3UUDA

Crystal structure of hera-lbd (y537s) in complex with estradiol
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
245
structure length
240
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLEAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKKNVVPLSDLLLEMLDAHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic insights into bisphenols action provide guidelines for risk assessment and discovery of bisphenol A substitutes.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Hormone receptor
source organism Homo sapiens
total genus 90
structure length 240
sequence length 245
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3uudA00
4DQMA 2HVCA 1IE9A 1P93A 2ZK0A 5DXBA 3DCTA 2QSEA 2OVHA 3WTQA 4WQPA 1Y0XX 4OKWA 4CI4A 3V3QA 3UUDB 5DRMA 5DUGA 5DX3B 5G42A 2HFPA 3A9EB 2HBHA 2XYXA 3G8IA 2ZXMA 2ZBSA 2AX6A 2POGA 1OVLA 5DXPA 3R8DA 3WT6A 4IV4A 1X7BA 1Z95A 4J5WA 4N73A 1Z5XU 4RZEA 4FGYA 4UDCA 3UU7B 3F7DA 4LTWA 3TX7B 3L0JA 3AUNA 3OSWA 4MG7B 4DK8A 5KCEA 5AAVB 3RLLA 3UVVA 2P54A 5DUHA 2QGWA 2ZLAA 4FN9A 1LV2A 1QKUA 2J7XA 4REEA 3FEJA 1T76A 1FCYA 3VRWA 4S0TA 3VT3A 3G9EA 2AXAA 3FUGA 3OMPA 3ADSA 5KRIA 3OMOA 1U3SA 1IE8A 5CJ6A 5DWJA 2ACLA 4F9MA 4E2JA 4IA1A 1GS4A 1SR7A 2ZFXA 4ZN9A 1PRGA 2JFAB 4J5XC 1MV9A 3OLSA 3B66A 1ZAFA 3BEJA 4WHGA 4X1FA 5KCUA 3KMRA 2BJ4B 2Q6RA 2B50A 1UHLA 3RUUA 4UDAA 4OH6A 4E4QA 1YOWA 3W0CA 5APKA 4PP3A 2PIVA 5G44A 2AMAA 3B68A 1PDUA 2R6YA 4HEEX 1MZNA 2AA5A 4DORA 3ET3A 3ET0A 3JZBA 5L11A 5IXKA 2QR9A 2Q5SA 2HARA 3KMGA 2PKLA 1T7RA 3FS1A 3KFCA 5G45A 3WT7A 2Q6JA 1R20D 2ZXZA 2B1ZA 3UU7A 2PIOA 4POJA 1KNUA 2GTKA 3LBDA 4MGAB 3CS8A 4ZO1X 5DXEA 5AAVA 5JJMB 2QA8B 5DZ3A 2I4ZA 3ADUA 1FM9A 2H77A 1T7TA 4IWFA 3ADWA 1NQ7A 1NQ0A 3VT7A 3VT8A 5C4UA 4DMAA 1M7WA 4N8RA 1RK3A 1L2JA 2GIUA 4MG5A 1YP0A 4JL4A 4JGVA 4PLDA 2P4YA 1NDEA 1PQCA 4TV1A 3BC5A 3L0EA 1U3QA 4EMAA 2V0VA 4WVDA 5A86A 5GT4A 