1G50A 2H77A 4XUHA 2P7AA 5DZIA 2AX6A 3EYBA 2Q61A 1T63A 3FEIA 4MG7B 3OZJA 2VSTA 5EHJA 4OK1A 2AO6A 4N1YA 4OH6A 5DXMA 5DX3B 2Q7IA 3DZYA 1GWQA 1X7EA 1X78A 4RAKA 1T7RA 5EITA 3ET2A 4IV4A 3AZ2A 3VJIA 3OMOA 4DM6A 3UVVA 2HASA 4Y29A 5DWIA 5DK9A 3B67A 1RJKA 2Q6JA 2B1VA 4RUPA 3FC6A 5B41A 2QPYA 3KWYA 2P1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OLL A;  4ZNU A;  3TY0 A;  2I4J A;  1Y0S A;  2YJD A;  5ACC A;  2QGW A;  3UU7 A;  5KRI A;  4MG6 A;  4MG8 A;  4OKX A;  4E4Q A;  1T7M A;  2OM9 A;  3G8O A;  5HJP B;  1UHL B;  5APJ A;  3AUN A;  5KRH A;  1ZGY A;  2ZK3 A;  1XVP A;  1M13 A;  1XP1 A;  3P0U A;  3X1H A;  4DK8 A;  4O8F A;  5C4O A;  1GS4 A;  1T5Z A;  3HC6 A;  2R6Y A;  4OEY A;  4WPF A;  4KZJ A;  4FN9 A;  3D90 A;  5LGA A;  1QKM A;  4XT9 A;  1SKX A;  5IZ0 A;  3UP3 A;  2LBD A;  3KMZ A;  3RUU A;  3VT3 A;  1QKT A;  2XYX A;  4OED A;  4UDB A;  2FVJ A;  4OH5 A;  3L0L A;  3OOK A;  5L11 A;  4REE A;  5G3J A;  1ZH7 A;  3RLJ A;  1R20 D;  2J14 A;  5AZV A;  2ZL9 A;  4MG9 B;  4E2J A;  2E2R A;  2VV3 A;  3ERD A;  2HC4 A;  2Q7K A;  5APH A;  3VRV A;  3W5T A;  2ZFX A;  3HC5 A;  4QM0 A;  3ADX A;  1P93 A;  4XUM A;  1G5Y A;  4MG7 A;  3IXP D;  5DSH A;  2PIN A;  2GWX A;  3DCU A;  1OSH A;  3B0T A;  4QK4 A;  4OFU A;  5DX3 A;  1X76 A;  2PJL A;  3WT5 A;  2HAM A;  3IPS A;  4PP3 A;  1FM6 A;  1FM9 A;  1M2Z A;  3VJT A;  3OLS A;  4B7W A;  2AXA A;  2VV1 B;  2I0J A;  3BEJ A;  3W0C A;  4OEZ A;  2PNU A;  1S9P A;  3CDS A;  5DL4 A;  4WHF A;  4RE8 A;  2XKW A;  1UPV A;  1NHZ A;  3V9Y A;  4E4K A;  4RZF A;  5DV8 A;  2P15 A;  5KCU A;  1XZX X;  3OKI A;  1LBD A;  4OC7 A;  1R1K D;  5AAV B;  5E7V A;  4IS8 A;  1P8D A;  5HJP A;  1RKG A;  3ET0 A;  5GT4 A;  1UHL A;  3SP9 A;  1G2N A;  2R40 D;  5DY8 A;  3H0A A;  4EM9 A;  3AUR A;  4JGV A;  3OMQ A;  1RKH A;  5KCE A;  1YMT A;  2YAT A;  4K4J A;  3B0W A;  3ZRA A;  1H9U A;  1EXX A;  2ZBS A;  2VSR A;  1R5K A;  3F5C B;  4NUF A;  1T7T A;  4OIU A;  4S0S A;  3OZ0 A;  5G42 A;  2AA7 A;  3V9V A;  2GIU A;  2ACL B;  3B3K A;  3OGT A;  4MG9 A;  1PQC A;  3W5P A;  4G20 A;  2Q7L A;  2QMV A;  4APU A;  2Q59 B;  1A28 A;  2PIR A;  3OS9 A;  4MGD B;  2FAI A;  3TKC A;  3PEQ A;  5HCV A;  3AN3 A;  3HO0 A;  4P6W A;  1N83 A;  1ZDU A;  4J5W C;  4IUI A;  3GBK A;  5KRJ A;  2ZAS A;  3AN4 A;  2PIP L;  1DKF B;  2Q1V A;  1NUO A;  4A2J A;  1XP6 A;  3SP6 A;  1PQ9 A;  4OFR A;  4XHD A;  3VT5 A;  4J24 A;  2VV1 A;  4JL4 A;  4ZNW A;  3VJH A;  5E0W A;  5L7E A;  5KCD A;  1YIM A;  1SJ0 A;  5DUE A;  3BC5 A;  3DCT A;  4OJ9 A;  3MNE A;  3U9Q A;  2P7Z A;  2QGT A;  4OZT U;  2QSE A;  3LMP A;  3NSQ A;  3HLV A;  5DXP A;  1SQN A;  4K7A A;  3RUT A;  3VTD A;  4UDC A;  4ZN9 A;  3ZQT A;  5AAV A;  4G1Y A;  4ZI1 A;  3AZ1 A;  5HYR A;  3ADV A;  3P88 A;  5FQR A;  5FQT A;  4IA7 A;  3RLL A;  2NXX E;  5DYD A;  2Q5S A;  5DID A;  3E00 A;  5DZ0 A;  5K13 A;  3G9E A;  4IW6 A;  2QNV A;  2PIX A;  2AA2 A;  3OAP A;  2OVM A;  4MGB B;  5E15 A;  2ABI A;  3VI8 A;  5DKB A;  3F5C A;  5DVS A;  5G46 A;  3FLI A;  5E1C A;  3BQD A;  2Q7J A;  3W0G A;  1OSV A;  5E0X A;  3VT7 A;  3R8I A;  5H1E A;  2PIQ A;  1ZEO A;  4R6S A;  2G44 A;  2ACL A;  2XYW A;  1K7L A;  1TFC A;  4LBD A;  5GIC A;  3GD2 A;  5DI7 A;  2HWQ A;  3R8D A;  1XNX A;  1HG4 A;  5DVC A;  2Q59 A;  4PRG A;  5C4T A;  1T76 A;  5KCC A;  4MGD A;  3T03 A;  4L98 A;  5B5B A;  1Z5X E;  3CJW A;  4ZO1 X;  2GPO A;  3VHW A;  1S19 A;  3VTB A;  2OCF A;  3B0R A;  1L2J A;  4TV1 B;  1NQ2 A;  4QE8 A;  3HM1 A;  3VSP A;  1XLS A;  5DXG A;  3KFC A;  1DKF A;  2ZMI A;  4IA1 A;  2QA8 B;  3IPU A;  3ZRB A;  2J7Y A;  3WFF A;  1FCY A;  1N46 A;  2A3I A;  2NW4 A;  2OVH A;  1YIN A;  4LSJ A;  3MNP A;  2AB2 A;  4IV2 A;  3AZ3 A;  5DUG A;  3E94 A;  1K74 D;  3GYT A;  5DXR A;  5LWP A;  2HB7 A;  4QE6 A;  1GWR A;  1T79 A;  3A2I A;  2ZXM A;  3WFG A;  5AVL A;  3PCU A;  1T65 A;  4MDD A;  3AUQ A;  