3DCUA

Fxr with src1 and gsk8062
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
229
structure length
229
Chain Sequence
ELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformationally constrained farnesoid X receptor (FXR) agonists: Naphthoic acid-based analogs of GW 4064.
pubmed doi rcsb
molecule keywords Bile acid receptor
molecule tags Transcription/transcription activator
source organism Homo sapiens
total genus 86
structure length 229
sequence length 229
ec nomenclature
pdb deposition date 2008-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3dcuA00
1P93A 3CS8A 3VT3A 1XNXA 3FALA 4OZRU 2QNVA 3B3KA 3WMHA 5KCCA 2VV3A 1M13A 3GZ9A 1XPCA 3OOKA 3KMRA 4A4VA 2QZOA 1G50A 2J7YA 4K6IA 2HWRA 3AUQA 2P7GA 3OZ0A 3VTCA 2GTKA 4IVYA 4RWVA 3L0EA 2Q7LA 3Q95B 5DSHA 3TKCA 2YJDA 1FM6D 3V4AA 2QPYA 4LNWA 2HARA 3A2JA 4WLBA 2IOKA 3R2AA 3B66A 3GN8A 3OLSA 3X1IA 3HQ5A 3OMOA 1T5ZA 5KD9A 1RKGA 5AAUA 1X7EA 2NXXA 2ZK4A 4WVDA 2Q7KA 2HASA 4OK1A 5E1CA 1UHLA 2Q5GA 1T65A 2AA5A 2ATHA 3TX7B 3W5RA 3OS8C 1N46A 1ILGA 1XAPA 1A28A 5DXEA 3ADXA 5E0XA 4ZNSA 4RFWA 5EHJA 2YATA 3U9QA 3G8IA 5DKGA 1Y9RA 5C4TA 4XUHA 2ZXMA 4IS8A 4N73A 4MG9B 5DUHA 3KPZA 3G9EA 4ZNWA 2ZK2A 1NRLA 4OKXA 4S15A 4DQMA 1VJBA 4NB6A 1T73A 4RZFA 5DIEA 3OMMA 2R6YA 3ZQTA 1FD0A 2QGWA 4JYHA 4BCRA 1GWQA 1DKFA 3UUAB 4R2UA 3HODA 2J4AA 4OFRA 2Q6RA 3MNEA 2YJAB 1RJKA 3ILZA 3B0WA 3SP6A 2ZNPA 3GYTA 5E14A 2YLPA 2QXMA 2H77A 2VV4B 2NPAA 2ZL9A 3AX8A 3PCUA 4HEEX 2GL8A 2ZK3A 3VSPA 5GIDA 3DZUA 3SZ1A 1PQCA 3E00D 3NOAA 1XVPA 5F9BA 5DXRA 4ZN9A 5DV6A 1T7TA 3V3EA 1U3RA 4TUZB 2R40A 2AAXA 3OKHA 3OMKA 5DZIA 5AZTA 5IAWA 5DV3A 2AMAA 3A2HA 4RE8A 3VHUA 1EXXA 3AN3A 3NSQA 1R1KD 4FN9A 4IA7A 5KRJA 1KKQA 5DYBA 1NQ7A 2QABA 3DY6A 1I38A 4S14A 5IXKA 4MGBB 4POHA 1Y0SA 2OM9A 3L3XA 3D90A 1YMTA 3KWYA 3OKIA 3UU7A 2PIUA 4PXMA 3UUDB 1SQNA 2GPPA 2ZK0A 3CS6A 4PLDA 5JJMA 4J5XC 3AZ2A 3QT0A 3OSAA 3VT4A 4OEDA 3KMGA 2PIPL 1YOKA 1MV9A 1UPWA 1Y0XX 1ZUCA 2HB8A 3AZ1A 4OEAA 5HCVA 5KYAA 5SYZA 1PRGA 3UVVB 2VV4A 2PNUA 3HC6A 3O1DA 3K23A 3P89A 4IUIA 3P88A 4RMDA 2PIVA 1Z95A 2QGTA 5AWKA 3WFGA 1NUOA 3PRGA 5FQPA 4QE6A 2OCFA 1X7RA 5DXBB 1EXAA 1I37A 4UDAA 4S0TA 3DZYA 1UPVA 3OOFA 4QL8A 5HYKA 3B1MA 1RK3A 4ITEA 3NSPA 2YHDA 3RUTA 1XDKB 2XYJA 3IA6A 5DU5A 3V9VA 2ZASA 2P54A 5DWEA 2PIRA 3OS8A 2IHQA 5DWJA 1G2NA 3IXPA 4MGAB 3RLLA 2AMBA 1K74A 4A4WA 3W0AA 4OC7A 1L2IA 1YIMA 2QA8A 3FLIA 3H52A 2AM9A 3L03A 4IV2A 1PZLA 2Q7IA 4PF3A 5KCFA 4E2JA 3PLZA 4J5WC 5HJSA 4MG7A 5C4SA 3WFFA 5AAVB 3OZJA 4J24A 1GS4A 2GWXA 2V0VA 2ZNNA 2V7CA 3GBKA 1PQ6A 2P4YA 3E7CA 4ZN7A 2O9IA 5EI1A 5DZ1A 3A78A 1UOMA 1FM9A 2ZK1A 1FCXA 3VHWA 2Q6JA 3VRWA 4DOSA 4E4QA 1QKNA 2J7XA 1T63A 1ZAFA 4OILA 5GT4A 2O4JA 5KYJA 5DKSA 1X7JA 1XOWA 4YT1A 5L7EA 4IU7A 4WHGA 4PPPA 4OARA 1HJ1A 1XDKA 4LSJA 4X1FA 5DUEA 3DZUD 2ZFXA 2AB2A 1XQ3A 5DXKA 1ERRA 4PP6A 3OMQA 3KFCA 3SP9A 4OEZA 2R40D 3VT7A 4NIEA 2B1VA 4K4JA 3VTBA 3WTQA 2PIXA 5HZCA 2E2RA 4NQAB 1Z5XE 5E19A 2G44A 5DX3A 2A3IA 1X78A 4RMEA 5DV8A 5G43A 3W0GA 3A9EB 3F5CA 2GPVA 4UDDA 2POGA 3OLFA 1G5YA 2YLYA 3AUNA 2JJ3A 3FC6A 4Q0AC 2P7AA 3R5NA 5KRIA 1XJ7A 2VV2A 2Z4JA 4IA3A 5CJ6A 4OKTA 2AX9A 2QTUA 1T74A 4JYGA 4OHAA 2Q59B 3VT8A 4M8HA 4J5XA 1OVLA 3W0YA 1MVCA 1G1UA 2B50A 4R06A 1NDEA 1E3GA 1SKXA 4EMAA 1M7WA 3JZBA 3V3QA 4HLWA 3OLLA 3UP3A 1S9PA 4MGCA 2XYWA 3ET2A 4J26A 2PITA 3RLJA 1E3KA 1YJEA 2F4BA 1KNUA 2Q1VA 1YOWA 3B68A 3B5RA 4DORA 5DVCA 2P1VA 1ZDUA 2HBHA 4REFA 4DM6A 2LBDA 4G21A 3W0HA 3DZYD 1XP1A 5ICKA 5AVIA 3OSWA 1QKUA 3B0QA 2P7ZA 3VSOA 3Q95A 2JFAB 2QMVA 2I4JA 3AZ3A 4P6XA 2R6WA 4OJ4A 5DKEA 5ETHA 3VRUA 3IXPD 2EWPA 1TFCA 2PIQA 3OGTA 2ACLB 2P1UA 4MDDA 4G1YA 4OLMA 1K74D 3P8XA 5DZHA 3OMPA 5KR9A 2FAIA 5DY8A 3HZFA 4MGDB 2ZBSA 4XI3A 1YA3A 4J5WA 4IW6A 3VTDA 5FQTA 4OIUA 2VV1B 4OJ9A 3RY9A 3W5TA 3AURA 2QR9A 5JI0D 2IOGA 1YY4A 4IQRA 1U9EA 2AX6A 1LBDA 3GYUA 2AX8A 5KCWA 1FM9D 1ZDTA 2BJ4B 2YLOA 3AN4A 3D24A 3KMZA 4MG9A 4N5GA 3R5MA 5DXPA 3B0TA 4ONIA 4Q13A 5HJPB 3VHVA 5DZ0A 2AO6A 4KZMA 2Q5PA 5DYDA 3CLDA 5A86A 4ITFA 4IA1A 4RUOX 3WGPA 5L11A 4PVUA 2JFAA 2QSEA 4IWFA 4WPFA 1NHZA 3UUAA 4UDCA 5DL4A 2XYXA 5DVVA 3ZRAA 2I4ZA 4XTAA 4YNKA 2FSZA 1Z5XU 5FQSA 1M2ZA 3O1EA 3BC5A 3ADWA 2P15A 4OKBA 2HAMA 3S9SA 1XV9B 1BSXA 3IPQA 1OSHA 4OH5A 4IA2A 4TUZA 3D5FA 3M7RA 1PK5A 5LGAA 2OUZA 1NQ0A 3PBAA 2G0GA 2PIOA 1TXIA 3F7DA 5B41A 2ZXZA 4DK7A 2OVMA 3H0AA 1YYEA 4A2JA 5KCTA 1XP9A 4IWCA 4MG8B 4MGBA 5L7HA 3V9TA 2QA6A 4LBDA 5C4OA 3FEJA 3HVLA 1IE8A 3MNOA 3CDSA 2I0JA 3W0JA 3L0LA 3UUDA 2G0HA 1I7GA 2ZMHA 3OAPA 1NAVA 4FGYA 3UP0A 4OH6A 2Q3YA 1ZKYA 4TV1B 3GWSX 5LWPA 1R6GA 4NY9A 5APKA 1XLSE 2HFPA 2ZK5A 5KRFA 4L96A 3JZCA 5DTVA 1RDTA 5FQVA 3WT5A 2Q5SA 3FEIA 3R8DA 3PO9A 5DXGA 2ZK6A 1I7IA 2B1ZA 1L2JA 2OAXA 4N8RA 2O4RA 3LMPA 4KZJA 5DP0A 4DMAA 1NQ1A 4RZGA 3W5QA 5IZ0A 4L98A 5DXBA 5FQRA 3IMYA 3D6DA 3B0RA 3FALB 4QM0A 3KDUA 5DMFA 2GPUA 1X76A 1IE9A 2QZOB 2AA7A 3X31A 4CSJA 1GWRA 2ZLCA 5DWIA 1NAXA 4O8FA 1WM0X 1ZH7A 3ET1A 4ZNUA 4YPQA 1N4HA 4RZEA 2ZVTA 1GWXA 2Q61A 4MGAA 2PKLA 4ZNHA 3X1HA 3VT6A 5KRCA 3ET0A 3DCUA 1XNNA 3FUGA 4TV1A 5JY3A 4G2HA 3CJWA 2AX7A 1S9QA 4N1YA 3VI8A 2QXSA 2AWHA 1UHLB 2FVJA 3D57A 5APJA 3WJ4A 5AAVA 2Q7JA 4Y29A 5E7VA 4WHFA 2NXXE 2I4PA 2POBA 2QE4A 3CQVA 3KBAA 4ZOMA 5EC9A 3RVFA 5DXMA 3R8IA 1YINA 1XIUA 4MG5A 4ZO1X 3X36A 3W5PA 4OGHA 4ZI1A 4MG6A 4RMCA 3TKMA 2ABIA 4OJBA 5KRHA 2YFEA 2Q60A 3LBDA 3V49A 3N00A 1SR7A 2ZLAA 3G0WA 4F9MA 1EREA 1FBYA 3VT5A 3GD2A 1NQ2A 5EJVA 1XZXX 4PPSA 3WT7A 3L1BA 3ERTA 2H79A 3ADUA 3A3ZX 1Q4XA 5AWJA 1DKFB 5GICA 2P1TA 3ET3A 3V9YA 4G1ZA 1T7RA 4OFUA 3FURA 1R20A 5KRAA 3GWXA 2XHSA 1S0ZA 5GIEA 2PINA 5DK9A 3A2IA 4YMQA 1XB7A 1N83A 3A9EA 3K8SA 4CI4A 3H0AD 3VRVA 3ZRBA 5I4VA 2HC4A 5KRMA 5G5WA 1XVPB 1T79A 3OSIA 2AA6A 2Q70A 4QJRA 4RUJA 5C4UA 3OS9A 5M96A 2Q59A 4G1DA 5DMCA 5H1EA 3VJTA 3UUCA 2GIUA 5DWGA 1RKHA 2ZXNA 5E15A 4CI5A 4WQPA 4IVWA 5DIGA 1ZGYA 3PEQA 1FCZA 3BQDA 5DUGA 5EGVA 5KCEA 4KZIA 4M8EA 1RDTD 4OZTE 1OT7A 4REEA 3HM1A 3AFRA 5K13A 3UU7B 2OVHA 4FHHA 2ZNQA 3ERDA 5DI7A 3VT9A 5JJMB 4RAKA 5KCUA 3ADVA 5KRLA 3R8AA 5G46A 4RUPA 1HG4A 4EM9A 3VRTA 4PLEA 5EITA 5AVLA 1X7BA 4Q50A 4FNEA 3W0IA 4PP3A 4XUMA 3L3ZA 3VJIA 5DIDA 1QKTA 1T7FA 5ACCA 1XP6A 4OZRE 4XHDA 4PP5A 2ACLA 2HWQA 5G3JA 4ZJRA 4K7AA 3CTBA 3VJHA 4OEYA 4PWLA 4B7WA 5KCDA 4MGDA 3WT6A 2VSRA 2GPOA 1QKMA 2W8YA 1FM6A 5B5BA 3DCTA 2VV1A 3ZR7A 3P0UA 2B23A 3VJSA 2Q1HA 5DRJA 1XQCA 4IV4A 1K4WA 5DKBA 4JL4A 5KROA 2BAWA 1PDUA 2BJ4A 2QA8B 1H9UA 1MZNA 3UVVA 2NV7A 1U3QA 4JYIA 4ZJWA 5HJPA 3DT3A 5G45A 4APUA 4MG7B 1SJ0A 4PRGA 2ZMJA 5HYRA 4POJA 4P6WA 1R5KA 3B67A 4OIVA 5DWLA 2GP7A 4IW8A 1U3SA 5DXQA 3K22A 5DZ3A 2ZMIA 1K7LA 1PCGA 3VN2A 1P8DA 3E94A 4QE8A 2REWA 4ZO1B 5L7GA 3BEJA 2QW4A 2OZ7A 2ZNOA 2HB7A 1R20D 2Q8SA 4ZNTA 2J14A 2VV0A 3T03A 2PJLA 3L0JA 4LTWA 5DLRA 4NUFA 2PRGA 2AYRA 2ZKCA 1XV9A 3G8OA 5AZVA 5DRMA 1FCYA 2ZY0A 4OKWA 2Z4BA 1PQ9A 4DM8A 4XAOA 3FXVA 1NYXA 3R29A 1T7MA 1ILHA 4JAZA 5G42A 1YP0A 4JGVA 2HCDA 2QH6A 4UDBA 2I0GA 3KYTA 5AYGA 3W0CA 3CS4A 5DX3B 3WJ5A 3HLVA 3IPUA 3MNPA 4MG8A 1S0XA 2JF9A 3F5CB 3HO0A 3E00A 3FC6B 3FS1A 1ZEOA 2VSTA 3K6PA 4G2IA 4OZTU 4S0SA 1XLSA 3CWDA 1OSVA 1S19A 1T76A 3IPSA 4XT9A 2NW4A 2HVCA 1R1KA 3RUUA 3B65A 2Q6SA 4G20A 1OVLB 5KRKA 5APHA 4QK4A 1KV6A 2AXAA 1DB1A 3ADSA 2PIWA 2XKWA 5DVSA 3CDPA 1A52A 1LV2A 1YUCA 4E4KA 4XLDA 3HC5A 4ZNVA 5AK2A 3TY0A 2AA2A 4FHIA 3EYBA 3KDTA 5G44A 5E0WA 4X1GA 2YLQA 3A40X 3ADTA 2G5OA 3DR1A 4DK8A 4LNXA 3WWRA 4R6SA