3D5FA 3R8IA 2B1VA 1OSHA 2JFAA 3RY9A 2ZK6A 3MNOA 4PP5A 5K13A 4OFUA 1XP9A 1SJ0A 2I4PA 3KBAA 2BJ4A 3SZ1A 3GD2A 3B0TA 4M8EA 5KRKA 4RUPA 1I38A 4JYGA 5HJPB 1XNXA 5LGAA 3ADVA 3GWSX 5KCWA 1X76A 5DXMA 3ET1A 3OS8C 2YFEA 1S0ZA 1R1KD 1E3GA 3PEQA 5FQTA 4MGDB 3X1HA 3FALB 2B23A 4JYIA 4PP6A 1FBYA 2PIWA 2ZNQA 2R40D 4J5XA 5KYJA 3HQ5A 5C4SA 3ET2A 3K8SA 1P8DA 4OJ9A 5E0XA 2ZXNA 1ZDTA 2OZ7A 5ACCA 1MVCA 5JJMA 2QA8A 2VV1B 3AX8A 3TY0A 4RWVA 1K7LA 3VHWA 3B0QA 3K23A 2ZKCA 3OMQA 3PCUA 1SKXA 5E1CA 2PIQA 2QMVA 3H0AA 3GYUA 3WJ5A 5DV8A 4PPPA 2AA6A 4XAOA 2GPPA 2P7GA 1QKMA 1NQ2A 3WFGA 4HLWA 3D57A 3FC6A 1G2NA 4RUOX 3RVFA 5DXQA 3UP3A 3HLVA 4NIEA 1S9QA 2PIXA 5DYDA 3KDUA 4ITEA 4S14A 4S0SA 5IAWA 1I7IA 2P7ZA 5DZIA 3VI8A 1H9UA 1RDTA 2PRGA 3OMKA 2GWXA 4MG9A 1PZLA 4XI3A 3VRVA 4G21A 1RDTD 4RZFA 4ZNVA 1T63A 3W0JA 4XUHA 4R2UA 5DIGA 5KCTA 2G44A 2XYJA 3ERDA 4ZNSA 3VJHA 3R5NA 3FALA 5G46A 3U9QA 3TKCA 3OLFA 1ERRA 2YLPA 3AUQA 3UUCA 4K7AA 1OT7A 2Q7JA 2PNUA 3NSPA 1TFCA 3W0YA 1TXIA 1UPVA 1G5YA 2V7CA 3DY6A 5DL4A 4E4KA 1OSVA 4PXMA 1DB1A 3KWYA 2YJAB 4R06A 3OOKA 3EYBA 2Q6SA 1YUCA 4TUZB 2YLOA 4NQAB 3VJTA 3HZFA 4PRGA 3OS8A 3W0HA 4WPFA 4RE8A 1T73A 3R29A 5DK9A 5FQSA 2ZMHA 4A4VA 3B1MA 1FCZA 2XHSA 3D24A 4OK1A 1EXAA 2A3IA 3RUTA 3W5RA 1ZGYA 5L7EA 4LBDA 3P88A 4IU7A 3UUAA 2Q1VA 1WM0X 4DOSA 1XPCA 3L1BA 4ITFA 2PITA 2Q7LA 4OIVA 3MNPA 5KRFA 1HJ1A 3OKIA 4OZRE 2NV7A 2Q5GA 2OCFA 4ZNTA 2QZOA 4QL8A 5GIDA 5H1EA 1T65A 2EWPA 4OH5A 2QTUA 4IVYA 2Q59A 2AB2A 5DKEA 5KCFA 5ETHA 1S9PA 5JY3A 1XVPA 2AAXA 2GPVA 5EITA 1XV9B 4KZIA 2IOKA 5IZ0A 4JAZA 3AZ2A 3OAPA 4OJ4A 5DWEA 1SQNA 2VV4B 3R2AA 1KV6A 5DWIA 3UUDA 3VTDA 5DX3A 2ABIA 4L96A 4POHA 4LNXA 3A9EA 4KZJA 3BQDA 5KRJA 4QM0A 1XLSE 5DSHA 2LBDA 2OM9A 5AZVA 2QNVA 1R20A 1ZUCA 3O1DA 4G2IA 5KR9A 2QH6A 1U3RA 2GPOA 3IPQA 1NHZA 4L98A 3WJ4A 1T74A 1U9EA 1PQ9A 1ILGA 2NW4A 4TUZA 4MG7A 4IW8A 4XUMA 3VHUA 2Q60A 2Q70A 5DZ0A 3VHVA 