2HWR A;  2VV2 A;  3W5R A;  1OT7 A;  2GP7 A;  5DWL A;  5DVV A;  4YNK A;  3ADW A;  5G43 A;  4ITE A;  3GN8 A;  4N73 A;  4MGB A;  1YYE A;  1FCZ A;  1Z5X U;  3LBD A;  4X1G A;  4RUO X;  5AYG A;  1T73 A;  5C4U A;  4R06 A;  3OMM A;  5EJV A;  3R29 A;  3UP0 A;  4PPS A;  1YP0 A;  5AWK A;  3G8I A;  2AA6 A;  4JAZ A;  5EC9 A;  1Y9R A;  5CJ6 A;  3H52 A;  2NV7 A;  4ZOM A;  5ICK A;  4J5X A;  4EMA A;  1XDK B;  1S9Q A;  5E19 A;  3OS8 A;  3X1I A;  1FD0 A;  1NQ7 A;  4Q50 A;  1E3G A;  4OKW A;  4S15 A;  5DV6 A;  4G1D A;  2B50 A;  5AVI A;  4PP6 A;  1FM9 D;  2GTK A;  2Q60 A;  4IU7 A;  4LNW A;  3O1E A;  1XV9 B;  4QJR A;  2OAX A;  4TV1 A;  5DMF A;  3VHV A;  2HB8 A;  1XAP A;  1XQ3 A;  2ZNQ A;  4OGH A;  1MZN A;  5AWJ A;  2QR9 A;  3L0J A;  1KNU A;  1I37 A;  2I4P A;  2QA8 A;  2QTU A;  4OJB A;  5HZC A;  5KRC A;  3AX8 A;  3K8S A;  4F9M A;  2ZLC A;  4G1Z A;  5APK A;  4ZJW A;  5JJM B;  4IVW A;  3CQV A;  3PO9 A;  4G2H A;  4HLW A;  1XLS E;  1PRG A;  3VT6 A;  1XJ7 A;  5FQP A;  1R20 A;  3B66 A;  1ILG A;  1ZKY A;  1E3K A;  2AX8 A;  2ZLA A;  3ADT A;  3ADU A;  4P6X A;  4ZO1 B;  1N4H A;  1I7I A;  1YOK A;  3HQ5 A;  3IXP A;  3WMH A;  3D57 A;  1NYX A;  5DKS A;  1YUC A;  3CLD A;  3HZF A;  3WJ4 A;  4DMA A;  3R2A A;  3R5N A;  4OZT E;  3UUD B;  4OKB A;  3D6D A;  1PCG A;  2VV0 A;  3FAL B;  4RUJ A;  3V4A A;  1U9E A;  4J26 A;  5G45 A;  5SYZ A;  4IA3 A;  3VHU A;  4S14 A;  5DU5 A;  4PLE A;  4POH A;  1PK5 A;  1XPC A;  3KMR A;  1XDK A;  4ZNV A;  5G5W A;  1HJ1 A;  3ADS A;  1UPW A;  2Q5P A;  4ZNT A;  4IA2 A;  2HCD A;  1R6G A;  1RDT D;  2VV4 B;  3O1D A;  4XAO A;  3VT4 A;  1DB1 A;  1EXA A;  1G1U A;  2PKL A;  2OZ7 A;  1XV9 A;  2YFE A;  2R40 A;  2QXS A;  1I7G A;  1ZDT A;  2P54 A;  2PRG A;  5JY3 A;  2QZO B;  2P4Y A;  2G0H A;  3VSO A;  3AFR A;  4RMC A;  5JJM A;  5AK2 A;  2V7C A;  4Q0A C;  3UUA B;  4RME A;  4QL8 A;  1UOM A;  4FHI A;  4R2U A;  4WQP A;  4J5W A;  4OIV A;  3KPZ A;  3TKM A;  4MGA A;  4S0T A;  1A52 A;  3IA6 A;  2F4B A;  5E14 A;  3V3E A;  2YHD A;  1S0X A;  5L7G A;  2O9I A;  1XIU A;  1Y0X X;  2AMB A;  2AWH A;  4KZM A;  4M8H A;  5DKE A;  5KRA A;  4YPQ A;  1ERR A;  4DM8 A;  4IWF A;  4JYG A;  3OSW A;  4N8R A;  3DZU D;  1FCX A;  1U3Q A;  5DV3 A;  3UUD A;  4MGC A;  3WGP A;  1SR7 A;  4IVY A;  3VRT A;  3FAL A;  3IPQ A;  5KRF A;  3A40 X;  5KCT A;  1RK3 A;  2ZY0 A;  3KDU A;  5DZH A;  3L3X A;  5KCW A;  4DQM A;  4NY9 A;  1YJE A;  3A9E B;  3V3Q A;  4A4W A;  3FEJ A;  3KBA A;  4KZI A;  4IQR A;  4FNE A;  3GWS X;  4PF3 A;  2GPU A;  1I38 A;  3R5M A;  3V9T A;  4PPP A;  2QXM A;  5IAW A;  4PLD A;  3CDP A;  3X36 A;  4MG5 A;  4OZR U;  3DZY D;  3VTC A;  2R6W A;  1OVL B;  2VV4 A;  2QW4 A;  3HOD A;  2IOK A;  1S0Z A;  5F9B A;  2YLY A;  2P1T A;  3A2H A;  5DRJ A;  3CTB A;  4RWV A;  2POG A;  3P8X A;  4ZJR A;  3PLZ A;  4M8E A;  2QZO A;  2ATH A;  3KDT A;  3CS6 A;  1GWX A;  4RMD A;  5AZT A;  4POJ A;  4REF A;  1BSX A;  2G0G A;  4IWC A;  3L3Z A;  5FQS A;  2P1U A;  3UUA A;  3WJ5 A;  4CI4 A;  2W8Y A;  5A86 A;  3OLF A;  2Q6R A;  3IMY A;  2Q5G A;  1ILH A;  1X7B A;  1M7W A;  4OAR A;  5DZ3 A;  4DOR A;  4TUZ A;  2PIV A;  3DR1 A;  3SZ1 A;  4NQA B;  5DKG A;  3FUG A;  3GYU A;  4XTA A;  2ZNN A;  4ITF A;  3VJS A;  1FBY A;  1LV2 A;  1U3S A;  2ZMH A;  5ETH A;  4X1F A;  2OUZ A;  1Q4X A;  2HAR A;  3WT7 A;  2O4R A;  4XI3 A;  5C4S A;  1IE9 A;  4RZE A;  5KRL A;  2ZNP A;  2BAW A;  5DUH A;  1PDU A;  4FHH A;  4LTW A;  4Q13 A;  4DK7 A;  2G5O A;  1U3R A;  3D24 A;  5I4V A;  2QAB A;  5KCF A;  5AAU A;  5DXQ A;  5HJS A;  1IE8 A;  3WT6 A;  2H79 A;  2HVC A;  3A9E A;  3L03 A;  1NDE A;  4PWL A;  5DP0 A;  3NOA A;  1YY4 A;  3M7R A;  3UUC A;  4RZG A;  3RY9 A;  1QKN A;  4OKT A;  1K74 A;  4FGY A;  2EWP A;  1XNN A;  2XYJ A;  5GIE A;  2NPA A;  2Q8S A;  1OVL A;  2ZK1 A;  3N00 A;  2ZK0 A;  4N5G A;  5FQV A;  1FM6 D;  4A4V A;  2Z4B A;  3V49 