chains in the Genus database with same CATH superfamily
1P93A 3CS8A 3VT3A 1XNXA 3FALA 4OZRU 2QNVA 3B3KA 3WMHA 5KCCA 2VV3A 1M13A 3GZ9A 1XPCA 3OOKA 3KMRA 4A4VA 2QZOA 1G50A 2J7YA 4K6IA 2HWRA 3AUQA 2P7GA 3OZ0A 3VTCA 2GTKA 4IVYA 4RWVA 3L0EA 2Q7LA 3Q95B 5DSHA 3TKCA 2YJDA 1FM6D 3V4AA 2QPYA 4LNWA 2HARA 3A2JA 4WLBA 2IOKA 3R2AA 3B66A 3GN8A 3OLSA 3X1IA 3HQ5A 3OMOA 1T5ZA 5KD9A 1RKGA 5AAUA 1X7EA 2NXXA 2ZK4A 4WVDA 2Q7KA 2HASA 4OK1A 5E1CA 1UHLA 2Q5GA 1T65A 2AA5A 2ATHA 3TX7B 3W5RA 3OS8C 1N46A 1ILGA 1XAPA 1A28A 5DXEA 3ADXA 5E0XA 4ZNSA 4RFWA 5EHJA 2YATA 3U9QA 3G8IA 5DKGA 1Y9RA 5C4TA 4XUHA 2ZXMA 4IS8A 4N73A 4MG9B 5DUHA 3KPZA 3G9EA 4ZNWA 2ZK2A 1NRLA 4OKXA 4S15A 4DQMA 1VJBA 4NB6A 1T73A 4RZFA 5DIEA 3OMMA 2R6YA 3ZQTA 1FD0A 2QGWA 4JYHA 4BCRA 1GWQA 1DKFA 3UUAB 4R2UA 3HODA 2J4AA 4OFRA 2Q6RA 3MNEA 2YJAB 1RJKA 3ILZA 3B0WA 3SP6A 2ZNPA 3GYTA 5E14A 2YLPA 2QXMA 2H77A 2VV4B 2NPAA 2ZL9A 3AX8A 3PCUA 4HEEX 2GL8A 2ZK3A 3VSPA 5GIDA 3DZUA 3SZ1A 1PQCA 3E00D 3NOAA 1XVPA 5F9BA 5DXRA 4ZN9A 5DV6A 1T7TA 3V3EA 1U3RA 4TUZB 2R40A 2AAXA 3OKHA 3OMKA 5DZIA 5AZTA 5IAWA 5DV3A 2AMAA 3A2HA 4RE8A 3VHUA 1EXXA 3AN3A 3NSQA 1R1KD 4FN9A 4IA7A 5KRJA 1KKQA 5DYBA 1NQ7A 2QABA 3DY6A 1I38A 4S14A 5IXKA 4MGBB 4POHA 1Y0SA 2OM9A 3L3XA 3D90A 1YMTA 3KWYA 3OKIA 3UU7A 2PIUA 4PXMA 3UUDB 1SQNA 2GPPA 2ZK0A 3CS6A 4PLDA 5JJMA 4J5XC 3AZ2A 3QT0A 3OSAA 3VT4A 4OEDA 3KMGA 2PIPL 1YOKA 1MV9A 1UPWA 1Y0XX 1ZUCA 2HB8A 3AZ1A 4OEAA 5HCVA 5KYAA 5SYZA 1PRGA 3UVVB 2VV4A 2PNUA 3HC6A 3O1DA 3K23A 3P89A 4IUIA 3P88A 4RMDA 2PIVA 1Z95A 2QGTA 5AWKA 3WFGA 1NUOA 3PRGA 5FQPA 4QE6A 2OCFA 1X7RA 5DXBB 1EXAA 1I37A 4UDAA 4S0TA 3DZYA 1UPVA 3OOFA 4QL8A 5HYKA 3B1MA 1RK3A 4ITEA 3NSPA 2YHDA 3RUTA 1XDKB 2XYJA 3IA6A 5DU5A 3V9VA 2ZASA 2P54A 5DWEA 2PIRA 3OS8A 2IHQA 5DWJA 1G2NA 3IXPA 4MGAB 3RLLA 2AMBA 1K74A 4A4WA 3W0AA 4OC7A 1L2IA 1YIMA 2QA8A 3FLIA 3H52A 2AM9A 3L03A 4IV2A 1PZLA 2Q7IA 4PF3A 5KCFA 4E2JA 3PLZA 4J5WC 5HJSA 4MG7A 5C4SA 3WFFA 5AAVB 3OZJA 4J24A 1GS4A 2GWXA 2V0VA 2ZNNA 2V7CA 3GBKA 1PQ6A 2P4YA 3E7CA 4ZN7A 2O9IA 5EI1A 5DZ1A 3A78A 1UOMA 1FM9A 2ZK1A 1FCXA 3VHWA 2Q6JA 3VRWA 4DOSA 4E4QA 1QKNA 2J7XA 1T63A 1ZAFA 4OILA 5GT4A 2O4JA 5KYJA 5DKSA 1X7JA 1XOWA 4YT1A 5L7EA 4IU7A 4WHGA 4PPPA 4OARA 1HJ1A 1XDKA 4LSJA 4X1FA 5DUEA 3DZUD 2ZFXA 2AB2A 1XQ3A 5DXKA 1ERRA 4PP6A 3OMQA 3KFCA 3SP9A 4OEZA 2R40D 3VT7A 4NIEA 2B1VA 4K4JA 3VTBA 3WTQA 2PIXA 5HZCA 2E2RA 4NQAB 1Z5XE 5E19A 2G44A 5DX3A 2A3IA 1X78A 4RMEA 5DV8A 5G43A 3W0GA 3A9EB 3F5CA 2GPVA 4UDDA 2POGA 3OLFA 1G5YA 2YLYA 3AUNA 2JJ3A 3FC6A 4Q0AC 2P7AA 3R5NA 5KRIA 1XJ7A 2VV2A 2Z4JA 4IA3A 5CJ6A 4OKTA 2AX9A 2QTUA 1T74A 4JYGA 4OHAA 2Q59B 3VT8A 4M8HA 4J5XA 1OVLA 3W0YA 1MVCA 1G1UA 2B50A 4R06A 1NDEA 1E3GA 1SKXA 4EMAA 1M7WA 3JZBA 3V3QA 4HLWA 3OLLA 3UP3A 1S9PA 4MGCA 2XYWA 3ET2A 4J26A 2PITA 3RLJA 1E3KA 1YJEA 2F4BA 1KNUA 2Q1VA 1YOWA 3B68A 3B5RA 4DORA 5DVCA 2P1VA 1ZDUA 2HBHA 4REFA 4DM6A 2LBDA 4G21A 3W0HA 3DZYD 1XP1A 5ICKA 5AVIA 3OSWA 1QKUA 3B0QA 2P7ZA 3VSOA 3Q95A 2JFAB 2QMVA 2I4JA 3AZ3A 4P6XA 2R6WA 4OJ4A 5DKEA 5ETHA 3VRUA 3IXPD 2EWPA 1TFCA 2PIQA 3OGTA 2ACLB 2P1UA 4MDDA 4G1YA 4OLMA 1K74D 3P8XA 5DZHA 3OMPA 5KR9A 2FAIA 5DY8A 3HZFA 4MGDB 2ZBSA 4XI3A 1YA3A 4J5WA 4IW6A 3VTDA 5FQTA 4OIUA 2VV1B 4OJ9A 3RY9A 3W5TA 3AURA 2QR9A 5JI0D 2IOGA 1YY4A 4IQRA 1U9EA 2AX6A 1LBDA 3GYUA 2AX8A 5KCWA 1FM9D 1ZDTA 2BJ4B 2YLOA 3AN4A 3D24A 3KMZA 4MG9A 4N5GA 3R5MA 5DXPA 3B0TA 4ONIA 4Q13A 5HJPB 3VHVA 5DZ0A 2AO6A 4KZMA 2Q5PA 5DYDA 3CLDA 5A86A 4ITFA 4IA1A 4RUOX 3WGPA 5L11A 4PVUA 2JFAA 2QSEA 4IWFA 4WPFA 1NHZA 3UUAA 4UDCA 5DL4A 2XYXA 5DVVA 3ZRAA 2I4ZA 4XTAA 4YNKA 2FSZA 1Z5XU 5FQSA 1M2ZA 3O1EA 3BC5A 3ADWA 2P15A 4OKBA 2HAMA 3S9SA 1XV9B 1BSXA 3IPQA 1OSHA 4OH5A 4IA2A 4TUZA 3D5FA 3M7RA 1PK5A 5LGAA 2OUZA 1NQ0A 3PBAA 2G0GA 2PIOA 1TXIA 3F7DA 5B41A 2ZXZA 4DK7A 2OVMA 3H0AA 1YYEA 4A2JA 5KCTA 1XP9A 4IWCA 4MG8B 4MGBA 5L7HA 3V9TA 2QA6A 4LBDA 5C4OA 3FEJA 3HVLA 1IE8A 3MNOA 3CDSA 2I0JA 3W0JA 3L0LA 3UUDA 2G0HA 1I7GA 2ZMHA 3OAPA 1NAVA 4FGYA 3UP0A 4OH6A 2Q3YA 1ZKYA 4TV1B 3GWSX 5LWPA 1R6GA 4NY9A 5APKA 1XLSE 2HFPA 2ZK5A 5KRFA 4L96A 3JZCA 5DTVA 1RDTA 5FQVA 3WT5A 2Q5SA 3FEIA 3R8DA 3PO9A 5DXGA 2ZK6A 1I7IA 2B1ZA 1L2JA 2OAXA 4N8RA 2O4RA 3LMPA 4KZJA 5DP0A 4DMAA 1NQ1A 4RZGA 3W5QA 5IZ0A 4L98A 5DXBA 5FQRA 3IMYA 3D6DA 3B0RA 3FALB 4QM0A 3KDUA 5DMFA 2GPUA 1X76A 1IE9A 2QZOB 2AA7A 3X31A 4CSJA 1GWRA 2ZLCA 5DWIA 1NAXA 4O8FA 1WM0X 1ZH7A 3ET1A 4ZNUA 4YPQA 1N4HA 4RZEA 2ZVTA 1GWXA 2Q61A 4MGAA 2PKLA 4ZNHA 3X1HA 3VT6A 5KRCA 3ET0A 3DCUA 1XNNA 3FUGA 4TV1A 5JY3A 4G2HA 3CJWA 2AX7A 1S9QA 4N1YA 3VI8A 2QXSA 2AWHA 1UHLB 2FVJA 3D57A 5APJA 3WJ4A 5AAVA 2Q7JA 4Y29A 5E7VA 4WHFA 2NXXE 2I4PA 2POBA 2QE4A 3CQVA 3KBAA 4ZOMA 5EC9A 3RVFA 5DXMA 3R8IA 1YINA 1XIUA 4MG5A 4ZO1X 3X36A 3W5PA 4OGHA 4ZI1A 4MG6A 4RMCA 3TKMA 2ABIA 4OJBA 5KRHA 2YFEA 2Q60A 3LBDA 3V49A 3N00A 1SR7A 2ZLAA 3G0WA 4F9MA 1EREA 1FBYA 3VT5A 3GD2A 1NQ2A 5EJVA 1XZXX 4PPSA 3WT7A 3L1BA 3ERTA 2H79A 3ADUA 3A3ZX 1Q4XA 5AWJA 1DKFB 5GICA 2P1TA 3ET3A 3V9YA 4G1ZA 1T7RA 4OFUA 3FURA 1R20A 5KRAA 3GWXA 2XHSA 1S0ZA 5GIEA 2PINA 5DK9A 3A2IA 4YMQA 1XB7A 1N83A 3A9EA 3K8SA 4CI4A 3H0AD 3VRVA 3ZRBA 5I4VA 2HC4A 5KRMA 5G5WA 1XVPB 1T79A 3OSIA 2AA6A 2Q70A 4QJRA 4RUJA 5C4UA 3OS9A 5M96A 2Q59A 4G1DA 5DMCA 5H1EA 3VJTA 3UUCA 2GIUA 5DWGA 1RKHA 2ZXNA 5E15A 4CI5A 4WQPA 4IVWA 5DIGA 1ZGYA 3PEQA 1FCZA 3BQDA 5DUGA 5EGVA 5KCEA 4KZIA 4M8EA 1RDTD 4OZTE 1OT7A 4REEA 3HM1A 3AFRA 5K13A 3UU7B 2OVHA 4FHHA 2ZNQA 3ERDA 5DI7A 3VT9A 5JJMB 4RAKA 5KCUA 3ADVA 5KRLA 3R8AA 5G46A 4RUPA 1HG4A 4EM9A 3VRTA 4PLEA 5EITA 5AVLA 1X7BA 4Q50A 4FNEA 3W0IA 4PP3A 4XUMA 