4PWLA 4MGBB 3OSAA 4N5GA 2HWQA 3W0IA 4CI5A 4M8HA 3CQVA 5JI0D 2PIPL 2HB7A 3E94A 4RMDA 5G3JA 4JYHA 3OOFA 3V9TA 2O4JA 3OZJA 3CS4A 3VJSA 4S15A 3S9SA 2YATA 1G50A 4A4WA 2ZMIA 4OILA 4OZTE 5AVLA 2HCDA 4IUIA 1BSXA 2AA2A 5KRMA 4PF3A 3D6DA 3PO9A 4OKBA 3W0GA 3HO0A 5HZCA 2NXXE 3IXPD 5DXGA 5HCVA 4OGHA 1RKHA 5DUEA 4G1YA 4UDBA 1ZEOA 3VTBA 2Q7IA 1GWXA 3FLIA 1L2IA 5G5WA 4ZJWA 2FAIA 1XDKB 2HWRA 2VSTA 4XTAA 5DWGA 3W5PA 1XZXX 3X1IA 2OAXA 4XLDA 2QPYA 3B3KA 3DCUA 3T03A 1R1KA 3ADXA 3VSPA 2PINA 2W8YA 3WFFA 4APUA 4G20A 4OARA 1ZDUA 3Q95B 4DM6A 2ZY0A 1DKFB 2IOGA 4OFRA 2R40A 4EM9A 2H79A 1YIMA 3GWXA 5E7VA 3VRUA 3KPZA 3B0WA 4ZN7A 1FM6D 1EXXA 1M2ZA 5AZTA 4ZNUA 1A52A 5E0WA 3A3ZX 2HASA 4MGAA 2AMBA 4A2JA 3ZRAA 2Q61A 2I0GA 3DZYD 3B67A 4MGBA 4OJBA 4QK4A 5EHJA 4ZJRA 2ZL9A 3A78A 4QJRA 3CLDA 2JF9A 5L7HA 4DK7A 4PVUA 1T5ZA 1QKTA 2ZK4A 1EREA 1GWQA 1KKQA 4X1GA 1FCXA 5DLRA 5EI1A 2AO6A 3L0LA 5DXBB 4REFA 4OKXA 3G8OA 2Q7KA 5DKSA 4MDDA 2FSZA 4ZO1B 3W0AA 3VN2A 3V4AA 3OMMA 3DZUA 4FHIA 2ZK1A 2ZNPA 5FQVA 3DZUD 2G0HA 2VV2A 3CWDA 1FD0A 5DXRA 5E14A 3FEIA 3A2HA 3CJWA 1XDKA 1I37A 2VV3A 3WT5A 1LBDA 3H52A 4OEDA 5DV6A 2XKWA 4K4JA 5DV3A 1NUOA 2QE4A 3UVVB 3UP0A 2P1VA 3ILZA 2AWHA 3FXVA 1DKFA 1Q4XA 3KMZA 2J7YA 4MGDA 4QE8A 3DT3A 3PBAA 4UDDA 1T7MA 1YINA 1HG4A 3JZCA 3IPUA 3P8XA 5DIDA 1K74A 3VJIA 1Z5XE 3X31A 2I0JA 2G5OA 3V3EA 5AAUA 4NY9A 3RLJA 2ACLB 1K74D 2FVJA 3L3XA 3L03A 3L3ZA 3VT6A 4OEAA 3HC5A 2AX7A 3OS9A 5AVIA 3V9VA 2VV1A 2ZK5A 2ZK3A 4MGCA 3VRTA 3AFRA 1XNNA 2I4JA 3OKHA 5B41A 2AYRA 4XT9A 4NUFA 3IA6A 5DZ1A 5DVVA 3AURA 4G2HA 5E19A 1UHLB 3W5TA 5LWPA 4OEZA 2P1UA 5KRLA 1YJEA 2ZLCA 1RJKA 4WHFA 2YHDA 3DR1A 5DYBA 2J14A 2PJLA 3SP6A 2POBA 2QABA 4YPQA 4RAKA 4IVWA 3K22A 2P15A 3VT5A 5DU5A 4ZOMA 4QE6A 3WMHA 3HVLA 1S0XA 4WLBA 2BAWA 4G1DA 1Y0SA 3OGTA 1UPWA 5KRAA 1E3KA 4IA3A 1YOKA 3A40X 4OIUA 5KROA 3PLZA 2AX9A 2ZMJA 4O8FA 1I7GA 5DI7A 5HYKA 3P89A 4RMCA 4P6XA 