A;  5DIE A;  2ZVT A;  4G21 A;  4J5X C;  1QKU A;  3ET1 A;  5DXK A;  3B1M A;  2AA5 A;  2ZK2 A;  3CS4 A;  3OS8 C;  4OEA A;  4UDA A;  5KRM A;  2YLQ A;  2ZKC A;  2YJA B;  3P89 A;  3OSI A;  4ZNH A;  5DWJ A;  4CI5 A;  3L1B A;  2Q3Y A;  2ZXZ A;  3OKH A;  4RFW A;  4YT1 A;  4WHG A;  2YLO A;  3KMG A;  4ONI A;  1PQ6 A;  2ZK5 A;  3CS8 A;  2ZNO A;  5IXK A;  1XP9 A;  2ZK6 A;  4MGA B;  1MVC A;  5M96 A;  4OHA A;  1T74 A;  3OSA A;  5DXE A;  1K4W A;  1KKQ A;  2JF9 A;  3PRG A;  5DTV A;  5KYJ A;  2PIW A;  4HEE X;  3H0A D;  3X31 A;  2AX9 A;  3VRW A;  3G0W A;  1XQC A;  3ZR7 A;  5JI0 D;  3TX7 B;  1Z95 A;  4K6I A;  3FXV A;  3W0J A;  1ZAF A;  2Q1H A;  3Q95 B;  1ZUC A;  3OMP A;  3VT9 A;  3WWR A;  5DRM A;  5EGV A;  4OLM A;  3GWX A;  2JFA B;  4DOS A;  3MNO A;  3A78 A;  2QA6 A;  3PBA A;  2AAX A;  1MV9 A;  2B1Z A;  2PIT A;  2NXX A;  2V0V A;  5KRK A;  3ERT A;  4OIL A;  1NQ0 A;  1YA3 A;  2AM9 A;  2AMA A;  1TXI A;  2I0G A;  2PIO A;  2PIU A;  4IW8 A;  4OJ4 A;  1R1K A;  2BJ4 B;  2ZXN A;  3FUR A;  2YLP A;  2HFP A;  4UDD A;  1NQ1 A;  3QT0 A;  5KYA A;  5DXB B;  5KD9 A;  1T7F A;  1VJB A;  1WM0 X;  1NRL A;  2O4J A;  1NAV A;  2REW A;  2JJ3 A;  3HVL A;  4PP5 A;  5DIG A;  5DWE A;  5GID A;  1PZL A;  5G44 A;  4WLB A;  4PXM A;  3D5F A;  3JZC A;  3VT8 A;  2Q6S A;  4OZR E;  4XLD A;  3W0I A;  3FS1 A;  3B5R A;  2QE4 A;  1L2I A;  4TUZ B;  3W0Y A;  3L0E A;  2GL8 A;  3OMK A;  4LNX A;  3NSP A;  3B0Q A;  1XOW A;  4NB6 A;  3K6P A;  3E00 D;  2P7G A;  5DYB A;  3F7D A;  4ZN7 A;  3W5Q A;  2J4A A;  1RDT A;  5DLR A;  3RVF A;  3Q95 A;  3UVV B;  1YOW A;  3B65 A;  3E7C A;  3A2J A;  3FC6 B;  4L96 A;  2QH6 A;  2ZK4 A;  2IHQ A;  4ZNS A;  5DMC A;  3R8A A;  3VRU A;  2JFA A;  2Q70 A;  2IOG A;  1X7J A;  3ILZ A;  3WTQ A;  5HYK A;  3K22 A;  3S9S A;  2FSZ A;  3GZ9 A;  2GPP A;  4NIE A;  4YMQ A;  4PVU A;  2XHS A;  4WVD A;  3UU7 B;  4MG8 B;  2POB A;  2Z4J A;  3A3Z X;  5KRO A;  1KV6 A;  3ET3 A;  4G2I A;  3B68 A;  2HBH A;  5DZ1 A;  2BJ4 A;  3W0H A;  1XVP B;  3DY6 A;  2I4Z A;  2AX7 A;  1ERE A;  1X7R A;  5DXB A;  3OOF A;  4JYI A;  1NAX A;  5EI1 A;  3JZB A;  2GPV A;  3VN2 A;  4BCR A;  2AYR A;  5KR9 A;  3K23 A;  3DZU A;  5DWG A;  3DT3 A;  2J7X A;  1XB7 A;  5L7H A;  3CWD A;  3KYT A;  4CSJ A;  3W0A A;  4JYH A;  2ZMJ A;  2B23 A;  1G50 A;  2H77 A;  4XUH A;  2P7A A;  5DZI A;  2AX6 A;  3EYB A;  2Q61 A;  1T63 A;  3FEI A;  4MG7 B;  3OZJ A;  2VST A;  5EHJ A;  4OK1 A;  2AO6 A;  4N1Y A;  4OH6 A;  5DXM A;  5DX3 B;  2Q7I A;  3DZY A;  1GWQ A;  1X7E A;  1X78 A;  4RAK A;  1T7R A;  5EIT A;  3ET2 A;  4IV4 A;  3AZ2 A;  3VJI A;  3OMO A;  4DM6 A;  3UVV A;  2HAS A;  4Y29 A;  5DWI A;  5DK9 A;  3B67 A;  1RJK A;  2Q6J A;  2B1V A;  4RUP A;  3FC6 A;  5B41 A;  2QPY A;  3KWY A;  2P1V A; 
#chains in the Genus database with same CATH topology
 3OLL A;  4ZNU A;  3TY0 A;  2I4J A;  1Y0S A;  2YJD A;  5ACC A;  2QGW A;  3UU7 A;  5KRI A;  4MG6 A;  4MG8 A;  4OKX A;  4E4Q A;  1T7M A;  2OM9 A;  3G8O A;  5HJP B;  1UHL B;  5APJ A;  3AUN A;  5KRH A;  1ZGY A;  2ZK3 A;  1XVP A;  1M13 A;  1XP1 A;  3P0U A;  3X1H A;  4DK8 A;  4O8F A;  5C4O A;  1GS4 A;  1T5Z A;  3HC6 A;  2R6Y A;  4OEY A;  4WPF A;  4KZJ A;  4FN9 A;  3D90 A;  5LGA A;  1QKM A;  4XT9 A;  1SKX A;  5IZ0 A;  3UP3 A;  2LBD A;  3KMZ A;  3RUU A;  3VT3 A;  1QKT A;  2XYX A;  4OED A;  4UDB A;  2FVJ A;  4OH5 A;  3L0L A;  3OOK A;  5L11 A;  4REE A;  5G3J A;  1ZH7 A;  3RLJ A;  1R20 D;  2J14 A;  5AZV A;  2ZL9 A;  4MG9 B;  4E2J A;  2E2R A;  2VV3 A;  3ERD A;  2HC4 A;  2Q7K A;  5APH A;  3VRV A;  3W5T A;  2ZFX A;  3HC5 A;  4QM0 A;  3ADX A;  1P93 A;  4XUM A;  1G5Y A;  4MG7 A;  3IXP D;  5DSH A;  2PIN A;  2GWX A;  3DCU A;  1OSH A;  3B0T A;  4QK4 A;  4OFU A;  5DX3 A;  1X76 A;  2PJL A;  3WT5 A;  2HAM A;  3IPS A;  4PP3 A;  1FM6 A;  1FM9 A;  1M2Z A;  3VJT A;  3OLS A;  4B7W A;  2AXA A;  2VV1 B;  2I0J