3L3ZA 3VJIA 5DIDA 1QKTA 1T7FA 5ACCA 1XP6A 4OZRE 4XHDA 4PP5A 2ACLA 2HWQA 5G3JA 4ZJRA 4K7AA 3CTBA 3VJHA 4OEYA 4PWLA 4B7WA 5KCDA 4MGDA 3WT6A 2VSRA 2GPOA 1QKMA 2W8YA 1FM6A 5B5BA 3DCTA 2VV1A 3ZR7A 3P0UA 2B23A 3VJSA 2Q1HA 5DRJA 1XQCA 4IV4A 1K4WA 5DKBA 4JL4A 5KROA 2BAWA 1PDUA 2BJ4A 2QA8B 1H9UA 1MZNA 3UVVA 2NV7A 1U3QA 4JYIA 4ZJWA 5HJPA 3DT3A 5G45A 4APUA 4MG7B 1SJ0A 4PRGA 2ZMJA 5HYRA 4POJA 4P6WA 1R5KA 3B67A 4OIVA 5DWLA 2GP7A 4IW8A 1U3SA 5DXQA 3K22A 5DZ3A 2ZMIA 1K7LA 1PCGA 3VN2A 1P8DA 3E94A 4QE8A 2REWA 4ZO1B 5L7GA 3BEJA 2QW4A 2OZ7A 2ZNOA 2HB7A 1R20D 2Q8SA 4ZNTA 2J14A 2VV0A 3T03A 2PJLA 3L0JA 4LTWA 5DLRA 4NUFA 2PRGA 2AYRA 2ZKCA 1XV9A 3G8OA 5AZVA 5DRMA 1FCYA 2ZY0A 4OKWA 2Z4BA 1PQ9A 4DM8A 4XAOA 3FXVA 1NYXA 3R29A 1T7MA 1ILHA 4JAZA 5G42A 1YP0A 4JGVA 2HCDA 2QH6A 4UDBA 2I0GA 3KYTA 5AYGA 3W0CA 3CS4A 5DX3B 3WJ5A 3HLVA 3IPUA 3MNPA 4MG8A 1S0XA 2JF9A 3F5CB 3HO0A 3E00A 3FC6B 3FS1A 1ZEOA 2VSTA 3K6PA 4G2IA 4OZTU 4S0SA 1XLSA 3CWDA 1OSVA 1S19A 1T76A 3IPSA 4XT9A 2NW4A 2HVCA 1R1KA 3RUUA 3B65A 2Q6SA 4G20A 1OVLB 5KRKA 5APHA 4QK4A 1KV6A 2AXAA 1DB1A 3ADSA 2PIWA 2XKWA 5DVSA 3CDPA 1A52A 1LV2A 1YUCA 4E4KA 4XLDA 3HC5A 4ZNVA 5AK2A 3TY0A 2AA2A 4FHIA 3EYBA 3KDTA 5G44A 5E0WA 4X1GA 2YLQA 3A40X 3ADTA 2G5OA 3DR1A 4DK8A 4LNXA 3WWRA 4R6SA
chains in the Genus database with same CATH topology
1P93A 3CS8A 3VT3A 1XNXA 3FALA 4OZRU 2QNVA 3B3KA 3WMHA 5KCCA 2VV3A 1M13A 3GZ9A 1XPCA 3OOKA 3KMRA 4A4VA 2QZOA 1G50A 2J7YA 4K6IA 2HWRA 3AUQA 2P7GA 3OZ0A 3VTCA 2GTKA 4IVYA 4RWVA 3L0EA 2Q7LA 3Q95B 5DSHA 3TKCA 2YJDA 1FM6D 3V4AA 2QPYA 4LNWA 2HARA 3A2JA 4WLBA 2IOKA 3R2AA 3B66A 3GN8A 3OLSA 3X1IA 3HQ5A 3OMOA 1T5ZA 5KD9A 1RKGA 5AAUA 1X7EA 2NXXA 2ZK4A 4WVDA 2Q7KA 2HASA 4OK1A 5E1CA 1UHLA 2Q5GA 1T65A 2AA5A 2ATHA 3TX7B 3W5RA 3OS8C 1N46A 1ILGA 1XAPA 1A28A 5DXEA 3ADXA 5E0XA 4ZNSA 4RFWA 5EHJA 2YATA 3U9QA 3G8IA 5DKGA 1Y9RA 5C4TA 4XUHA 2ZXMA 4IS8A 4N73A 4MG9B 5DUHA 3KPZA 3G9EA 4ZNWA 2ZK2A 1NRLA 4OKXA 4S15A 4DQMA 1VJBA 4NB6A 1T73A 4RZFA 5DIEA 3OMMA 2R6YA 3ZQTA 1FD0A 2QGWA 4JYHA 4BCRA 1GWQA 1DKFA 3UUAB 4R2UA 3HODA 2J4AA 4OFRA 2Q6RA 3MNEA 2YJAB 1RJKA 3ILZA 3B0WA 3SP6A 2ZNPA 3GYTA 5E14A 2YLPA 2QXMA 2H77A 2VV4B 2NPAA 2ZL9A 3AX8A 3PCUA 4HEEX 2GL8A 2ZK3A 3VSPA 5GIDA 3DZUA 3SZ1A 1PQCA 3E00D 3NOAA 1XVPA 5F9BA 5DXRA 4ZN9A 5DV6A 1T7TA 3V3EA 1U3RA 4TUZB 2R40A 2AAXA 3OKHA 3OMKA 5DZIA 5AZTA 5IAWA 5DV3A 2AMAA 3A2HA 4RE8A 3VHUA 1EXXA 3AN3A 3NSQA 1R1KD 4FN9A 4IA7A 5KRJA 1KKQA 5DYBA 1NQ7A 2QABA 3DY6A 1I38A 4S14A 5IXKA 4MGBB 4POHA 1Y0SA 2OM9A 3L3XA 3D90A 1YMTA 3KWYA 3OKIA 3UU7A 2PIUA 4PXMA 3UUDB 1SQNA 2GPPA 2ZK0A 3CS6A 4PLDA 5JJMA 4J5XC 3AZ2A 3QT0A 3OSAA 3VT4A 4OEDA 3KMGA 2PIPL 1YOKA 1MV9A 1UPWA 1Y0XX 1ZUCA 2HB8A 3AZ1A 4OEAA 5HCVA 5KYAA 5SYZA 1PRGA 3UVVB 2VV4A 2PNUA 3HC6A 3O1DA 3K23A 3P89A 4IUIA 3P88A 4RMDA 2PIVA 1Z95A 2QGTA 5AWKA 3WFGA 1NUOA 3PRGA 5FQPA 4QE6A 2OCFA 1X7RA 5DXBB 1EXAA 1I37A 4UDAA 4S0TA 3DZYA 1UPVA 3OOFA 4QL8A 5HYKA 3B1MA 1RK3A 4ITEA 3NSPA 2YHDA 3RUTA 1XDKB 2XYJA 3IA6A 5DU5A 3V9VA 2ZASA 2P54A 5DWEA 2PIRA 3OS8A 2IHQA 5DWJA 1G2NA 3IXPA 4MGAB 3RLLA 2AMBA 1K74A 4A4WA 3W0AA 4OC7A 1L2IA 1YIMA 2QA8A 3FLIA 3H52A 2AM9A 3L03A 4IV2A 1PZLA 2Q7IA 4PF3A 5KCFA 4E2JA 3PLZA 4J5WC 5HJSA 4MG7A 5C4SA 3WFFA 5AAVB 3OZJA 4J24A 1GS4A 2GWXA 2V0VA 2ZNNA 2V7CA 3GBKA 1PQ6A 2P4YA 3E7CA 4ZN7A 2O9IA 5EI1A 5DZ1A 3A78A 1UOMA 1FM9A 2ZK1A 1FCXA 3VHWA 2Q6JA 3VRWA 4DOSA 4E4QA 1QKNA 2J7XA 1T63A 1ZAFA 4OILA 5GT4A 2O4JA 5KYJA 5DKSA 1X7JA 1XOWA 4YT1A 5L7EA 4IU7A 4WHGA 4PPPA 4OARA 1HJ1A 1XDKA 4LSJA 4X1FA 5DUEA 3DZUD 2ZFXA 2AB2A 1XQ3A 5DXKA 1ERRA 4PP6A 3OMQA 3KFCA 3SP9A 4OEZA 2R40D 3VT7A 4NIEA 2B1VA 4K4JA 3VTBA 3WTQA 2PIXA 5HZCA 2E2RA 4NQAB 1Z5XE 5E19A 2G44A 5DX3A 2A3IA 1X78A 4RMEA 5DV8A 5G43A 3W0GA 3A9EB 3F5CA 2GPVA 4UDDA 2POGA 3OLFA 1G5YA 2YLYA 3AUNA 2JJ3A 3FC6A 4Q0AC 2P7AA 3R5NA 5KRIA 1XJ7A 2VV2A 2Z4JA 4IA3A 5CJ6A 4OKTA 2AX9A 2QTUA 1T74A 4JYGA 4OHAA 2Q59B 3VT8A 4M8HA 4J5XA 1OVLA 3W0YA 1MVCA 1G1UA 2B50A 4R06A 1NDEA 1E3GA 1SKXA 4EMAA 1M7WA 3JZBA 3V3QA 4HLWA 3OLLA 3UP3A 1S9PA 4MGCA 2XYWA 3ET2A 4J26A 2PITA 3RLJA 1E3KA 1YJEA 2F4BA 1KNUA 2Q1VA 1YOWA 3B68A 3B5RA 4DORA 5DVCA 2P1VA 1ZDUA 2HBHA 4REFA 4DM6A 2LBDA 4G21A 3W0HA 3DZYD 1XP1A 5ICKA 5AVIA 3OSWA 1QKUA 3B0QA 2P7ZA 3VSOA 3Q95A 2JFAB 2QMVA 2I4JA 3AZ3A 4P6XA 2R6WA 4OJ4A 5DKEA 5ETHA 3VRUA 3IXPD 2EWPA 1TFCA 2PIQA 3OGTA 2ACLB 2P1UA 4MDDA 4G1YA 4OLMA 1K74D 3P8XA 5DZHA 3OMPA 5KR9A 2FAIA 5DY8A 3HZFA 4MGDB 2ZBSA 4XI3A 1YA3A 4J5WA 4IW6A 3VTDA 5FQTA 4OIUA 2VV1B 4OJ9A 3RY9A 3W5TA 3AURA 2QR9A 5JI0D 2IOGA 1YY4A 4IQRA 1U9EA 2AX6A 1LBDA 3GYUA 2AX8A 5KCWA 1FM9D 1ZDTA 2BJ4B 2YLOA 3AN4A 3D24A 3KMZA 4MG9A 4N5GA 3R5MA 5DXPA 3B0TA 4ONIA 4Q13A 5HJPB 3VHVA 5DZ0A 2AO6A 4KZMA 2Q5PA 5DYDA 3CLDA 5A86A 4ITFA 4IA1A 4RUOX 3WGPA 5L11A 4PVUA 2JFAA 2QSEA 4IWFA 4WPFA 1NHZA 3UUAA 4UDCA 5DL4A 2XYXA 5DVVA 3ZRAA 2I4ZA 4XTAA 4YNKA 2FSZA 1Z5XU 5FQSA 1M2ZA 3O1EA 3BC5A 3ADWA 2P15A 4OKBA 2HAMA 3S9SA 1XV9B 1BSXA 3IPQA 1OSHA 4OH5A 4IA2A 4TUZA 3D5FA 3M7RA 1PK5A 5LGAA 2OUZA 1NQ0A 3PBAA 2G0GA 2PIOA 1TXIA 3F7DA 5B41A 2ZXZA 4DK7A 2OVMA 3H0AA 1YYEA 4A2JA 5KCTA 1XP9A 4IWCA 4MG8B 4MGBA 5L7HA 3V9TA 2QA6A 4LBDA 5C4OA 3FEJA 3HVLA 1IE8A 3MNOA 3CDSA 2I0JA 3W0JA 3L0LA 3UUDA 2G0HA 1I7GA 2ZMHA 3OAPA 1NAVA 4FGYA 3UP0A 4OH6A 2Q3YA 1ZKYA 4TV1B 3GWSX 5LWPA 1R6GA 4NY9A 5APKA 1XLSE 2HFPA 2ZK5A 5KRFA 4L96A 3JZCA 5DTVA 1RDTA 5FQVA 3WT5A 2Q5SA 3FEIA 3R8DA 3PO9A 5DXGA 2ZK6A 1I7IA 2B1ZA 1L2JA 2OAXA 4N8RA 2O4RA 3LMPA 4KZJA 5DP0A 4DMAA 1NQ1A 4RZGA 3W5QA 5IZ0A 4L98A 5DXBA 5FQRA 3IMYA 3D6DA 3B0RA 3FALB 4QM0A 3KDUA 5DMFA 2GPUA 1X76A 1IE9A 2QZOB 2AA7A 3X31A 4CSJA 1GWRA 2ZLCA 5DWIA 1NAXA 4O8FA 1WM0X 1ZH7A 3ET1A 4ZNUA 4YPQA 1N4HA 4RZEA 2ZVTA 1GWXA 2Q61A 4MGAA 2PKLA 4ZNHA 3X1HA 3VT6A 5KRCA 3ET0A 3DCUA 1XNNA 3FUGA 4TV1A 5JY3A 4G2HA 3CJWA 2AX7A 1S9QA 4N1YA 3VI8A 2QXSA 2AWHA 1UHLB 2FVJA 3D57A 5APJA 3WJ4A 5AAVA 2Q7JA 4Y29A 5E7VA 4WHFA 2NXXE 2I4PA 2POBA 2QE4A 3CQVA 3KBAA 4ZOMA 5EC9A 3RVFA 5DXMA 3R8IA 1YINA 1XIUA 4MG5A 4ZO1X 3X36A 3W5PA 4OGHA 4ZI1A 4MG6A 4RMCA 3TKMA 2ABIA 4OJBA 5KRHA 2YFEA 2Q60A 3LBDA 3V49A 3N00A 1SR7A 2ZLAA 3G0WA 4F9MA 1EREA 1FBYA 3VT5A 3GD2A 1NQ2A 5EJVA 1XZXX 4PPSA 3WT7A 3L1BA 3ERTA 2H79A 3ADUA 3A3ZX 1Q4XA 5AWJA 1DKFB 5GICA 2P1TA 3ET3A 3V9YA 4G1ZA 1T7RA 4OFUA 3FURA 1R20A 5KRAA 3GWXA 2XHSA 1S0ZA 5GIEA 2PINA 5DK9A 3A2IA 4YMQA 1XB7A 1N83A 3A9EA 3K8SA 4CI4A 3H0AD 3VRVA 3ZRBA 5I4VA 2HC4A 5KRMA 5G5WA 1XVPB 1T79A 3OSIA 2AA6A 2Q70A 4QJRA 4RUJA 5C4UA 3OS9A 5M96A 2Q59A 