5AK2A 2OVMA 3GZ9A 5I4VA 1ZKYA 2QXSA 4PPSA 5DMCA 2Q8SA 2O4RA 5KRCA 3AZ3A 3KYTA 4RMEA 4R6SA 3W5QA 1X7EA 5M96A 3ADTA 2J4AA 4OEYA 5SYZA 3CDPA 4FHHA 2YJDA 4TV1B 4IA2A 4G1ZA 3ZQTA 3SP9A 5KCDA 3AZ1A 5G43A 3CTBA 1XOWA 4ONIA 1N46A 4J24A 4OZRU 2OUZA 2HB8A 5HJSA 1XLSA 5HJPA 4OC7A 5AWJA 1XB7A 2JJ3A 1S19A 3AN3A 5B5BA 1X7RA 2VSRA 4Q0AC 4K6IA 4PLEA 3E00A 1XJ7A 5FQRA 1YY4A 2Q1HA 3VT9A 5L7GA 1T7FA 3E00D 4IS8A 3R8AA 4IQRA 4IW6A 4MG8B 3IXPA 3B0RA 3CS6A 3B5RA 3VT4A 2O9IA 4YMQA 3N00A 5DXKA 1XP6A 4IWCA 3TKMA 2ZNNA 3IMYA 3M7RA 1NAVA 4YT1A 3FURA 4MG6A 4BCRA 5C4OA 4J26A 2AA7A 1XV9A 2F4BA 1R5KA 5KYAA 2ZK2A 3D90A 2Q5PA 1QKNA 1YA3A 2VV4A 4XHDA 5DP0A 1XQ3A 4KZMA 1FM9D 4RFWA 5KRHA 4RZGA 3VSOA 1XQCA 1N83A 2NXXA 3ZR7A 4IA7A 3OZ0A 3F5CB 5FQPA 5AWKA 3OLLA 1A28A 1GWRA 1FM6A 5DKBA 2Q3YA 4NB6A 3FC6B 4B7WA 1NAXA 1XAPA 5ICKA 4YNKA 5E15A 5DVCA 5APJA 3VTCA 2YLYA 2PIRA 4N1YA 5DIEA 2QGTA 4Y29A 1T79A 4OZTU 3DZYA 2ZVTA 1Y9RA 2QXMA 3ERTA 1PQ6A 2E2RA 5DY8A 2GPUA 4MG9B 4Q13A 4J5WC 2AM9A 3X36A 5C4TA 5F9BA 3R5MA 2AX8A 5DZHA 2GL8A 2ATHA 1PK5A 4OKTA 5DWLA 3G0WA 4ZI1A 3AN4A 1XP1A 3CDSA 4ZNWA 4MG8A 4OLMA 2HC4A 1PCGA 3ZRBA 2ZNOA 1YYEA 5EGVA 1N4HA 3NSQA 4OHAA 1R6GA 1X7JA 4DM8A 3A2IA 4FNEA 2VV0A 3E7CA 5KD9A 3O1EA 4LSJA 3IPSA 1OVLB 1YMTA 2NPAA 2QW4A 2R6WA 3NOAA 3QT0A 3V9YA 2G0GA 3HC6A 4CSJA 2Z4JA 2XYWA 3K6PA 5GICA 3V49A 2P1TA 4LNWA 1G1UA 2GP7A 1X78A 3A2JA 3GYTA 3P0UA 3WWRA 1K4WA 2REWA 5EC9A 5KCCA 3Q95A 4P6WA 1VJBA 5GIEA 3F5CA 2PIUA 3H0AD 3OSIA 2Z4BA 5EJVA 4Q50A 4RUJA 3UUAB 3PRGA 5DVSA 5APHA 5DMFA 5AYGA 1NQ1A 1NRLA 2YLQA 1NYXA 2QA6A 1XIUA 3GBKA 3HODA 3KDTA 3LMPA 5DKGA 3GN8A 5DTVA 1M13A 2HAMA 2P7AA 2QZOB 5HYRA 3B65A 3MNEA 2ZASA 3HM1A 3WGPA 2IHQA 5DRJA 2Q59B 1ILHA 1RKGA 1ZH7A 1UOMA 4IV2A 4ZNHA 1XVPB
chains in the Genus database with same CATH superfamily