A;  3BEJ A;  3W0C A;  4OEZ A;  2PNU A;  1S9P A;  3CDS A;  5DL4 A;  4WHF A;  4RE8 A;  2XKW A;  1UPV A;  1NHZ A;  3V9Y A;  4E4K A;  4RZF A;  5DV8 A;  2P15 A;  5KCU A;  1XZX X;  3OKI A;  1LBD A;  4OC7 A;  1R1K D;  5AAV B;  5E7V A;  4IS8 A;  1P8D A;  5HJP A;  1RKG A;  3ET0 A;  5GT4 A;  1UHL A;  3SP9 A;  1G2N A;  2R40 D;  5DY8 A;  3H0A A;  4EM9 A;  3AUR A;  4JGV A;  3OMQ A;  1RKH A;  5KCE A;  1YMT A;  2YAT A;  4K4J A;  3B0W A;  3ZRA A;  1H9U A;  1EXX A;  2ZBS A;  2VSR A;  1R5K A;  3F5C B;  4NUF A;  1T7T A;  4OIU A;  4S0S A;  3OZ0 A;  5G42 A;  2AA7 A;  3V9V A;  2GIU A;  2ACL B;  3B3K A;  3OGT A;  4MG9 A;  1PQC A;  3W5P A;  4G20 A;  2Q7L A;  2QMV A;  4APU A;  2Q59 B;  1A28 A;  2PIR A;  3OS9 A;  4MGD B;  2FAI A;  3TKC A;  3PEQ A;  5HCV A;  3AN3 A;  3HO0 A;  4P6W A;  1N83 A;  1ZDU A;  4J5W C;  4IUI A;  3GBK A;  5KRJ A;  2ZAS A;  3AN4 A;  2PIP L;  1DKF B;  2Q1V A;  1NUO A;  4A2J A;  1XP6 A;  3SP6 A;  1PQ9 A;  4OFR A;  4XHD A;  3VT5 A;  4J24 A;  2VV1 A;  4JL4 A;  4ZNW A;  3VJH A;  5E0W A;  5L7E A;  5KCD A;  1YIM A;  1SJ0 A;  5DUE A;  3BC5 A;  3DCT A;  4OJ9 A;  3MNE A;  3U9Q A;  2P7Z A;  2QGT A;  4OZT U;  2QSE A;  3LMP A;  3NSQ A;  3HLV A;  5DXP A;  1SQN A;  4K7A A;  3RUT A;  3VTD A;  4UDC A;  4ZN9 A;  3ZQT A;  5AAV A;  4G1Y A;  4ZI1 A;  3AZ1 A;  5HYR A;  3ADV A;  3P88 A;  5FQR A;  5FQT A;  4IA7 A;  3RLL A;  2NXX E;  5DYD A;  2Q5S A;  5DID A;  3E00 A;  5DZ0 A;  5K13 A;  3G9E A;  4IW6 A;  2QNV A;  2PIX A;  2AA2 A;  3OAP A;  2OVM A;  4MGB B;  5E15 A;  2ABI A;  3VI8 A;  5DKB A;  3F5C A;  5DVS A;  5G46 A;  3FLI A;  5E1C A;  3BQD A;  2Q7J A;  3W0G A;  1OSV A;  5E0X A;  3VT7 A;  3R8I A;  5H1E A;  2PIQ A;  1ZEO A;  4R6S A;  2G44 A;  2ACL A;  2XYW A;  1K7L A;  1TFC A;  4LBD A;  5GIC A;  3GD2 A;  5DI7 A;  2HWQ A;  3R8D A;  1XNX A;  1HG4 A;  5DVC A;  2Q59 A;  4PRG A;  5C4T A;  1T76 A;  5KCC A;  4MGD A;  3T03 A;  4L98 A;  5B5B A;  1Z5X E;  3CJW A;  4ZO1 X;  2GPO A;  3VHW A;  1S19 A;  3VTB A;  2OCF A;  3B0R A;  1L2J A;  4TV1 B;  1NQ2 A;  4QE8 A;  3HM1 A;  3VSP A;  1XLS A;  5DXG A;  3KFC A;  1DKF A;  2ZMI A;  4IA1 A;  2QA8 B;  3IPU A;  3ZRB A;  2J7Y A;  3WFF A;  1FCY A;  1N46 A;  2A3I A;  2NW4 A;  2OVH A;  1YIN A;  4LSJ A;  3MNP A;  2AB2 A;  4IV2 A;  3AZ3 A;  5DUG A;  3E94 A;  1K74 D;  3GYT A;  5DXR A;  5LWP A;  2HB7 A;  4QE6 A;  1GWR A;  1T79 A;  3A2I A;  2ZXM A;  3WFG A;  5AVL A;  3PCU A;  1T65 A;  4MDD A;  3AUQ A;  2HWR A;  2VV2 A;  3W5R A;  1OT7 A;  2GP7 A;  5DWL A;  5DVV A;  4YNK A;  3ADW A;  5G43 A;  4ITE A;  3GN8 A;  4N73 A;  4MGB A;  1YYE A;  1FCZ A;  1Z5X U;  3LBD A;  4X1G A;  4RUO X;  5AYG A;  1T73 A;  5C4U A;  4R06 A;  3OMM A;  5EJV A;  3R29 A;  3UP0 A;  4PPS A;  1YP0 A;  5AWK A;  3G8I A;  2AA6 A;  4JAZ A;  5EC9 A;  1Y9R A;  5CJ6 A;  3H52 A;  2NV7 A;  4ZOM A;  5ICK A;  4J5X A;  4EMA A;  1XDK B;  1S9Q A;  5E19 A;  3OS8 A;  3X1I A;  1FD0 A;  1NQ7 A;  4Q50 A;  1E3G A;  4OKW A;  4S15 A;  5DV6 A;  4G1D A;  2B50 A;  5AVI A;  4PP6 A;  1FM9 D;  2GTK A;  2Q60 A;  4IU7 A;  4LNW A;  3O1E A;  1XV9 B;  4QJR A;  2OAX A;  4TV1 A;  5DMF A;  3VHV A;  2HB8 A;  1XAP A;  1XQ3 A;  2ZNQ A;  4OGH A;  1MZN A;  5AWJ A;  2QR9 A;  3L0J A;  1KNU A;  1I37 A;  2I4P A;  2QA8 A;  2QTU A;  4OJB A;  5HZC A;  5KRC A;  3AX8 A;  3K8S A;  4F9M A;  2ZLC A;  4G1Z A;  5APK A;  4ZJW A;  5JJM B;  4IVW A;  3CQV A;  3PO9 A;  4G2H A;  4HLW A;  1XLS E;  1PRG A;  3VT6 A;  1XJ7 A;  5FQP A;  1R20 A;  3B66 A;  1ILG A;  1ZKY A;  1E3K A;  2AX8 A;  2ZLA A;  3ADT A;  3ADU A;  4P6X A;  4ZO1 B;  1N4H A;  1I7I A;  1YOK A;  3HQ5 A;  3IXP A;  3WMH A;  3D57 A;  1NYX A;  5DKS A;  1YUC A;  3CLD A;  3HZF A;  3WJ4 A;  4DMA A;  3R2A A;  3R5N A;  4OZT E;  3UUD B;  4OKB A;  3D6D A;  1PCG A;  2VV0 A;  3FAL B;  4RUJ A;  3V4A A;  1U9E A;  4J26 A;  5G45 A;  5SYZ A;  4IA3 A;  3VHU A;  4S14 