4G1DA 5DMCA 5H1EA 3VJTA 3UUCA 2GIUA 5DWGA 1RKHA 2ZXNA 5E15A 4CI5A 4WQPA 4IVWA 5DIGA 1ZGYA 3PEQA 1FCZA 3BQDA 5DUGA 5EGVA 5KCEA 4KZIA 4M8EA 1RDTD 4OZTE 1OT7A 4REEA 3HM1A 3AFRA 5K13A 3UU7B 2OVHA 4FHHA 2ZNQA 3ERDA 5DI7A 3VT9A 5JJMB 4RAKA 5KCUA 3ADVA 5KRLA 3R8AA 5G46A 4RUPA 1HG4A 4EM9A 3VRTA 4PLEA 5EITA 5AVLA 1X7BA 4Q50A 4FNEA 3W0IA 4PP3A 4XUMA 3L3ZA 3VJIA 5DIDA 1QKTA 1T7FA 5ACCA 1XP6A 4OZRE 4XHDA 4PP5A 2ACLA 2HWQA 5G3JA 4ZJRA 4K7AA 3CTBA 3VJHA 4OEYA 4PWLA 4B7WA 5KCDA 4MGDA 3WT6A 2VSRA 2GPOA 1QKMA 2W8YA 1FM6A 5B5BA 3DCTA 2VV1A 3ZR7A 3P0UA 2B23A 3VJSA 2Q1HA 5DRJA 1XQCA 4IV4A 1K4WA 5DKBA 4JL4A 5KROA 2BAWA 1PDUA 2BJ4A 2QA8B 1H9UA 1MZNA 3UVVA 2NV7A 1U3QA 4JYIA 4ZJWA 5HJPA 3DT3A 5G45A 4APUA 4MG7B 1SJ0A 4PRGA 2ZMJA 5HYRA 4POJA 4P6WA 1R5KA 3B67A 4OIVA 5DWLA 2GP7A 4IW8A 1U3SA 5DXQA 3K22A 5DZ3A 2ZMIA 1K7LA 1PCGA 3VN2A 1P8DA 3E94A 4QE8A 2REWA 4ZO1B 5L7GA 3BEJA 2QW4A 2OZ7A 2ZNOA 2HB7A 1R20D 2Q8SA 4ZNTA 2J14A 2VV0A 3T03A 2PJLA 3L0JA 4LTWA 5DLRA 4NUFA 2PRGA 2AYRA 2ZKCA 1XV9A 3G8OA 5AZVA 5DRMA 1FCYA 2ZY0A 4OKWA 2Z4BA 1PQ9A 4DM8A 4XAOA 3FXVA 1NYXA 3R29A 1T7MA 1ILHA 4JAZA 5G42A 1YP0A 4JGVA 2HCDA 2QH6A 4UDBA 2I0GA 3KYTA 5AYGA 3W0CA 3CS4A 5DX3B 3WJ5A 3HLVA 3IPUA 3MNPA 4MG8A 1S0XA 2JF9A 3F5CB 3HO0A 3E00A 3FC6B 3FS1A 1ZEOA 2VSTA 3K6PA 4G2IA 4OZTU 4S0SA 1XLSA 3CWDA 1OSVA 1S19A 1T76A 3IPSA 4XT9A 2NW4A 2HVCA 1R1KA 3RUUA 3B65A 2Q6SA 4G20A 1OVLB 5KRKA 5APHA 4QK4A 1KV6A 2AXAA 1DB1A 3ADSA 2PIWA 2XKWA 5DVSA 3CDPA 1A52A 1LV2A 1YUCA 4E4KA 4XLDA 3HC5A 4ZNVA 5AK2A 3TY0A 2AA2A 4FHIA 3EYBA 3KDTA 5G44A 5E0WA 4X1GA 2YLQA 3A40X 3ADTA 2G5OA 3DR1A 4DK8A 4LNXA 3WWRA 4R6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P93 A;  3CS8 A;  3VT3 A;  1XNX A;  3FAL A;  4OZR U;  2QNV A;  3B3K A;  3WMH A;  5KCC A;  2VV3 A;  1M13 A;  3GZ9 A;  1XPC A;  3OOK A;  3KMR A;  4A4V A;  2QZO A;  1G50 A;  2J7Y A;  4K6I A;  2HWR A;  3AUQ A;  2P7G A;  3OZ0 A;  3VTC A;  2GTK A;  4IVY A;  4RWV A;  3L0E A;  2Q7L A;  3Q95 B;  5DSH A;  3TKC A;  2YJD A;  1FM6 D;  3V4A A;  2QPY A;  4LNW A;  2HAR A;  3A2J A;  4WLB A;  2IOK A;  3R2A A;  3B66 A;  3GN8 A;  3OLS A;  3X1I A;  3HQ5 A;  3OMO A;  1T5Z A;  5KD9 A;  1RKG A;  5AAU A;  1X7E A;  2NXX A;  2ZK4 A;  4WVD A;  2Q7K A;  2HAS A;  4OK1 A;  5E1C A;  1UHL A;  2Q5G A;  1T65 A;  2AA5 A;  2ATH A;  3TX7 B;  3W5R A;  3OS8 C;  1N46 A;  1ILG A;  1XAP A;  1A28 A;  5DXE A;  3ADX A;  5E0X A;  4ZNS A;  4RFW A;  5EHJ A;  2YAT A;  3U9Q A;  3G8I A;  5DKG A;  1Y9R A;  5C4T A;  4XUH A;  2ZXM A;  4IS8 A;  4N73 A;  4MG9 B;  5DUH A;  3KPZ A;  3G9E A;  4ZNW A;  2ZK2 A;  1NRL A;  4OKX A;  4S15 A;  4DQM A;  1VJB A;  4NB6 A;  1T73 A;  4RZF A;  5DIE A;  3OMM A;  2R6Y A;  3ZQT A;  1FD0 A;  2QGW A;  4JYH A;  4BCR A;  1GWQ A;  1DKF A;  3UUA B;  4R2U A;  3HOD A;  2J4A A;  4OFR A;  2Q6R A;  3MNE A;  2YJA B;  1RJK A;  3ILZ A;  3B0W A;  3SP6 A;  2ZNP A;  3GYT A;  5E14 A;  2YLP A;  2QXM A;  2H77 A;  2VV4 B;  2NPA A;  2ZL9 A;  3AX8 A;  3PCU A;  4HEE X;  2GL8 A;  2ZK3 A;  3VSP A;  5GID A;  3DZU A;  3SZ1 A;  1PQC A;  3E00 D;  3NOA A;  1XVP A;  5F9B A;  5DXR A;  4ZN9 A;  5DV6 A;  1T7T A;  3V3E A;  1U3R A;  4TUZ B;  2R40 A;  2AAX A;  3OKH A;  3OMK A;  5DZI A;  5AZT A;  5IAW A;  5DV3 A;  2AMA A;  3A2H A;  4RE8 A;  3VHU A;  1EXX A;  3AN3 A;  3NSQ A;  1R1K D;  4FN9 A;  4IA7 A;  5KRJ A;  1KKQ A;  5DYB A;  1NQ7 A;  2QAB A;  3DY6 A;  1I38 A;  4S14 A;  5IXK A;  4MGB B;  4POH A;  1Y0S A;  2OM9 A;  3L3X A;  3D90 A;  1YMT A;  3KWY A;  3OKI A;  3UU7 A;  2PIU A;  4PXM A;  3UUD B;  1SQN A;  2GPP A;  2ZK0 A;  3CS6 A;  4PLD A;  5JJM A;  4J5X C;  3AZ2 A;  3QT0 A;  3OSA A;  3VT4 A;  4OED A;  3KMG A;  2PIP L;  1YOK A;  1MV9 A;  1UPW A;  1Y0X X;  1ZUC A;  2HB8 A;  3AZ1 A;  4OEA A;  5HCV A;  5KYA A;  5SYZ A;  1PRG A;  3UVV B;  2VV4 A;  2PNU A;  3HC6 A;  3O1D A;  3K23 A;  3P89 A;  4IUI A;  3P88 A;  4RMD A;  2PIV A;  1Z95 A;  2QGT A;  5AWK A;  3WFG A;  1NUO A;  3PRG A;  5FQP A;  4QE6 A;  2OCF A;  1X7R A;  5DXB B;  1EXA A;  1I37 A;  4UDA A;  4S0T A;  3DZY A;  1UPV A;  3OOF A;  4QL8 A;  5HYK A;  3B1M A;  1RK3 A;  4ITE A;  3NSP A;  2YHD A;  3RUT A;  1XDK B;  2XYJ A;  3IA6 A;  5DU5 A;  3V9V A;  2ZAS A;  2P54 A;  5DWE A;  2PIR A;  3OS8 A;  2IHQ A;  5DWJ A;  1G2N A;  3IXP A;  4MGA B;  3RLL A;  2AMB A;  1K74 A;  4A4W A;  3W0A A;  4OC7 A;  1L2I A;  1YIM A;  2QA8 A;  3FLI A;  3H52 A;  2AM9 A;  3L03 A;  4IV2 A;  1PZL A;  2Q7I A;  4PF3 A;  5KCF A;  4E2J A;  3PLZ A;  4J5W C;  5HJS A;  4MG7 A;  5C4S A;  3WFF A;  5AAV B;  3OZJ A;  4J24 A;  1GS4 A;  2GWX A;  2V0V A;  2ZNN A;  2V7C A;  3GBK A;  1PQ6 A;  2P4Y A;  3E7C A;  4ZN7 A;  2O9I A;  5EI1 A;  5DZ1 A;  3A78 A;  1UOM A;  1FM9 A;  2ZK1 A;  1FCX A;  3VHW A;  2Q6J A;  3VRW A;  4DOS A;  4E4Q A;  1QKN A;  2J7X A;  1T63 A;  1ZAF A;  4OIL A;  5GT4 A;  2O4J A;  5KYJ A;  5DKS A;  1X7J A;  1XOW A;  4YT1 A;  5L7E A;  4IU7 A;  4WHG A;  4PPP A;  4OAR A;  1HJ1 A;  1XDK A;  4LSJ A;  4X1F A;  5DUE A;  3DZU D;  2ZFX A;  2AB2 A;  1XQ3 A;  5DXK A;  1ERR A;  4PP6 A;  3OMQ A;  3KFC A;  3SP9 A;  4OEZ A;  2R40 D;  3VT7 A;  4NIE A;  2B1V A;  4K4J A;  3VTB A;  3WTQ A;  2PIX A;  5HZC A;  2E2R A;  4NQA B;  1Z5X E;  5E19 A;  2G44 A;  5DX3 A;  2A3I A;  1X78 A;  4RME A;  5DV8 A;  5G43 A;  3W0G A;  3A9E B;  3F5C A;  2GPV A;  4UDD A;  2POG A;  3OLF A;  1G5Y A;  2YLY A;  3AUN A;  2JJ3 A;  3FC6 A;  4Q0A C;  2P7A A;  3R5N A;  5KRI A;  1XJ7 A;  2VV2 A;  2Z4J A;  4IA3 A;  5CJ6 A;  4OKT A;  2AX9 A;  2QTU A;  1T74 A;  4JYG A;  4OHA A;  2Q59 B;  3VT8 A;  4M8H A;  4J5X A;  1OVL A;  3W0Y A;  1MVC A;  1G1U A;  2B50 A;  4R06 A;  1NDE A;  1E3G A;  1SKX A;  4EMA A;  1M7W A;  3JZB A;  3V3Q A;  4HLW A;  3OLL A;  3UP3 A;  1S9P A;  4MGC A;  2XYW A;  3ET2 A;  4J26 A;  2PIT A;  3RLJ A;  1E3K A;  1YJE A;  2F4B A;  1KNU A;  2Q1V A;  1YOW A;  3B68 A;  3B5R A;  4DOR A;  5DVC A;  2P1V A;  1ZDU A;  2HBH A;  4REF A;  4DM6 A;  2LBD A;  4G21 A;  3W0H A;  3DZY D;  1XP1 A;  5ICK A;  5AVI A;  3OSW A;  1QKU A;  3B0Q A;  2P7Z A;  3VSO A;  3Q95 A;  2JFA B;  2QMV A;  2I4J A;  3AZ3 A;  4P6X A;  2R6W A;  4OJ4 A;  5DKE A;  5ETH A;  3VRU A;  3IXP D;  2EWP A;  1TFC A;  2PIQ A;  3OGT A;  2ACL B;  2P1U A;  4MDD A;  4G1Y A;  4OLM A;  1K74 D;  3P8X A;  5DZH A;  3OMP A;  5KR9 A;  2FAI A;  5DY8 A;  3HZF A;  4MGD B;  2ZBS A;  4XI3 A;  1YA3 A;  4J5W A;  4IW6 A;  3VTD A;  5FQT A;  4OIU A;  2VV1 B;  4OJ9 A;  3RY9 A;  3W5T A;  3AUR A;  2QR9 A;  