4DQMA 2HVCA 1IE9A 1P93A 2ZK0A 5DXBA 3DCTA 2QSEA 2OVHA 3WTQA 4WQPA 1Y0XX 4OKWA 4CI4A 3V3QA 3UUDB 5DRMA 5DUGA 5DX3B 5G42A 2HFPA 3A9EB 2HBHA 2XYXA 3G8IA 2ZXMA 2ZBSA 2AX6A 2POGA 1OVLA 5DXPA 3R8DA 3WT6A 4IV4A 1X7BA 1Z95A 4J5WA 4N73A 1Z5XU 4RZEA 4FGYA 4UDCA 3UU7B 3F7DA 4LTWA 3TX7B 3L0JA 3AUNA 3OSWA 4MG7B 4DK8A 5KCEA 5AAVB 3RLLA 3UVVA 2P54A 5DUHA 2QGWA 2ZLAA 4FN9A 1LV2A 1QKUA 2J7XA 4REEA 3FEJA 1T76A 1FCYA 3VRWA 4S0TA 3VT3A 3G9EA 2AXAA 3FUGA 3OMPA 3ADSA 5KRIA 3OMOA 1U3SA 1IE8A 5CJ6A 5DWJA 2ACLA 4F9MA 4E2JA 4IA1A 1GS4A 1SR7A 2ZFXA 4ZN9A 1PRGA 2JFAB 4J5XC 1MV9A 3OLSA 3B66A 1ZAFA 3BEJA 4WHGA 4X1FA 5KCUA 3KMRA 2BJ4B 2Q6RA 2B50A 1UHLA 3RUUA 4UDAA 4OH6A 4E4QA 1YOWA 3W0CA 5APKA 4PP3A 2PIVA 5G44A 2AMAA 3B68A 1PDUA 2R6YA 4HEEX 1MZNA 2AA5A 4DORA 3ET3A 3ET0A 3JZBA 5L11A 5IXKA 2QR9A 2Q5SA 2HARA 3KMGA 2PKLA 1T7RA 3FS1A 3KFCA 5G45A 3WT7A 2Q6JA 1R20D 2ZXZA 2B1ZA 3UU7A 2PIOA 4POJA 1KNUA 2GTKA 3LBDA 4MGAB 3CS8A 4ZO1X 5DXEA 5AAVA 5JJMB 2QA8B 5DZ3A 2I4ZA 3ADUA 1FM9A 2H77A 1T7TA 4IWFA 3ADWA 1NQ7A 1NQ0A 3VT7A 3VT8A 5C4UA 4DMAA 1M7WA 4N8RA 1RK3A 1L2JA 2GIUA 4MG5A 1YP0A 4JL4A 4JGVA 4PLDA 2P4YA 1NDEA 1PQCA 4TV1A 3BC5A 3L0EA 1U3QA 4EMAA 2V0VA 4WVDA 5A86A 5GT4A 3D5FA 3R8IA 2B1VA 1OSHA 2JFAA 3RY9A 2ZK6A 3MNOA 4PP5A 5K13A 4OFUA 1XP9A 1SJ0A 2I4PA 3KBAA 2BJ4A 3SZ1A 3GD2A 3B0TA 4M8EA 5KRKA 4RUPA 1I38A 4JYGA 5HJPB 1XNXA 5LGAA 3ADVA 3GWSX 5KCWA 1X76A 5DXMA 3ET1A 3OS8C 2YFEA 1S0ZA 1R1KD 1E3GA 3PEQA 5FQTA 4MGDB 3X1HA 3FALB 2B23A 4JYIA 4PP6A 1FBYA 2PIWA 2ZNQA 2R40D 4J5XA 5KYJA 3HQ5A 5C4SA 3ET2A 3K8SA 1P8DA 4OJ9A 5E0XA 2ZXNA 1ZDTA 2OZ7A 5ACCA 1MVCA 5JJMA 2QA8A 2VV1B 3AX8A 3TY0A 4RWVA 1K7LA 3VHWA 3B0QA 3K23A 2ZKCA 3OMQA 3PCUA 1SKXA 5E1CA 2PIQA 2QMVA 3H0AA 3GYUA 3WJ5A 5DV8A 4PPPA 2AA6A 4XAOA 2GPPA 2P7GA 1QKMA 1NQ2A 3WFGA 4HLWA 3D57A 3FC6A 1G2NA 4RUOX 3RVFA 5DXQA 3UP3A 3HLVA 4NIEA 1S9QA 2PIXA 5DYDA 3KDUA 4ITEA 4S14A 4S0SA 5IAWA 1I7IA 2P7ZA 5DZIA 3VI8A 1H9UA 1RDTA 2PRGA 3OMKA 2GWXA 4MG9A 1PZLA 4XI3A 