A;  5DU5 A;  4PLE A;  4POH A;  1PK5 A;  1XPC A;  3KMR A;  1XDK A;  4ZNV A;  5G5W A;  1HJ1 A;  3ADS A;  1UPW A;  2Q5P A;  4ZNT A;  4IA2 A;  2HCD A;  1R6G A;  1RDT D;  2VV4 B;  3O1D A;  4XAO A;  3VT4 A;  1DB1 A;  1EXA A;  1G1U A;  2PKL A;  2OZ7 A;  1XV9 A;  2YFE A;  2R40 A;  2QXS A;  1I7G A;  1ZDT A;  2P54 A;  2PRG A;  5JY3 A;  2QZO B;  2P4Y A;  2G0H A;  3VSO A;  3AFR A;  4RMC A;  5JJM A;  5AK2 A;  2V7C A;  4Q0A C;  3UUA B;  4RME A;  4QL8 A;  1UOM A;  4FHI A;  4R2U A;  4WQP A;  4J5W A;  4OIV A;  3KPZ A;  3TKM A;  4MGA A;  4S0T A;  1A52 A;  3IA6 A;  2F4B A;  5E14 A;  3V3E A;  2YHD A;  1S0X A;  5L7G A;  2O9I A;  1XIU A;  1Y0X X;  2AMB A;  2AWH A;  4KZM A;  4M8H A;  5DKE A;  5KRA A;  4YPQ A;  1ERR A;  4DM8 A;  4IWF A;  4JYG A;  3OSW A;  4N8R A;  3DZU D;  1FCX A;  1U3Q A;  5DV3 A;  3UUD A;  4MGC A;  3WGP A;  1SR7 A;  4IVY A;  3VRT A;  3FAL A;  3IPQ A;  5KRF A;  3A40 X;  5KCT A;  1RK3 A;  2ZY0 A;  3KDU A;  5DZH A;  3L3X A;  5KCW A;  4DQM A;  4NY9 A;  1YJE A;  3A9E B;  3V3Q A;  4A4W A;  3FEJ A;  3KBA A;  4KZI A;  4IQR A;  4FNE A;  3GWS X;  4PF3 A;  2GPU A;  1I38 A;  3R5M A;  3V9T A;  4PPP A;  2QXM A;  5IAW A;  4PLD A;  3CDP A;  3X36 A;  4MG5 A;  4OZR U;  3DZY D;  3VTC A;  2R6W A;  1OVL B;  2VV4 A;  2QW4 A;  3HOD A;  2IOK A;  1S0Z A;  5F9B A;  2YLY A;  2P1T A;  3A2H A;  5DRJ A;  3CTB A;  4RWV A;  2POG A;  3P8X A;  4ZJR A;  3PLZ A;  4M8E A;  2QZO A;  2ATH A;  3KDT A;  3CS6 A;  1GWX A;  4RMD A;  5AZT A;  4POJ A;  4REF A;  1BSX A;  2G0G A;  4IWC A;  3L3Z A;  5FQS A;  2P1U A;  3UUA A;  3WJ5 A;  4CI4 A;  2W8Y A;  5A86 A;  3OLF A;  2Q6R A;  3IMY A;  2Q5G A;  1ILH A;  1X7B A;  1M7W A;  4OAR A;  5DZ3 A;  4DOR A;  4TUZ A;  2PIV A;  3DR1 A;  3SZ1 A;  4NQA B;  5DKG A;  3FUG A;  3GYU A;  4XTA A;  2ZNN A;  4ITF A;  3VJS A;  1FBY A;  1LV2 A;  1U3S A;  2ZMH A;  5ETH A;  4X1F A;  2OUZ A;  1Q4X A;  2HAR A;  3WT7 A;  2O4R A;  4XI3 A;  5C4S A;  1IE9 A;  4RZE A;  5KRL A;  2ZNP A;  2BAW A;  5DUH A;  1PDU A;  4FHH A;  4LTW A;  4Q13 A;  4DK7 A;  2G5O A;  1U3R A;  3D24 A;  5I4V A;  2QAB A;  5KCF A;  5AAU A;  5DXQ A;  5HJS A;  1IE8 A;  3WT6 A;  2H79 A;  2HVC A;  3A9E A;  3L03 A;  1NDE A;  4PWL A;  5DP0 A;  3NOA A;  1YY4 A;  3M7R A;  3UUC A;  4RZG A;  3RY9 A;  1QKN A;  4OKT A;  1K74 A;  4FGY A;  2EWP A;  1XNN A;  2XYJ A;  5GIE A;  2NPA A;  2Q8S A;  1OVL A;  2ZK1 A;  3N00 A;  2ZK0 A;  4N5G A;  5FQV A;  1FM6 D;  4A4V A;  2Z4B A;  3V49 A;  5DIE A;  2ZVT A;  4G21 A;  4J5X C;  1QKU A;  3ET1 A;  5DXK A;  3B1M A;  2AA5 A;  2ZK2 A;  3CS4 A;  3OS8 C;  4OEA A;  4UDA A;  5KRM A;  2YLQ A;  2ZKC A;  2YJA B;  3P89 A;  3OSI A;  4ZNH A;  5DWJ A;  4CI5 A;  3L1B A;  2Q3Y A;  2ZXZ A;  3OKH A;  4RFW A;  4YT1 A;  4WHG A;  2YLO A;  3KMG A;  4ONI A;  1PQ6 A;  2ZK5 A;  3CS8 A;  2ZNO A;  5IXK A;  1XP9 A;  2ZK6 A;  4MGA B;  1MVC A;  5M96 A;  4OHA A;  1T74 A;  3OSA A;  5DXE A;  1K4W A;  1KKQ A;  2JF9 A;  3PRG A;  5DTV A;  5KYJ A;  2PIW A;  4HEE X;  3H0A D;  3X31 A;  2AX9 A;  3VRW A;  3G0W A;  1XQC A;  3ZR7 A;  5JI0 D;  3TX7 B;  1Z95 A;  4K6I A;  3FXV A;  3W0J A;  1ZAF A;  2Q1H A;  3Q95 B;  1ZUC A;  3OMP A;  3VT9 A;  3WWR A;  5DRM A;  5EGV A;  4OLM A;  3GWX A;  2JFA B;  4DOS A;  3MNO A;  3A78 A;  2QA6 A;  3PBA A;  2AAX A;  1MV9 A;  2B1Z A;  2PIT A;  2NXX A;  2V0V A;  5KRK A;  3ERT A;  4OIL A;  1NQ0 A;  1YA3 A;  2AM9 A;  2AMA A;  1TXI A;  2I0G A;  2PIO A;  2PIU A;  4IW8 A;  4OJ4 A;  1R1K A;  2BJ4 B;  2ZXN A;  3FUR A;  2YLP A;  2HFP A;  4UDD A;  1NQ1 A;  3QT0 A;  5KYA A;  5DXB B;  5KD9 A;  1T7F A;  1VJB A;  1WM0 X;  1NRL A;  2O4J A;  1NAV A;  2REW A;  2JJ3 A;  3HVL A;  4PP5 A;  5DIG A;  5DWE A;  5GID A;  1PZL A;  5G44 A;  4WLB A;  4PXM A;  3D5F A;  3JZC A;  3VT8 A;  2Q6S A;  4OZR E;  4XLD A;  3W0I A;  3FS1 A;  3B5R A;  2QE4 A;  1L2I A;  4TUZ B;  3W0Y A;  3L0E A;  2GL8 A;  