5JI0 D;  2IOG A;  1YY4 A;  4IQR A;  1U9E A;  2AX6 A;  1LBD A;  3GYU A;  2AX8 A;  5KCW A;  1FM9 D;  1ZDT A;  2BJ4 B;  2YLO A;  3AN4 A;  3D24 A;  3KMZ A;  4MG9 A;  4N5G A;  3R5M A;  5DXP A;  3B0T A;  4ONI A;  4Q13 A;  5HJP B;  3VHV A;  5DZ0 A;  2AO6 A;  4KZM A;  2Q5P A;  5DYD A;  3CLD A;  5A86 A;  4ITF A;  4IA1 A;  4RUO X;  3WGP A;  5L11 A;  4PVU A;  2JFA A;  2QSE A;  4IWF A;  4WPF A;  1NHZ A;  3UUA A;  4UDC A;  5DL4 A;  2XYX A;  5DVV A;  3ZRA A;  2I4Z A;  4XTA A;  4YNK A;  2FSZ A;  1Z5X U;  5FQS A;  1M2Z A;  3O1E A;  3BC5 A;  3ADW A;  2P15 A;  4OKB A;  2HAM A;  3S9S A;  1XV9 B;  1BSX A;  3IPQ A;  1OSH A;  4OH5 A;  4IA2 A;  4TUZ A;  3D5F A;  3M7R A;  1PK5 A;  5LGA A;  2OUZ A;  1NQ0 A;  3PBA A;  2G0G A;  2PIO A;  1TXI A;  3F7D A;  5B41 A;  2ZXZ A;  4DK7 A;  2OVM A;  3H0A A;  1YYE A;  4A2J A;  5KCT A;  1XP9 A;  4IWC A;  4MG8 B;  4MGB A;  5L7H A;  3V9T A;  2QA6 A;  4LBD A;  5C4O A;  3FEJ A;  3HVL A;  1IE8 A;  3MNO A;  3CDS A;  2I0J A;  3W0J A;  3L0L A;  3UUD A;  2G0H A;  1I7G A;  2ZMH A;  3OAP A;  1NAV A;  4FGY A;  3UP0 A;  4OH6 A;  2Q3Y A;  1ZKY A;  4TV1 B;  3GWS X;  5LWP A;  1R6G A;  4NY9 A;  5APK A;  1XLS E;  2HFP A;  2ZK5 A;  5KRF A;  4L96 A;  3JZC A;  5DTV A;  1RDT A;  5FQV A;  3WT5 A;  2Q5S A;  3FEI A;  3R8D A;  3PO9 A;  5DXG A;  2ZK6 A;  1I7I A;  2B1Z A;  1L2J A;  2OAX A;  4N8R A;  2O4R A;  3LMP A;  4KZJ A;  5DP0 A;  4DMA A;  1NQ1 A;  4RZG A;  3W5Q A;  5IZ0 A;  4L98 A;  5DXB A;  5FQR A;  3IMY A;  3D6D A;  3B0R A;  3FAL B;  4QM0 A;  3KDU A;  5DMF A;  2GPU A;  1X76 A;  1IE9 A;  2QZO B;  2AA7 A;  3X31 A;  4CSJ A;  1GWR A;  2ZLC A;  5DWI A;  1NAX A;  4O8F A;  1WM0 X;  1ZH7 A;  3ET1 A;  4ZNU A;  4YPQ A;  1N4H A;  4RZE A;  2ZVT A;  1GWX A;  2Q61 A;  4MGA A;  2PKL A;  4ZNH A;  3X1H A;  3VT6 A;  5KRC A;  3ET0 A;  3DCU A;  1XNN A;  3FUG A;  4TV1 A;  5JY3 A;  4G2H A;  3CJW A;  2AX7 A;  1S9Q A;  4N1Y A;  3VI8 A;  2QXS A;  2AWH A;  1UHL B;  2FVJ A;  3D57 A;  5APJ A;  3WJ4 A;  5AAV A;  2Q7J A;  4Y29 A;  5E7V A;  4WHF A;  2NXX E;  2I4P A;  2POB A;  2QE4 A;  3CQV A;  3KBA A;  4ZOM A;  5EC9 A;  3RVF A;  5DXM A;  3R8I A;  1YIN A;  1XIU A;  4MG5 A;  4ZO1 X;  3X36 A;  3W5P A;  4OGH A;  4ZI1 A;  4MG6 A;  4RMC A;  3TKM A;  2ABI A;  4OJB A;  5KRH A;  2YFE A;  2Q60 A;  3LBD A;  3V49 A;  3N00 A;  1SR7 A;  2ZLA A;  3G0W A;  4F9M A;  1ERE A;  1FBY A;  3VT5 A;  3GD2 A;  1NQ2 A;  5EJV A;  1XZX X;  4PPS A;  3WT7 A;  3L1B A;  3ERT A;  2H79 A;  3ADU A;  3A3Z X;  1Q4X A;  5AWJ A;  1DKF B;  5GIC A;  2P1T A;  3ET3 A;  3V9Y A;  4G1Z A;  1T7R A;  4OFU A;  3FUR A;  1R20 A;  5KRA A;  3GWX A;  2XHS A;  1S0Z A;  5GIE A;  2PIN A;  5DK9 A;  3A2I A;  4YMQ A;  1XB7 A;  1N83 A;  3A9E A;  3K8S A;  4CI4 A;  3H0A D;  3VRV A;  3ZRB A;  5I4V A;  2HC4 A;  5KRM A;  5G5W A;  1XVP B;  1T79 A;  3OSI A;  2AA6 A;  2Q70 A;  4QJR A;  4RUJ A;  5C4U A;  3OS9 A;  5M96 A;  2Q59 A;  4G1D A;  5DMC A;  5H1E A;  3VJT A;  3UUC A;  2GIU A;  5DWG A;  1RKH A;  2ZXN A;  5E15 A;  4CI5 A;  4WQP A;  4IVW A;  5DIG A;  1ZGY A;  3PEQ A;  1FCZ A;  3BQD A;  5DUG A;  5EGV A;  5KCE A;  4KZI A;  4M8E A;  1RDT D;  4OZT E;  1OT7 A;  4REE A;  3HM1 A;  3AFR A;  5K13 A;  3UU7 B;  2OVH A;  4FHH A;  2ZNQ A;  3ERD A;  5DI7 A;  3VT9 A;  5JJM B;  4RAK A;  5KCU A;  3ADV A;  5KRL A;  3R8A A;  5G46 A;  4RUP A;  1HG4 A;  4EM9 A;  3VRT A;  4PLE A;  5EIT A;  5AVL A;  1X7B A;  4Q50 A;  4FNE A;  3W0I A;  4PP3 A;  4XUM A;  3L3Z A;  3VJI A;  5DID A;  1QKT A;  1T7F A;  5ACC A;  1XP6 A;  4OZR E;  4XHD A;  4PP5 A;  2ACL A;  2HWQ A;  5G3J A;  4ZJR A;  4K7A A;  3CTB A;  3VJH A;  4OEY A;  4PWL A;  4B7W A;  5KCD A;  4MGD A;  3WT6 A;  2VSR A;  2GPO A;  1QKM A;  2W8Y A;  1FM6 A;  5B5B A;  3DCT A;  2VV1 A;  3ZR7 A;  3P0U A;  2B23 A;  3VJS A;  2Q1H A;  5DRJ A;  1XQC A;  4IV4 A;  1K4W A;  5DKB A;  4JL4 A;  5KRO A;  2BAW A;  1PDU A;  2BJ4 A;  2QA8 B;  1H9U A;  1MZN A;  3UVV A;  2NV7 A;  1U3Q A;  4JYI A;  4ZJW A;  5HJP A;  3DT3 A;  5G45 A;  4APU A;  4MG7 B;  1SJ0 A;  4PRG A;  2ZMJ A;  5HYR A;  4POJ A;  4P6W A;  1R5K A;  3B67 A;  4OIV A;  5DWL A;  2GP7 A;  4IW8 A;  1U3S A;  5DXQ A;  3K22 A;  5DZ3 A;  2ZMI A;  1K7L A;  1PCG A;  3VN2 A;  1P8D A;  3E94 A;  4QE8 A;  2REW A;  4ZO1 B;  5L7G A;  3BEJ A;  2QW4 A;  2OZ7 A;  2ZNO A;  2HB7 A;  1R20 D;  2Q8S A;  4ZNT A;  2J14 A;  2VV0 A;  3T03 A;  2PJL A;  3L0J A;  4LTW A;  5DLR A;  4NUF A;  2PRG A;  2AYR A;  2ZKC A;  1XV9 A;  3G8O A;  5AZV A;  5DRM A;  1FCY A;  2ZY0 A;  4OKW A;  2Z4B A;  1PQ9 A;  4DM8 A;  4XAO A;  3FXV A;  1NYX A;  3R29 A;  1T7M A;  1ILH A;  4JAZ A;  5G42 A;  1YP0 A;  4JGV A;  2HCD A;  2QH6 A;  4UDB A;  2I0G A;  3KYT A;  5AYG A;  3W0C A;  3CS4 A;  5DX3 B;  3WJ5 A;  3HLV A;  3IPU A;  3MNP A;  4MG8 A;  1S0X A;  2JF9 A;  3F5C B;  3HO0 A;  3E00 A;  3FC6 B;  3FS1 A;  1ZEO A;  2VST A;  3K6P A;  4G2I A;  4OZT U;  4S0S A;  1XLS A;  3CWD A;  1OSV A;  1S19 A;  1T76 A;  3IPS A;  4XT9 A;  2NW4 A;  2HVC A;  1R1K A;  3RUU A;  3B65 A;  2Q6S A;  4G20 A;  1OVL B;  5KRK A;  5APH A;  4QK4 A;  1KV6 A;  2AXA A;  1DB1 A;  3ADS A;  2PIW A;  2XKW A;  5DVS A;  3CDP A;  1A52 A;  1LV2 A;  1YUC A;  4E4K A;  4XLD A;  3HC5 A;  4ZNV A;  5AK2 A;  3TY0 A;  2AA2 A;  4FHI A;  3EYB A;  3KDT A;  5G44 A;  5E0W A;  4X1G A;  2YLQ A;  3A40 X;  3ADT A;  2G5O A;  3DR1 A;  4DK8 A;  4LNX A;  3WWR A;  4R6S A; 
#chains in the Genus database with same CATH topology
 1P93 A;  3CS8 A;  3VT3 A;  1XNX A;  3FAL A;  4OZR U;  2QNV A;  3B3K A;  3WMH A;  5KCC A;  2VV3 A;  1M13 A;  3GZ9 A;  1XPC A;  3OOK A;  3KMR A;  4A4V A;  2QZO A;  1G50 A;  2J7Y A;  4K6I A;  2HWR A;  3AUQ A;  2P7G A;  3OZ0 A;  3VTC A;  2GTK A;  4IVY A;  4RWV A;  3L0E A;  2Q7L A;  3Q95 B;  5DSH A;  3TKC A;  2YJD A;  1FM6 D;  3V4A A;  2QPY A;  4LNW A;  2HAR A;  3A2J A;  4WLB A;  2IOK A;  3R2A A;  3B66 A;  3GN8 A;  3OLS A;  3X1I A;  3HQ5 A;  3OMO A;  1T5Z A;  5KD9 A;  1RKG A;  5AAU A;  1X7E A;  2NXX A;  2ZK4 A;  4WVD A;  2Q7K A;  2HAS A;  4OK1 A;  5E1C A;  1UHL A;  2Q5G A;  1T65 A;  2AA5 A;  2ATH A;  3TX7 B;  3W5R A;  3OS8 C;  1N46 A;  1ILG A;  1XAP A;  1A28 A;  5DXE A;  3ADX A;  5E0X A;  4ZNS A;  4RFW A;  5EHJ A;  2YAT A;  3U9Q A;  3G8I A;  5DKG A;  1Y9R A;  5C4T A;  4XUH A;  2ZXM A;  4IS8 A;  4N73 A;  4MG9 B;  5DUH A;  3KPZ A;  3G9E A;  4ZNW A;  2ZK2 A;  1NRL A;  4OKX A;  4S15 A;  4DQM A;  1VJB A;  4NB6 A;  1T73 A;  4RZF A;  5DIE A;  3OMM A;  2R6Y A;  3ZQT A;  