3VRVA 4G21A 1RDTD 4RZFA 4ZNVA 1T63A 3W0JA 4XUHA 4R2UA 5DIGA 5KCTA 2G44A 2XYJA 3ERDA 4ZNSA 3VJHA 3R5NA 3FALA 5G46A 3U9QA 3TKCA 3OLFA 1ERRA 2YLPA 3AUQA 3UUCA 4K7AA 1OT7A 2Q7JA 2PNUA 3NSPA 1TFCA 3W0YA 1TXIA 1UPVA 1G5YA 2V7CA 3DY6A 5DL4A 4E4KA 1OSVA 4PXMA 1DB1A 3KWYA 2YJAB 4R06A 3OOKA 3EYBA 2Q6SA 1YUCA 4TUZB 2YLOA 4NQAB 3VJTA 3HZFA 4PRGA 3OS8A 3W0HA 4WPFA 4RE8A 1T73A 3R29A 5DK9A 5FQSA 2ZMHA 4A4VA 3B1MA 1FCZA 2XHSA 3D24A 4OK1A 1EXAA 2A3IA 3RUTA 3W5RA 1ZGYA 5L7EA 4LBDA 3P88A 4IU7A 3UUAA 2Q1VA 1WM0X 4DOSA 1XPCA 3L1BA 4ITFA 2PITA 2Q7LA 4OIVA 3MNPA 5KRFA 1HJ1A 3OKIA 4OZRE 2NV7A 2Q5GA 2OCFA 4ZNTA 2QZOA 4QL8A 5GIDA 5H1EA 1T65A 2EWPA 4OH5A 2QTUA 4IVYA 2Q59A 2AB2A 5DKEA 5KCFA 5ETHA 1S9PA 5JY3A 1XVPA 2AAXA 2GPVA 5EITA 1XV9B 4KZIA 2IOKA 5IZ0A 4JAZA 3AZ2A 3OAPA 4OJ4A 5DWEA 1SQNA 2VV4B 3R2AA 1KV6A 5DWIA 3UUDA 3VTDA 5DX3A 2ABIA 4L96A 4POHA 4LNXA 3A9EA 4KZJA 3BQDA 5KRJA 4QM0A 1XLSE 5DSHA 2LBDA 2OM9A 5AZVA 2QNVA 1R20A 1ZUCA 3O1DA 4G2IA 5KR9A 2QH6A 1U3RA 2GPOA 3IPQA 1NHZA 4L98A 3WJ4A 1T74A 1U9EA 1PQ9A 1ILGA 2NW4A 4TUZA 4MG7A 4IW8A 4XUMA 3VHUA 2Q60A 2Q70A 5DZ0A 3VHVA 4PWLA 4MGBB 3OSAA 4N5GA 2HWQA 3W0IA 4CI5A 4M8HA 3CQVA 5JI0D 2PIPL 2HB7A 3E94A 4RMDA 5G3JA 4JYHA 3OOFA 3V9TA 2O4JA 3OZJA 3CS4A 3VJSA 4S15A 3S9SA 2YATA 1G50A 4A4WA 2ZMIA 4OILA 4OZTE 5AVLA 2HCDA 4IUIA 1BSXA 2AA2A 5KRMA 4PF3A 3D6DA 3PO9A 4OKBA 3W0GA 3HO0A 5HZCA 2NXXE 3IXPD 5DXGA 5HCVA 4OGHA 1RKHA 5DUEA 4G1YA 4UDBA 1ZEOA 3VTBA 2Q7IA 1GWXA 3FLIA 1L2IA 5G5WA 4ZJWA 2FAIA 1XDKB 2HWRA 2VSTA 4XTAA 5DWGA 3W5PA 1XZXX 3X1IA 2OAXA 4XLDA 2QPYA 3B3KA 3DCUA 3T03A 1R1KA 3ADXA 3VSPA 2PINA 2W8YA 3WFFA 4APUA 4G20A 4OARA 1ZDUA 3Q95B 4DM6A 2ZY0A 1DKFB 2IOGA 4OFRA 2R40A 4EM9A 2H79A 1YIMA 3GWXA 5E7VA 3VRUA 3KPZA 3B0WA 4ZN7A 1FM6D 1EXXA 1M2ZA 5AZTA 4ZNUA 1A52A 5E0WA 3A3ZX 2HASA 4MGAA 2AMBA 4A2JA 3ZRAA 2Q61A 2I0GA 3DZYD 3B67A 4MGBA 4OJBA 4QK4A 5EHJA 4ZJRA 2ZL9A 