3OMK A;  4LNX A;  3NSP A;  3B0Q A;  1XOW A;  4NB6 A;  3K6P A;  3E00 D;  2P7G A;  5DYB A;  3F7D A;  4ZN7 A;  3W5Q A;  2J4A A;  1RDT A;  5DLR A;  3RVF A;  3Q95 A;  3UVV B;  1YOW A;  3B65 A;  3E7C A;  3A2J A;  3FC6 B;  4L96 A;  2QH6 A;  2ZK4 A;  2IHQ A;  4ZNS A;  5DMC A;  3R8A A;  3VRU A;  2JFA A;  2Q70 A;  2IOG A;  1X7J A;  3ILZ A;  3WTQ A;  5HYK A;  3K22 A;  3S9S A;  2FSZ A;  3GZ9 A;  2GPP A;  4NIE A;  4YMQ A;  4PVU A;  2XHS A;  4WVD A;  3UU7 B;  4MG8 B;  2POB A;  2Z4J A;  3A3Z X;  5KRO A;  1KV6 A;  3ET3 A;  4G2I A;  3B68 A;  2HBH A;  5DZ1 A;  2BJ4 A;  3W0H A;  1XVP B;  3DY6 A;  2I4Z A;  2AX7 A;  1ERE A;  1X7R A;  5DXB A;  3OOF A;  4JYI A;  1NAX A;  5EI1 A;  3JZB A;  2GPV A;  3VN2 A;  4BCR A;  2AYR A;  5KR9 A;  3K23 A;  3DZU A;  5DWG A;  3DT3 A;  2J7X A;  1XB7 A;  5L7H A;  3CWD A;  3KYT A;  4CSJ A;  3W0A A;  4JYH A;  2ZMJ A;  2B23 A;  1G50 A;  2H77 A;  4XUH A;  2P7A A;  5DZI A;  2AX6 A;  3EYB A;  2Q61 A;  1T63 A;  3FEI A;  4MG7 B;  3OZJ A;  2VST A;  5EHJ A;  4OK1 A;  2AO6 A;  4N1Y A;  4OH6 A;  5DXM A;  5DX3 B;  2Q7I A;  3DZY A;  1GWQ A;  1X7E A;  1X78 A;  4RAK A;  1T7R A;  5EIT A;  3ET2 A;  4IV4 A;  3AZ2 A;  3VJI A;  3OMO A;  4DM6 A;  3UVV A;  2HAS A;  4Y29 A;  5DWI A;  5DK9 A;  3B67 A;  1RJK A;  2Q6J A;  2B1V A;  4RUP A;  3FC6 A;  5B41 A;  2QPY A;  3KWY A;  2P1V A; 
#chains in the Genus database with same CATH homology
 3OLL A;  4ZNU A;  3TY0 A;  2I4J A;  1Y0S A;  2YJD A;  5ACC A;  2QGW A;  3UU7 A;  5KRI A;  4MG6 A;  4MG8 A;  4OKX A;  4E4Q A;  1T7M A;  2OM9 A;  3G8O A;  5HJP B;  1UHL B;  5APJ A;  3AUN A;  5KRH A;  1ZGY A;  2ZK3 A;  1XVP A;  1M13 A;  1XP1 A;  3P0U A;  3X1H A;  4DK8 A;  4O8F A;  5C4O A;  1GS4 A;  1T5Z A;  3HC6 A;  2R6Y A;  4OEY A;  4WPF A;  4KZJ A;  4FN9 A;  3D90 A;  5LGA A;  1QKM A;  4XT9 A;  1SKX A;  5IZ0 A;  3UP3 A;  2LBD A;  3KMZ A;  3RUU A;  3VT3 A;  1QKT A;  2XYX A;  4OED A;  4UDB A;  2FVJ A;  4OH5 A;  3L0L A;  3OOK A;  5L11 A;  4REE A;  5G3J A;  1ZH7 A;  3RLJ A;  1R20 D;  2J14 A;  5AZV A;  2ZL9 A;  4MG9 B;  4E2J A;  2E2R A;  2VV3 A;  3ERD A;  2HC4 A;  2Q7K A;  5APH A;  3VRV A;  3W5T A;  2ZFX A;  3HC5 A;  4QM0 A;  3ADX A;  1P93 A;  4XUM A;  1G5Y A;  4MG7 A;  3IXP D;  5DSH A;  2PIN A;  2GWX A;  3DCU A;  1OSH A;  3B0T A;  4QK4 A;  4OFU A;  5DX3 A;  1X76 A;  2PJL A;  3WT5 A;  2HAM A;  3IPS A;  4PP3 A;  1FM6 A;  1FM9 A;  1M2Z A;  3VJT A;  3OLS A;  4B7W A;  2AXA A;  2VV1 B;  2I0J A;  3BEJ A;  3W0C A;  4OEZ A;  2PNU A;  1S9P A;  3CDS A;  5DL4 A;  4WHF A;  4RE8 A;  2XKW A;  1UPV A;  1NHZ A;  3V9Y A;  4E4K A;  4RZF A;  5DV8 A;  2P15 A;  5KCU A;  1XZX X;  3OKI A;  1LBD A;  4OC7 A;  1R1K D;  5AAV B;  5E7V A;  4IS8 A;  1P8D A;  5HJP A;  1RKG A;  3ET0 A;  5GT4 A;  1UHL A;  3SP9 A;  1G2N A;  2R40 D;  5DY8 A;  3H0A A;  4EM9 A;  3AUR A;  4JGV A;  3OMQ A;  1RKH A;  5KCE A;  1YMT A;  2YAT A;  4K4J A;  3B0W A;  3ZRA A;  1H9U A;  1EXX A;  2ZBS A;  2VSR A;  1R5K A;  3F5C B;  4NUF A;  1T7T A;  4OIU A;  4S0S A;  3OZ0 A;  5G42 A;  2AA7 A;  3V9V A;  2GIU A;  2ACL B;  3B3K A;  3OGT A;  4MG9 A;  1PQC A;  3W5P A;  4G20 A;  2Q7L A;  2QMV A;  4APU A;  2Q59 B;  1A28 A;  2PIR A;  3OS9 A;  4MGD B;  2FAI A;  3TKC A;  3PEQ A;  5HCV A;  3AN3 A;  3HO0 A;  4P6W A;  1N83 A;  1ZDU A;  4J5W C;  4IUI A;  3GBK A;  5KRJ A;  2ZAS A;  3AN4 A;  2PIP L;  1DKF B;  2Q1V A;  1NUO A;  4A2J A;  1XP6 A;  3SP6 A;  1PQ9 A;  4OFR A;  4XHD A;  3VT5 A;  4J24 A;  2VV1 A;  4JL4 A;  4ZNW A;  3VJH A;  5E0W A;  5L7E A;  5KCD A;  1YIM A;  1SJ0 A;  5DUE A;  3BC5 A;  3DCT A;  4OJ9 A;  3MNE A;  3U9Q A;  2P7Z A;  2QGT A;  4OZT U;  2QSE A;  3LMP A;  3NSQ A;  3HLV A;  5DXP A;  1SQN A;  4K7A A;  3RUT A;  3VTD A;  4UDC A;  4ZN9 A;  3ZQT A;  5AAV A;  4G1Y A;  4ZI1 A;  3AZ1 A;  5HYR A;  3ADV A;  3P88 A;  5FQR A;  5FQT A;  4IA7 A;  3RLL A;  2NXX E;  5DYD A;  