1FD0 A;  2QGW A;  4JYH A;  4BCR A;  1GWQ A;  1DKF A;  3UUA B;  4R2U A;  3HOD A;  2J4A A;  4OFR A;  2Q6R A;  3MNE A;  2YJA B;  1RJK A;  3ILZ A;  3B0W A;  3SP6 A;  2ZNP A;  3GYT A;  5E14 A;  2YLP A;  2QXM A;  2H77 A;  2VV4 B;  2NPA A;  2ZL9 A;  3AX8 A;  3PCU A;  4HEE X;  2GL8 A;  2ZK3 A;  3VSP A;  5GID A;  3DZU A;  3SZ1 A;  1PQC A;  3E00 D;  3NOA A;  1XVP A;  5F9B A;  5DXR A;  4ZN9 A;  5DV6 A;  1T7T A;  3V3E A;  1U3R A;  4TUZ B;  2R40 A;  2AAX A;  3OKH A;  3OMK A;  5DZI A;  5AZT A;  5IAW A;  5DV3 A;  2AMA A;  3A2H A;  4RE8 A;  3VHU A;  1EXX A;  3AN3 A;  3NSQ A;  1R1K D;  4FN9 A;  4IA7 A;  5KRJ A;  1KKQ A;  5DYB A;  1NQ7 A;  2QAB A;  3DY6 A;  1I38 A;  4S14 A;  5IXK A;  4MGB B;  4POH A;  1Y0S A;  2OM9 A;  3L3X A;  3D90 A;  1YMT A;  3KWY A;  3OKI A;  3UU7 A;  2PIU A;  4PXM A;  3UUD B;  1SQN A;  2GPP A;  2ZK0 A;  3CS6 A;  4PLD A;  5JJM A;  4J5X C;  3AZ2 A;  3QT0 A;  3OSA A;  3VT4 A;  4OED A;  3KMG A;  2PIP L;  1YOK A;  1MV9 A;  1UPW A;  1Y0X X;  1ZUC A;  2HB8 A;  3AZ1 A;  4OEA A;  5HCV A;  5KYA A;  5SYZ A;  1PRG A;  3UVV B;  2VV4 A;  2PNU A;  3HC6 A;  3O1D A;  3K23 A;  3P89 A;  4IUI A;  3P88 A;  4RMD A;  2PIV A;  1Z95 A;  2QGT A;  5AWK A;  3WFG A;  1NUO A;  3PRG A;  5FQP A;  4QE6 A;  2OCF A;  1X7R A;  5DXB B;  1EXA A;  1I37 A;  4UDA A;  4S0T A;  3DZY A;  1UPV A;  3OOF A;  4QL8 A;  5HYK A;  3B1M A;  1RK3 A;  4ITE A;  3NSP A;  2YHD A;  3RUT A;  1XDK B;  2XYJ A;  3IA6 A;  5DU5 A;  3V9V A;  2ZAS A;  2P54 A;  5DWE A;  2PIR A;  3OS8 A;  2IHQ A;  5DWJ A;  1G2N A;  3IXP A;  4MGA B;  3RLL A;  2AMB A;  1K74 A;  4A4W A;  3W0A A;  4OC7 A;  1L2I A;  1YIM A;  2QA8 A;  3FLI A;  3H52 A;  2AM9 A;  3L03 A;  4IV2 A;  1PZL A;  2Q7I A;  4PF3 A;  5KCF A;  4E2J A;  3PLZ A;  4J5W C;  5HJS A;  4MG7 A;  5C4S A;  3WFF A;  5AAV B;  3OZJ A;  4J24 A;  1GS4 A;  2GWX A;  2V0V A;  2ZNN A;  2V7C A;  3GBK A;  1PQ6 A;  2P4Y A;  3E7C A;  4ZN7 A;  2O9I A;  5EI1 A;  5DZ1 A;  3A78 A;  1UOM A;  1FM9 A;  2ZK1 A;  1FCX A;  3VHW A;  2Q6J A;  3VRW A;  4DOS A;  4E4Q A;  1QKN A;  2J7X A;  1T63 A;  1ZAF A;  4OIL A;  5GT4 A;  2O4J A;  5KYJ A;  5DKS A;  1X7J A;  1XOW A;  4YT1 A;  5L7E A;  4IU7 A;  4WHG A;  4PPP A;  4OAR A;  1HJ1 A;  1XDK A;  4LSJ A;  4X1F A;  5DUE A;  3DZU D;  2ZFX A;  2AB2 A;  1XQ3 A;  5DXK A;  1ERR A;  4PP6 A;  3OMQ A;  3KFC A;  3SP9 A;  4OEZ A;  2R40 D;  3VT7 A;  4NIE A;  2B1V A;  4K4J A;  3VTB A;  3WTQ A;  2PIX A;  5HZC A;  2E2R A;  4NQA B;  1Z5X E;  5E19 A;  2G44 A;  5DX3 A;  2A3I A;  1X78 A;  4RME A;  5DV8 A;  5G43 A;  3W0G A;  3A9E B;  3F5C A;  2GPV A;  4UDD A;  2POG A;  3OLF A;  1G5Y A;  2YLY A;  3AUN A;  2JJ3 A;  3FC6 A;  4Q0A C;  2P7A A;  3R5N A;  5KRI A;  1XJ7 A;  2VV2 A;  2Z4J A;  4IA3 A;  5CJ6 A;  4OKT A;  2AX9 A;  2QTU A;  1T74 A;  4JYG A;  4OHA A;  2Q59 B;  3VT8 A;  4M8H A;  4J5X A;  1OVL A;  3W0Y A;  1MVC A;  1G1U A;  2B50 A;  4R06 A;  1NDE A;  1E3G A;  1SKX A;  4EMA A;  1M7W A;  3JZB A;  3V3Q A;  4HLW A;  3OLL A;  3UP3 A;  1S9P A;  4MGC A;  2XYW A;  3ET2 A;  4J26 A;  2PIT A;  3RLJ A;  1E3K A;  1YJE A;  2F4B A;  1KNU A;  2Q1V A;  1YOW A;  3B68 A;  3B5R A;  4DOR A;  5DVC A;  2P1V A;  1ZDU A;  2HBH A;  4REF A;  4DM6 A;  2LBD A;  4G21 A;  3W0H A;  3DZY D;  1XP1 A;  5ICK A;  5AVI A;  3OSW A;  1QKU A;  3B0Q A;  2P7Z A;  3VSO A;  3Q95 A;  2JFA B;  2QMV A;  2I4J A;  3AZ3 A;  4P6X A;  2R6W A;  4OJ4 A;  5DKE A;  5ETH A;  3VRU A;  3IXP D;  2EWP A;  1TFC A;  2PIQ A;  3OGT A;  2ACL B;  2P1U A;  4MDD A;  4G1Y A;  4OLM A;  1K74 D;  3P8X A;  5DZH A;  3OMP A;  5KR9 A;  2FAI A;  5DY8 A;  3HZF A;  4MGD B;  2ZBS A;  4XI3 A;  1YA3 A;  4J5W A;  4IW6 A;  3VTD A;  5FQT A;  4OIU A;  2VV1 B;  4OJ9 A;  3RY9 A;  3W5T A;  3AUR A;  2QR9 A;  5JI0 D;  2IOG A;  1YY4 A;  4IQR A;  1U9E A;  2AX6 A;  1LBD A;  3GYU A;  2AX8 A;  5KCW A;  1FM9 D;  1ZDT A;  2BJ4 B;  2YLO A;  3AN4 A;  3D24 A;  3KMZ A;  4MG9 A;  4N5G A;  3R5M A;  5DXP A;  3B0T A;  4ONI A;  4Q13 A;  5HJP B;  3VHV A;  5DZ0 A;  2AO6 A;  4KZM A;  2Q5P A;  5DYD A;  3CLD A;  5A86 A;  4ITF A;  4IA1 A;  4RUO X;  3WGP A;  5L11 A;  4PVU A;  2JFA A;  2QSE A;  4IWF A;  4WPF A;  1NHZ A;  3UUA A;  4UDC A;  5DL4 A;  2XYX A;  5DVV A;  3ZRA A;  2I4Z A;  4XTA A;  4YNK A;  2FSZ A;  1Z5X U;  5FQS A;  1M2Z A;  3O1E A;  3BC5 A;  3ADW A;  2P15 A;  4OKB A;  2HAM A;  3S9S A;  1XV9 B;  1BSX A;  3IPQ A;  1OSH A;  4OH5 A;  4IA2 A;  4TUZ A;  3D5F A;  3M7R A;  1PK5 A;  5LGA A;  2OUZ A;  1NQ0 A;  3PBA A;  2G0G A;  2PIO A;  1TXI A;  3F7D A;  5B41 A;  2ZXZ A;  4DK7 A;  2OVM A;  3H0A A;  1YYE A;  4A2J A;  5KCT A;  1XP9 A;  4IWC A;  4MG8 B;  4MGB A;  5L7H A;  3V9T A;  2QA6 A;  4LBD A;  5C4O A;  3FEJ A;  3HVL A;  1IE8 A;  3MNO A;  3CDS A;  2I0J A;  3W0J A;  3L0L A;  3UUD A;  2G0H A;  1I7G A;  2ZMH A;  3OAP A;  1NAV A;  4FGY A;  3UP0 A;  4OH6 A;  2Q3Y A;  1ZKY A;  4TV1 B;  3GWS X;  5LWP A;  1R6G A;  4NY9 A;  5APK A;  1XLS E;  2HFP A;  2ZK5 A;  5KRF A;  4L96 A;  3JZC A;  5DTV A;  1RDT A;  5FQV A;  3WT5 A;  2Q5S A;  3FEI A;  3R8D A;  3PO9 A;  5DXG A;  2ZK6 A;  1I7I A;  2B1Z A;  1L2J A;  2OAX A;  4N8R A;  2O4R A;  3LMP A;  4KZJ A;  5DP0 A;  4DMA A;  1NQ1 A;  4RZG A;  3W5Q A;  5IZ0 A;  4L98 A;  5DXB A;  5FQR A;  3IMY A;  3D6D A;  3B0R A;  3FAL B;  4QM0 A;  3KDU A;  5DMF A;  2GPU A;  1X76 A;  1IE9 A;  2QZO B;  2AA7 A;  3X31 A;  4CSJ A;  1GWR A;  2ZLC A;  5DWI A;  1NAX A;  4O8F A;  1WM0 X;  1ZH7 A;  3ET1 A;  4ZNU A;  4YPQ A;  1N4H A;  4RZE A;  2ZVT A;  1GWX A;  2Q61 A;  4MGA A;  2PKL A;  4ZNH A;  3X1H A;  3VT6 A;  5KRC A;  3ET0 A;  3DCU A;  1XNN A;  3FUG A;  4TV1 A;  5JY3 A;  4G2H A;  3CJW A;  2AX7 A;  1S9Q A;  4N1Y A;  3VI8 A;  2QXS A;  2AWH A;  1UHL B;  2FVJ A;  3D57 A;  5APJ A;  3WJ4 A;  5AAV A;  2Q7J A;  4Y29 A;  5E7V A;  4WHF A;  2NXX E;  2I4P A;  2POB A;  2QE4 A;  3CQV A;  3KBA A;  4ZOM A;  5EC9 A;  3RVF A;  5DXM A;  3R8I A;  1YIN A;  1XIU A;  4MG5 A;  4ZO1 X;  3X36 A;  3W5P A;  4OGH A;  4ZI1 A;  4MG6 A;  4RMC A;  3TKM A;  2ABI A;  4OJB A;  5KRH A;  2YFE A;  2Q60 A;  3LBD A;  3V49 A;  3N00 A;  1SR7 A;  2ZLA A;  3G0W A;  4F9M A;  1ERE A;  1FBY A;  3VT5 A;  3GD2 A;  1NQ2 A;  5EJV A;  1XZX X;  4PPS A;  3WT7 A;  3L1B A;  3ERT A;  2H79 A;  3ADU A;  3A3Z X;  1Q4X A;  5AWJ A;  1DKF B;  5GIC A;  2P1T A;  3ET3 A;  3V9Y A;  4G1Z A;  1T7R A;  4OFU A;  3FUR A;  1R20 A;  5KRA A;  3GWX A;  2XHS A;  1S0Z A;  5GIE A;  2PIN A;  5DK9 A;  3A2I A;  4YMQ A;  1XB7 A;  