2Q5S A;  5DID A;  3E00 A;  5DZ0 A;  5K13 A;  3G9E A;  4IW6 A;  2QNV A;  2PIX A;  2AA2 A;  3OAP A;  2OVM A;  4MGB B;  5E15 A;  2ABI A;  3VI8 A;  5DKB A;  3F5C A;  5DVS A;  5G46 A;  3FLI A;  5E1C A;  3BQD A;  2Q7J A;  3W0G A;  1OSV A;  5E0X A;  3VT7 A;  3R8I A;  5H1E A;  2PIQ A;  1ZEO A;  4R6S A;  2G44 A;  2ACL A;  2XYW A;  1K7L A;  1TFC A;  4LBD A;  5GIC A;  3GD2 A;  5DI7 A;  2HWQ A;  3R8D A;  1XNX A;  1HG4 A;  5DVC A;  2Q59 A;  4PRG A;  5C4T A;  1T76 A;  5KCC A;  4MGD A;  3T03 A;  4L98 A;  5B5B A;  1Z5X E;  3CJW A;  4ZO1 X;  2GPO A;  3VHW A;  1S19 A;  3VTB A;  2OCF A;  3B0R A;  1L2J A;  4TV1 B;  1NQ2 A;  4QE8 A;  3HM1 A;  3VSP A;  1XLS A;  5DXG A;  3KFC A;  1DKF A;  2ZMI A;  4IA1 A;  2QA8 B;  3IPU A;  3ZRB A;  2J7Y A;  3WFF A;  1FCY A;  1N46 A;  2A3I A;  2NW4 A;  2OVH A;  1YIN A;  4LSJ A;  3MNP A;  2AB2 A;  4IV2 A;  3AZ3 A;  5DUG A;  3E94 A;  1K74 D;  3GYT A;  5DXR A;  5LWP A;  2HB7 A;  4QE6 A;  1GWR A;  1T79 A;  3A2I A;  2ZXM A;  3WFG A;  5AVL A;  3PCU A;  1T65 A;  4MDD A;  3AUQ A;  2HWR A;  2VV2 A;  3W5R A;  1OT7 A;  2GP7 A;  5DWL A;  5DVV A;  4YNK A;  3ADW A;  5G43 A;  4ITE A;  3GN8 A;  4N73 A;  4MGB A;  1YYE A;  1FCZ A;  1Z5X U;  3LBD A;  4X1G A;  4RUO X;  5AYG A;  1T73 A;  5C4U A;  4R06 A;  3OMM A;  5EJV A;  3R29 A;  3UP0 A;  4PPS A;  1YP0 A;  5AWK A;  3G8I A;  2AA6 A;  4JAZ A;  5EC9 A;  1Y9R A;  5CJ6 A;  3H52 A;  2NV7 A;  4ZOM A;  5ICK A;  4J5X A;  4EMA A;  1XDK B;  1S9Q A;  5E19 A;  3OS8 A;  3X1I A;  1FD0 A;  1NQ7 A;  4Q50 A;  1E3G A;  4OKW A;  4S15 A;  5DV6 A;  4G1D A;  2B50 A;  5AVI A;  4PP6 A;  1FM9 D;  2GTK A;  2Q60 A;  4IU7 A;  4LNW A;  3O1E A;  1XV9 B;  4QJR A;  2OAX A;  4TV1 A;  5DMF A;  3VHV A;  2HB8 A;  1XAP A;  1XQ3 A;  2ZNQ A;  4OGH A;  1MZN A;  5AWJ A;  2QR9 A;  3L0J A;  1KNU A;  1I37 A;  2I4P A;  2QA8 A;  2QTU A;  4OJB A;  5HZC A;  5KRC A;  3AX8 A;  3K8S A;  4F9M A;  2ZLC A;  4G1Z A;  5APK A;  4ZJW A;  5JJM B;  4IVW A;  3CQV A;  3PO9 A;  4G2H A;  4HLW A;  1XLS E;  1PRG A;  3VT6 A;  1XJ7 A;  5FQP A;  1R20 A;  3B66 A;  1ILG A;  1ZKY A;  1E3K A;  2AX8 A;  2ZLA A;  3ADT A;  3ADU A;  4P6X A;  4ZO1 B;  1N4H A;  1I7I A;  1YOK A;  3HQ5 A;  3IXP A;  3WMH A;  3D57 A;  1NYX A;  5DKS A;  1YUC A;  3CLD A;  3HZF A;  3WJ4 A;  4DMA A;  3R2A A;  3R5N A;  4OZT E;  3UUD B;  4OKB A;  3D6D A;  1PCG A;  2VV0 A;  3FAL B;  4RUJ A;  3V4A A;  1U9E A;  4J26 A;  5G45 A;  5SYZ A;  4IA3 A;  3VHU A;  4S14 A;  5DU5 A;  4PLE A;  4POH A;  1PK5 A;  1XPC A;  3KMR A;  1XDK A;  4ZNV A;  5G5W A;  1HJ1 A;  3ADS A;  1UPW A;  2Q5P A;  4ZNT A;  4IA2 A;  2HCD A;  1R6G A;  1RDT D;  2VV4 B;  3O1D A;  4XAO A;  3VT4 A;  1DB1 A;  1EXA A;  1G1U A;  2PKL A;  2OZ7 A;  1XV9 A;  2YFE A;  2R40 A;  2QXS A;  1I7G A;  1ZDT A;  2P54 A;  2PRG A;  5JY3 A;  2QZO B;  2P4Y A;  2G0H A;  3VSO A;  3AFR A;  4RMC A;  5JJM A;  5AK2 A;  2V7C A;  4Q0A C;  3UUA B;  4RME A;  4QL8 A;  1UOM A;  4FHI A;  4R2U A;  4WQP A;  4J5W A;  4OIV A;  3KPZ A;  3TKM A;  4MGA A;  4S0T A;  1A52 A;  3IA6 A;  2F4B A;  5E14 A;  3V3E A;  2YHD A;  1S0X A;  5L7G A;  2O9I A;  1XIU A;  1Y0X X;  2AMB A;  2AWH A;  4KZM A;  4M8H A;  5DKE A;  5KRA A;  4YPQ A;  1ERR A;  4DM8 A;  4IWF A;  4JYG A;  3OSW A;  4N8R A;  3DZU D;  1FCX A;  1U3Q A;  5DV3 A;  3UUD A;  4MGC A;  3WGP A;  1SR7 A;  4IVY A;  3VRT A;  3FAL A;  3IPQ A;  5KRF A;  3A40 X;  5KCT A;  1RK3 A;  2ZY0 A;  3KDU A;  5DZH A;  3L3X A;  5KCW A;  4DQM A;  4NY9 A;  1YJE A;  3A9E B;  3V3Q A;  4A4W A;  3FEJ A;  3KBA A;  4KZI A;  4IQR A;  4FNE A;  3GWS X;  4PF3 A;  2GPU A;  1I38 A;  3R5M A;  3V9T A;  4PPP A;  2QXM A;  5IAW A;  4PLD A;  3CDP A;  3X36 A;  4MG5 A;  4OZR U;  3DZY D;  3VTC A;  2R6W A;  1OVL B;  2VV4 A;  2QW4 A;  3HOD A;  2IOK A;  1S0Z A;  5F9B A;  2YLY A;  2P1T A;  3A2H A;  5DRJ A;  3CTB A;  4RWV A;  2POG A;  3P8X A;  4ZJR A;  3PLZ A;  4M8E A;  2QZO A;  2ATH A;  3KDT A;  3CS6 A;  1GWX A;  4RMD A;  5AZT A;  4POJ A;  4REF A;  1BSX A;  2G0G A;  4IWC A;  3L3Z A;  5FQS A;  2P1U A;  3UUA A;  3WJ5 A;  4CI4 A;  2W8Y A;  5A86 A;  3OLF A;  2Q6R A;  3IMY A;  2Q5G A;  1ILH A;  1X7B A;  1M7W A;  4OAR A;  5DZ3 A;  4DOR A;  4TUZ A;  2PIV A;  3DR1 A;  3SZ1 A;  4NQA B;  5DKG A;  3FUG A;  3GYU A;  4XTA A;  2ZNN A;  4ITF A;  3VJS A;  1FBY A;  1LV2 A;  1U3S A;  2ZMH A;  5ETH A;  4X1F A;  2OUZ A;  1Q4X A;  2HAR A;  3WT7 A;  2O4R A;  4XI3 A;  5C4S A;  1IE9 A;  4RZE A;  5KRL A;  2ZNP A;  2BAW A;  5DUH A;  1PDU A;  4FHH A;  4LTW A;  4Q13 A;  4DK7 A;  2G5O A;  1U3R A;  3D24 A;  5I4V A;  2QAB A;  5KCF A;  5AAU A;  5DXQ A;  5HJS A;  1IE8 A;  3WT6 A;  2H79 A;  2HVC A;  3A9E A;  3L03 A;  1NDE A;  4PWL A;  5DP0 A;  3NOA A;  1YY4 A;  3M7R A;  3UUC A;  4RZG A;  3RY9 A;  1QKN A;  4OKT A;  1K74 A;  4FGY A;  2EWP A;  1XNN A;  2XYJ A;  5GIE A;  2NPA A;  2Q8S A;  1OVL A;  2ZK1 A;  3N00 A;  2ZK0 A;  4N5G A;  5FQV A;  1FM6 D;  4A4V A;  2Z4B A;  3V49 A;  5DIE A;  2ZVT A;  4G21 A;  4J5X C;  1QKU A;  3ET1 A;  5DXK A;  3B1M A;  2AA5 A;  2ZK2 A;  3CS4 A;  3OS8 C;  4OEA A;  4UDA A;  5KRM A;  2YLQ A;  2ZKC A;  2YJA B;  3P89 A;  3OSI A;  4ZNH A;  5DWJ A;  4CI5 A;  3L1B A;  2Q3Y A;  2ZXZ A;  3OKH A;  4RFW A;  4YT1 A;  4WHG A;  2YLO A;  3KMG A;  4ONI A;  1PQ6 A;  2ZK5 A;  3CS8 A;  2ZNO A;  5IXK A;  1XP9 A;  2ZK6 A;  4MGA B;  1MVC A;  5M96 A;  4OHA A;  1T74 A;  3OSA A;  5DXE A;  1K4W A;  1KKQ A;  2JF9 A;  3PRG A;  5DTV A;  5KYJ A;  2PIW A;  4HEE X;  3H0A D;  3X31 A;  2AX9 A;  3VRW A;  3G0W A;  1XQC A;  3ZR7 A;  5JI0 D;  3TX7 B;  1Z95 A;  4K6I A;  3FXV A;  3W0J A;  1ZAF A;  2Q1H A;  3Q95 B;  1ZUC A;  3OMP A;  3VT9 A;  3WWR A;  5DRM A;  5EGV A;  4OLM A;  3GWX A;  2JFA B;  4DOS A;  3MNO A;  3A78 A;  2QA6 A;  3PBA A;  2AAX A;  1MV9 A;  2B1Z A;  2PIT A;  2NXX A;  2V0V A;  5KRK A;  3ERT A;  4OIL A;  1NQ0 A;  1YA3 A;  2AM9 A;  2AMA A;  1TXI A;  2I0G A;  2PIO A;  2PIU A;  4IW8 A;  4OJ4 A;  1R1K A;  2BJ4 B;  2ZXN A;  3FUR A;  2YLP A;  2HFP A;  4UDD A;  1NQ1 A;  3QT0 A;  5KYA A;  5DXB B;  5KD9 A;  1T7F A;  1VJB A;  1WM0 X;  1NRL A;  2O4J A;  1NAV A;  2REW A;  2JJ3 A;  3HVL A;  4PP5 A;  5DIG A;  5DWE A;  5GID A;  1PZL A;  5G44 A;  4WLB A;  4PXM A;  3D5F A;  3JZC A;  3VT8 A;  2Q6S A;  4OZR E;  4XLD A;  3W0I A;  3FS1 A;  3B5R A;  2QE4 A;  1L2I A;  4TUZ B;  3W0Y A;  3L0E A;  2GL8 A;  3OMK A;  4LNX A;  3NSP A;  3B0Q A;  1XOW A;  4NB6 A;  3K6P A;  3E00 D;  2P7G A;  5DYB A;  3F7D A;  4ZN7 A;  3W5Q A;  2J4A A;  1RDT A;  5DLR A;  3RVF A;  3Q95 A;  3UVV B;  1YOW A;  3B65 A;  3E7C A;  3A2J A;  3FC6 B;  4L96 A;  2QH6 A;  2ZK4 A;  2IHQ A;  4ZNS A;  5DMC A;  3R8A A;  3VRU A;  2JFA A;  2Q70 A;  2IOG A;  1X7J A;  3ILZ A;  3WTQ A;  5HYK A;  3K22 A;  3S9S A;  2FSZ A;  3GZ9 A;  2GPP A;  4NIE A;  4YMQ A;  4PVU A;  2XHS A;  4WVD A;  3UU7 B;  4MG8 B;  2POB A;  2Z4J A;  3A3Z X;  5KRO A;  1KV6 A;  3ET3 A;  4G2I A;  3B68 A;  2HBH A;  5DZ1 A;  2BJ4 A;  3W0H A;  1XVP B;  3DY6 A;  2I4Z A;  2AX7 A;  1ERE A;  1X7R A;  5DXB A;  3OOF A;  4JYI A;  1NAX A;  5EI1 A;  3JZB A;  2GPV A;  3VN2 A;  4BCR A;  2AYR A;  5KR9 A;  3K23 A;  3DZU A;  5DWG A;  3DT3 A;  2J7X A;  1XB7 A;  5L7H A;  3CWD A;  3KYT A;  4CSJ A;  3W0A A;  4JYH A;  2ZMJ A;  2B23 A;  1G50 A;  2H77 A;  4XUH A;  2P7A A;  5DZI A;  2AX6 A;  3EYB A;  2Q61 A;  1T63 A;  3FEI A;  4MG7 B;  3OZJ A;  2VST A;  5EHJ A;  4OK1 A;  2AO6 A;  4N1Y A;  4OH6 A;  5DXM A;  5DX3 B;  2Q7I A;  3DZY A;  1GWQ A;  1X7E A;  1X78 A;  4RAK A;  1T7R A;  5EIT A;  3ET2 A;  4IV4 A;  3AZ2 A;  3VJI A;  3OMO A;  4DM6 A;  3UVV A;  2HAS A;  4Y29 A;  5DWI A;  5DK9 A;  3B67 A;  1RJK A;  2Q6J A;  2B1V A;  4RUP A;  3FC6 A;  5B41 A;  2QPY A;  3KWY A;  2P1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...