1N83 A;  3A9E A;  3K8S A;  4CI4 A;  3H0A D;  3VRV A;  3ZRB A;  5I4V A;  2HC4 A;  5KRM A;  5G5W A;  1XVP B;  1T79 A;  3OSI A;  2AA6 A;  2Q70 A;  4QJR A;  4RUJ A;  5C4U A;  3OS9 A;  5M96 A;  2Q59 A;  4G1D A;  5DMC A;  5H1E A;  3VJT A;  3UUC A;  2GIU A;  5DWG A;  1RKH A;  2ZXN A;  5E15 A;  4CI5 A;  4WQP A;  4IVW A;  5DIG A;  1ZGY A;  3PEQ A;  1FCZ A;  3BQD A;  5DUG A;  5EGV A;  5KCE A;  4KZI A;  4M8E A;  1RDT D;  4OZT E;  1OT7 A;  4REE A;  3HM1 A;  3AFR A;  5K13 A;  3UU7 B;  2OVH A;  4FHH A;  2ZNQ A;  3ERD A;  5DI7 A;  3VT9 A;  5JJM B;  4RAK A;  5KCU A;  3ADV A;  5KRL A;  3R8A A;  5G46 A;  4RUP A;  1HG4 A;  4EM9 A;  3VRT A;  4PLE A;  5EIT A;  5AVL A;  1X7B A;  4Q50 A;  4FNE A;  3W0I A;  4PP3 A;  4XUM A;  3L3Z A;  3VJI A;  5DID A;  1QKT A;  1T7F A;  5ACC A;  1XP6 A;  4OZR E;  4XHD A;  4PP5 A;  2ACL A;  2HWQ A;  5G3J A;  4ZJR A;  4K7A A;  3CTB A;  3VJH A;  4OEY A;  4PWL A;  4B7W A;  5KCD A;  4MGD A;  3WT6 A;  2VSR A;  2GPO A;  1QKM A;  2W8Y A;  1FM6 A;  5B5B A;  3DCT A;  2VV1 A;  3ZR7 A;  3P0U A;  2B23 A;  3VJS A;  2Q1H A;  5DRJ A;  1XQC A;  4IV4 A;  1K4W A;  5DKB A;  4JL4 A;  5KRO A;  2BAW A;  1PDU A;  2BJ4 A;  2QA8 B;  1H9U A;  1MZN A;  3UVV A;  2NV7 A;  1U3Q A;  4JYI A;  4ZJW A;  5HJP A;  3DT3 A;  5G45 A;  4APU A;  4MG7 B;  1SJ0 A;  4PRG A;  2ZMJ A;  5HYR A;  4POJ A;  4P6W A;  1R5K A;  3B67 A;  4OIV A;  5DWL A;  2GP7 A;  4IW8 A;  1U3S A;  5DXQ A;  3K22 A;  5DZ3 A;  2ZMI A;  1K7L A;  1PCG A;  3VN2 A;  1P8D A;  3E94 A;  4QE8 A;  2REW A;  4ZO1 B;  5L7G A;  3BEJ A;  2QW4 A;  2OZ7 A;  2ZNO A;  2HB7 A;  1R20 D;  2Q8S A;  4ZNT A;  2J14 A;  2VV0 A;  3T03 A;  2PJL A;  3L0J A;  4LTW A;  5DLR A;  4NUF A;  2PRG A;  2AYR A;  2ZKC A;  1XV9 A;  3G8O A;  5AZV A;  5DRM A;  1FCY A;  2ZY0 A;  4OKW A;  2Z4B A;  1PQ9 A;  4DM8 A;  4XAO A;  3FXV A;  1NYX A;  3R29 A;  1T7M A;  1ILH A;  4JAZ A;  5G42 A;  1YP0 A;  4JGV A;  2HCD A;  2QH6 A;  4UDB A;  2I0G A;  3KYT A;  5AYG A;  3W0C A;  3CS4 A;  5DX3 B;  3WJ5 A;  3HLV A;  3IPU A;  3MNP A;  4MG8 A;  1S0X A;  2JF9 A;  3F5C B;  3HO0 A;  3E00 A;  3FC6 B;  3FS1 A;  1ZEO A;  2VST A;  3K6P A;  4G2I A;  4OZT U;  4S0S A;  1XLS A;  3CWD A;  1OSV A;  1S19 A;  1T76 A;  3IPS A;  4XT9 A;  2NW4 A;  2HVC A;  1R1K A;  3RUU A;  3B65 A;  2Q6S A;  4G20 A;  1OVL B;  5KRK A;  5APH A;  4QK4 A;  1KV6 A;  2AXA A;  1DB1 A;  3ADS A;  2PIW A;  2XKW A;  5DVS A;  3CDP A;  1A52 A;  1LV2 A;  1YUC A;  4E4K A;  4XLD A;  3HC5 A;  4ZNV A;  5AK2 A;  3TY0 A;  2AA2 A;  4FHI A;  3EYB A;  3KDT A;  5G44 A;  5E0W A;  4X1G A;  2YLQ A;  3A40 X;  3ADT A;  2G5O A;  3DR1 A;  4DK8 A;  4LNX A;  3WWR A;  4R6S A; 
#chains in the Genus database with same CATH homology
 1P93 A;  3CS8 A;  3VT3 A;  1XNX A;  3FAL A;  4OZR U;  2QNV A;  3B3K A;  3WMH A;  5KCC A;  2VV3 A;  1M13 A;  3GZ9 A;  1XPC A;  3OOK A;  3KMR A;  4A4V A;  2QZO A;  1G50 A;  2J7Y A;  4K6I A;  2HWR A;  3AUQ A;  2P7G A;  3OZ0 A;  3VTC A;  2GTK A;  4IVY A;  4RWV A;  3L0E A;  2Q7L A;  3Q95 B;  5DSH A;  3TKC A;  2YJD A;  1FM6 D;  3V4A A;  2QPY A;  4LNW A;  2HAR A;  3A2J A;  4WLB A;  2IOK A;  3R2A A;  3B66 A;  3GN8 A;  3OLS A;  3X1I A;  3HQ5 A;  3OMO A;  1T5Z A;  5KD9 A;  1RKG A;  5AAU A;  1X7E A;  2NXX A;  2ZK4 A;  4WVD A;  2Q7K A;  2HAS A;  4OK1 A;  5E1C A;  1UHL A;  2Q5G A;  1T65 A;  2AA5 A;  2ATH A;  3TX7 B;  3W5R A;  3OS8 C;  1N46 A;  1ILG A;  1XAP A;  1A28 A;  5DXE A;  3ADX A;  5E0X A;  4ZNS A;  4RFW A;  5EHJ A;  2YAT A;  3U9Q A;  3G8I A;  5DKG A;  1Y9R A;  5C4T A;  4XUH A;  2ZXM A;  4IS8 A;  4N73 A;  4MG9 B;  5DUH A;  3KPZ A;  3G9E A;  4ZNW A;  2ZK2 A;  1NRL A;  4OKX A;  4S15 A;  4DQM A;  1VJB A;  4NB6 A;  1T73 A;  4RZF A;  5DIE A;  3OMM A;  2R6Y A;  3ZQT A;  1FD0 A;  2QGW A;  4JYH A;  4BCR A;  1GWQ A;  1DKF A;  3UUA B;  4R2U A;  3HOD A;  2J4A A;  4OFR A;  2Q6R A;  3MNE A;  2YJA B;  1RJK A;  3ILZ A;  3B0W A;  3SP6 A;  2ZNP A;  3GYT A;  5E14 A;  2YLP A;  2QXM A;  2H77 A;  2VV4 B;  2NPA A;  2ZL9 A;  3AX8 A;  3PCU A;  4HEE X;  2GL8 A;  2ZK3 A;  3VSP A;  5GID A;  3DZU A;  3SZ1 A;  1PQC A;  3E00 D;  3NOA A;  1XVP A;  5F9B A;  5DXR A;  4ZN9 A;  5DV6 A;  1T7T A;  3V3E A;  1U3R A;  4TUZ B;  2R40 A;  2AAX A;  3OKH A;  3OMK A;  5DZI A;  5AZT A;  5IAW A;  5DV3 A;  2AMA A;  3A2H A;  4RE8 A;  3VHU A;  1EXX A;  3AN3 A;  3NSQ A;  1R1K D;  4FN9 A;  4IA7 A;  5KRJ A;  1KKQ A;  5DYB A;  1NQ7 A;  2QAB A;  3DY6 A;  1I38 A;  4S14 A;  5IXK A;  4MGB B;  4POH A;  1Y0S A;  2OM9 A;  3L3X A;  3D90 A;  1YMT A;  3KWY A;  3OKI A;  3UU7 A;  2PIU A;  4PXM A;  3UUD B;  1SQN A;  2GPP A;  2ZK0 A;  3CS6 A;  4PLD A;  5JJM A;  4J5X C;  3AZ2 A;  3QT0 A;  3OSA A;  3VT4 A;  4OED A;  3KMG A;  2PIP L;  1YOK A;  1MV9 A;  1UPW A;  1Y0X X;  1ZUC A;  2HB8 A;  3AZ1 A;  4OEA A;  5HCV A;  5KYA A;  5SYZ A;  1PRG A;  3UVV B;  2VV4 A;  2PNU A;  3HC6 A;  3O1D A;  3K23 A;  3P89 A;  4IUI A;  3P88 A;  4RMD A;  2PIV A;  1Z95 A;  2QGT A;  5AWK A;  3WFG A;  1NUO A;  3PRG A;  5FQP A;  4QE6 A;  2OCF A;  1X7R A;  5DXB B;  1EXA A;  1I37 A;  4UDA A;  4S0T A;  3DZY A;  1UPV A;  3OOF A;  4QL8 A;  5HYK A;  3B1M A;  1RK3 A;  4ITE A;  3NSP A;  2YHD A;  3RUT A;  1XDK B;  2XYJ A;  3IA6 A;  5DU5 A;  3V9V A;  2ZAS A;  2P54 A;  5DWE A;  2PIR A;  3OS8 A;  2IHQ A;  5DWJ A;  1G2N A;  3IXP A;  4MGA B;  3RLL A;  2AMB A;  1K74 A;  4A4W A;  3W0A A;  4OC7 A;  1L2I A;  1YIM A;  2QA8 A;  3FLI A;  3H52 A;  2AM9 A;  3L03 A;  4IV2 A;  1PZL A;  2Q7I A;  4PF3 A;  5KCF A;  4E2J A;  3PLZ A;  4J5W C;  5HJS A;  4MG7 A;  5C4S A;  3WFF A;  5AAV B;  3OZJ A;  4J24 A;  1GS4 A;  2GWX A;  2V0V A;  2ZNN A;  2V7C A;  3GBK A;  1PQ6 A;  2P4Y A;  3E7C A;  4ZN7 A;  2O9I A;  5EI1 A;  5DZ1 A;  3A78 A;  1UOM A;  1FM9 A;  2ZK1 A;  1FCX A;  3VHW A;  2Q6J A;  3VRW A;  4DOS A;  4E4Q A;  1QKN A;  2J7X A;  1T63 A;  1ZAF A;  4OIL A;  5GT4 A;  2O4J A;  5KYJ A;  5DKS A;  1X7J A;  1XOW A;  4YT1 A;  5L7E A;  4IU7 A;  4WHG A;  4PPP A;  4OAR A;  1HJ1 A;  1XDK A;  4LSJ A;  4X1F A;  5DUE A;  3DZU D;  2ZFX A;  2AB2 A;  1XQ3 A;  5DXK A;  1ERR A;  4PP6 A;  3OMQ A;  3KFC A;  3SP9 A;  4OEZ A;  2R40 D;  3VT7 A;  4NIE A;  2B1V A;  4K4J A;  3VTB A;  3WTQ A;  2PIX A;  5HZC A;  2E2R A;  4NQA B;  1Z5X E;  5E19 A;  2G44 A;  5DX3 A;  2A3I A;  1X78 A;  4RME A;  5DV8 A;  5G43 A;  3W0G A;  3A9E B;  3F5C A;  2GPV A;  4UDD A;  2POG A;  3OLF A;  1G5Y A;  2YLY A;  3AUN A;  2JJ3 A;  3FC6 A;  4Q0A C;  2P7A A;  3R5N A;  5KRI A;  1XJ7 A;  2VV2 A;  2Z4J A;  4IA3 A;  5CJ6 A;  4OKT A;  2AX9 A;  2QTU A;  1T74 A;  4JYG A;  4OHA A;  2Q59 B;  3VT8 A;  4M8H A;  4J5X A;  1OVL A;  3W0Y A;  1MVC A;  1G1U A;  2B50 A;  4R06 A;  1NDE A;  1E3G A;  1SKX A;  4EMA A;  1M7W A;  3JZB A;  3V3Q A;  4HLW A;  3OLL A;  3UP3 A;  1S9P A;  4MGC A;  2XYW A;  3ET2 A;  4J26 A;  2PIT A;  3RLJ A;  1E3K A;  1YJE A;  2F4B A;  1KNU A;  2Q1V A;  1YOW A;  3B68 A;  3B5R A;  4DOR A;  5DVC A;  2P1V A;  1ZDU A;  2HBH A;  4REF A;  4DM6 A;  2LBD A;  4G21 A;  3W0H A;  3DZY D;  1XP1 A;  5ICK A;  5AVI A;  3OSW A;  1QKU A;  3B0Q A;  2P7Z A;  3VSO A;  3Q95 A;  2JFA B;  2QMV A;  2I4J A;  3AZ3 A;  4P6X A;  2R6W A;  4OJ4 A;  5DKE A;  5ETH A;  3VRU A;  3IXP D;  2EWP A;  1TFC A;  2PIQ A;  3OGT A;  2ACL B;  2P1U A;  4MDD A;  4G1Y A;  4OLM A;  1K74 D;  3P8X A;  5DZH A;  3OMP A;  5KR9 A;  2FAI A;  5DY8 A;  3HZF A;  4MGD B;  2ZBS A;  4XI3 A;  1YA3 A;  4J5W A;  4IW6 A;  3VTD A;  5FQT A;  4OIU A;  2VV1 B;  4OJ9 A;  3RY9 A;  3W5T A;  3AUR A;  2QR9 A;  5JI0 D;  2IOG A;  1YY4 A;  4IQR A;  1U9E A;  2AX6 A;  1LBD A;  3GYU A;  2AX8 A;  5KCW A;  1FM9 D;  1ZDT A;  2BJ4 B;  2YLO A;  3AN4 A;  3D24 A;  3KMZ A;  4MG9 A;  4N5G A;  3R5M A;  5DXP A;  3B0T A;  4ONI A;  4Q13 A;  5HJP B;  3VHV A;  5DZ0 A;  2AO6 A;  4KZM A;  2Q5P A;  5DYD A;  3CLD A;  5A86 A;  4ITF A;  4IA1 A;  4RUO X;  3WGP A;  5L11 A;  4PVU A;  2JFA A;  2QSE A;  4IWF A;  4WPF A;  1NHZ A;  3UUA A;  4UDC A;  5DL4 A;  2XYX A;  5DVV A;  3ZRA A;  2I4Z A;  4XTA A;  4YNK A;  2FSZ A;  1Z5X U;  5FQS A;  1M2Z A;  3O1E A;  3BC5 A;  3ADW A;  2P15 A;  4OKB A;  2HAM A;  3S9S A;  1XV9 B;  1BSX A;  3IPQ A;  1OSH A;  4OH5 A;  4IA2 A;  4TUZ A;  3D5F A;  3M7R A;  1PK5 A;  5LGA A;  2OUZ A;  1NQ0 A;  3PBA A;  2G0G A;  2PIO A;  1TXI A;  3F7D A;  5B41 A;  2ZXZ A;  4DK7 A;  2OVM A;  3H0A A;  1YYE A;  4A2J A;  5KCT A;  1XP9 A;  4IWC A;  4MG8 B;  4MGB A;  5L7H A;  3V9T A;  2QA6 A;  4LBD A;  5C4O A;  3FEJ A;  3HVL A;  1IE8 A;  3MNO A;  3CDS A;  2I0J A;  3W0J A;  3L0L A;  3UUD A;  2G0H A;  1I7G A;  2ZMH A;  3OAP A;  1NAV A;  4FGY A;  3UP0 A;  4OH6 A;  2Q3Y A;  1ZKY A;  4TV1 B;  3GWS X;  5LWP A;  1R6G A;  4NY9 A;  5APK A;  1XLS E;  2HFP A;  2ZK5 A;  5KRF A;  4L96 A;  3JZC A;  5DTV A;  1RDT A;  5FQV A;  3WT5 A;  2Q5S A;  3FEI A;  3R8D A;  3PO9 A;  5DXG A;  2ZK6 A;  1I7I A;  2B1Z A;  1L2J A;  2OAX A;  4N8R A;  2O4R A;  3LMP A;  4KZJ A;  5DP0 A;  4DMA A;  1NQ1 A;  4RZG A;  3W5Q A;  5IZ0 A;  4L98 A;  5DXB A;  5FQR A;  3IMY A;  3D6D A;  3B0R A;  3FAL B;  4QM0 A;  3KDU A;  5DMF A;  2GPU A;  1X76 A;  1IE9 A;  2QZO B;  2AA7 A;  3X31 A;  4CSJ A;  1GWR A;  2ZLC A;  5DWI A;  1NAX A;  4O8F A;  1WM0 X;  1ZH7 A;  3ET1 A;  4ZNU A;  4YPQ A;  1N4H A;  4RZE A;  2ZVT A;  1GWX A;  2Q61 A;  4MGA A;  2PKL A;  4ZNH A;  3X1H A;  3VT6 A;  5KRC A;  3ET0 A;  3DCU A;  1XNN A;  3FUG A;  4TV1 A;  5JY3 A;  4G2H A;  3CJW A;  2AX7 A;  1S9Q A;  4N1Y A;  3VI8 A;  2QXS A;  2AWH A;  1UHL B;  2FVJ A;  3D57 A;  5APJ A;  3WJ4 A;  5AAV A;  2Q7J A;  4Y29 A;  5E7V A;  4WHF A;  2NXX E;  2I4P A;  2POB A;  2QE4 A;  3CQV A;  3KBA A;  4ZOM A;  5EC9 A;  3RVF A;  5DXM A;  3R8I A;  1YIN A;  1XIU A;  4MG5 A;  4ZO1 X;  3X36 A;  3W5P A;  4OGH A;  4ZI1 A;  4MG6 A;  4RMC A;  3TKM A;  2ABI A;  4OJB A;  5KRH A;  2YFE A;  2Q60 A;  3LBD A;  3V49 A;  3N00 A;  1SR7 A;  2ZLA A;  3G0W A;  4F9M A;  1ERE A;  1FBY A;  3VT5 A;  3GD2 A;  1NQ2 A;  5EJV A;  1XZX X;  4PPS A;  3WT7 A;  3L1B A;  3ERT A;  2H79 A;  3ADU A;  3A3Z X;  1Q4X A;  5AWJ A;  1DKF B;  5GIC A;  2P1T A;  3ET3 A;  3V9Y A;  4G1Z A;  1T7R A;  4OFU A;  3FUR A;  1R20 A;  5KRA A;  3GWX A;  2XHS A;  1S0Z A;  5GIE A;  2PIN A;  5DK9 A;  3A2I A;  4YMQ A;  1XB7 A;  1N83 A;  3A9E A;  3K8S A;  4CI4 A;  3H0A D;  3VRV A;  3ZRB A;  5I4V A;  2HC4 A;  5KRM A;  5G5W A;  1XVP B;  1T79 A;  3OSI A;  2AA6 A;  2Q70 A;  4QJR A;  4RUJ A;  5C4U A;  3OS9 A;  5M96 A;  2Q59 A;  4G1D A;  5DMC A;  5H1E A;  3VJT A;  3UUC A;  2GIU A;  5DWG A;  1RKH A;  2ZXN A;  5E15 A;  4CI5 A;  4WQP A;  4IVW A;  5DIG A;  1ZGY A;  3PEQ A;  1FCZ A;  3BQD A;  5DUG A;  5EGV A;  5KCE A;  4KZI A;  4M8E A;  1RDT D;  4OZT E;  1OT7 A;  4REE A;  3HM1 A;  3AFR A;  5K13 A;  3UU7 B;  2OVH A;  4FHH A;  2ZNQ A;  3ERD A;  5DI7 A;  3VT9 A;  5JJM B;  4RAK A;  5KCU A;  3ADV A;  5KRL A;  3R8A A;  5G46 A;  4RUP A;  1HG4 A;  4EM9 A;  3VRT A;  4PLE A;  5EIT A;  5AVL A;  1X7B A;  4Q50 A;  4FNE A;  3W0I A;  4PP3 A;  4XUM A;  3L3Z A;  3VJI A;  5DID A;  1QKT A;  1T7F A;  5ACC A;  1XP6 A;  4OZR E;  4XHD A;  4PP5 A;  2ACL A;  2HWQ A;  5G3J A;  4ZJR A;  4K7A A;  3CTB A;  3VJH A;  4OEY A;  4PWL A;  4B7W A;  5KCD A;  4MGD A;  3WT6 A;  2VSR A;  2GPO A;  1QKM A;  2W8Y A;  1FM6 A;  5B5B A;  3DCT A;  2VV1 A;  3ZR7 A;  3P0U A;  2B23 A;  3VJS A;  2Q1H A;  5DRJ A;  1XQC A;  4IV4 A;  1K4W A;  5DKB A;  4JL4 A;  5KRO A;  2BAW A;  1PDU A;  2BJ4 A;  2QA8 B;  1H9U A;  1MZN A;  3UVV A;  2NV7 A;  1U3Q A;  4JYI A;  4ZJW A;  5HJP A;  3DT3 A;  5G45 A;  4APU A;  4MG7 B;  1SJ0 A;  4PRG A;  2ZMJ A;  5HYR A;  4POJ A;  4P6W A;  1R5K A;  3B67 A;  4OIV A;  5DWL A;  2GP7 A;  4IW8 A;  1U3S A;  5DXQ A;  3K22 A;  5DZ3 A;  2ZMI A;  1K7L A;  1PCG A;  3VN2 A;  1P8D A;  3E94 A;  4QE8 A;  2REW A;  4ZO1 B;  5L7G A;  3BEJ A;  2QW4 A;  2OZ7 A;  2ZNO A;  2HB7 A;  1R20 D;  2Q8S A;  4ZNT A;  2J14 A;  2VV0 A;  3T03 A;  2PJL A;  3L0J A;  4LTW A;  5DLR A;  4NUF A;  2PRG A;  2AYR A;  2ZKC A;  1XV9 A;  3G8O A;  5AZV A;  5DRM A;  1FCY A;  2ZY0 A;  4OKW A;  2Z4B A;  1PQ9 A;  4DM8 A;  4XAO A;  3FXV A;  1NYX A;  3R29 A;  1T7M A;  1ILH A;  4JAZ A;  5G42 A;  1YP0 A;  4JGV A;  2HCD A;  2QH6 A;  4UDB A;  2I0G A;  3KYT A;  5AYG A;  3W0C A;  3CS4 A;  5DX3 B;  3WJ5 A;  3HLV A;  3IPU A;  3MNP A;  4MG8 A;  1S0X A;  2JF9 A;  3F5C B;  3HO0 A;  3E00 A;  3FC6 B;  3FS1 A;  1ZEO A;  2VST A;  3K6P A;  4G2I A;  4OZT U;  4S0S A;  1XLS A;  3CWD A;  1OSV A;  1S19 A;  1T76 A;  3IPS A;  4XT9 A;  2NW4 A;  2HVC A;  1R1K A;  3RUU A;  3B65 A;  2Q6S A;  4G20 A;  1OVL B;  5KRK A;  5APH A;  4QK4 A;  1KV6 A;  2AXA A;  1DB1 A;  3ADS A;  2PIW A;  2XKW A;  5DVS A;  3CDP A;  1A52 A;  1LV2 A;  1YUC A;  4E4K A;  4XLD A;  3HC5 A;  4ZNV A;  5AK2 A;  3TY0 A;  2AA2 A;  4FHI A;  3EYB A;  3KDT A;  5G44 A;  5E0W A;  4X1G A;  2YLQ A;  3A40 X;  3ADT A;  2G5O A;  3DR1 A;  4DK8 A;  4LNX A;  3WWR A;  4R6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...