3A78A 4QJRA 3CLDA 2JF9A 5L7HA 4DK7A 4PVUA 1T5ZA 1QKTA 2ZK4A 1EREA 1GWQA 1KKQA 4X1GA 1FCXA 5DLRA 5EI1A 2AO6A 3L0LA 5DXBB 4REFA 4OKXA 3G8OA 2Q7KA 5DKSA 4MDDA 2FSZA 4ZO1B 3W0AA 3VN2A 3V4AA 3OMMA 3DZUA 4FHIA 2ZK1A 2ZNPA 5FQVA 3DZUD 2G0HA 2VV2A 3CWDA 1FD0A 5DXRA 5E14A 3FEIA 3A2HA 3CJWA 1XDKA 1I37A 2VV3A 3WT5A 1LBDA 3H52A 4OEDA 5DV6A 2XKWA 4K4JA 5DV3A 1NUOA 2QE4A 3UVVB 3UP0A 2P1VA 3ILZA 2AWHA 3FXVA 1DKFA 1Q4XA 3KMZA 2J7YA 4MGDA 4QE8A 3DT3A 3PBAA 4UDDA 1T7MA 1YINA 1HG4A 3JZCA 3IPUA 3P8XA 5DIDA 1K74A 3VJIA 1Z5XE 3X31A 2I0JA 2G5OA 3V3EA 5AAUA 4NY9A 3RLJA 2ACLB 1K74D 2FVJA 3L3XA 3L03A 3L3ZA 3VT6A 4OEAA 3HC5A 2AX7A 3OS9A 5AVIA 3V9VA 2VV1A 2ZK5A 2ZK3A 4MGCA 3VRTA 3AFRA 1XNNA 2I4JA 3OKHA 5B41A 2AYRA 4XT9A 4NUFA 3IA6A 5DZ1A 5DVVA 3AURA 4G2HA 5E19A 1UHLB 3W5TA 5LWPA 4OEZA 2P1UA 5KRLA 1YJEA 2ZLCA 1RJKA 4WHFA 2YHDA 3DR1A 5DYBA 2J14A 2PJLA 3SP6A 2POBA 2QABA 4YPQA 4RAKA 4IVWA 3K22A 2P15A 3VT5A 5DU5A 4ZOMA 4QE6A 3WMHA 3HVLA 1S0XA 4WLBA 2BAWA 4G1DA 1Y0SA 3OGTA 1UPWA 5KRAA 1E3KA 4IA3A 1YOKA 3A40X 4OIUA 5KROA 3PLZA 2AX9A 2ZMJA 4O8FA 1I7GA 5DI7A 5HYKA 3P89A 4RMCA 4P6XA 5AK2A 2OVMA 3GZ9A 5I4VA 1ZKYA 2QXSA 4PPSA 5DMCA 2Q8SA 2O4RA 5KRCA 3AZ3A 3KYTA 4RMEA 4R6SA 3W5QA 1X7EA 5M96A 3ADTA 2J4AA 4OEYA 5SYZA 3CDPA 4FHHA 2YJDA 4TV1B 4IA2A 4G1ZA 3ZQTA 3SP9A 5KCDA 3AZ1A 5G43A 3CTBA 1XOWA 4ONIA 1N46A 4J24A 4OZRU 2OUZA 2HB8A 5HJSA 1XLSA 5HJPA 4OC7A 5AWJA 1XB7A 2JJ3A 1S19A 3AN3A 5B5BA 1X7RA 2VSRA 4Q0AC 4K6IA 4PLEA 3E00A 1XJ7A 5FQRA 1YY4A 2Q1HA 3VT9A 5L7GA 1T7FA 3E00D 4IS8A 3R8AA 4IQRA 4IW6A 4MG8B 3IXPA 3B0RA 3CS6A 3B5RA 3VT4A 2O9IA 4YMQA 3N00A 5DXKA 1XP6A 4IWCA 3TKMA 2ZNNA 3IMYA 3M7RA 1NAVA 4YT1A 3FURA 4MG6A 4BCRA 5C4OA 4J26A 2AA7A 1XV9A 2F4BA 1R5KA 5KYAA 2ZK2A 3D90A 2Q5PA 1QKNA 1YA3A 2VV4A 4XHDA 5DP0A 1XQ3A 4KZMA 1FM9D 4RFWA 5KRHA 4RZGA 3VSOA 1XQCA 1N83A 2NXXA 3ZR7A 4IA7A 3OZ0A 3F5CB 5FQPA 5AWKA 3OLLA 1A28A 1GWRA 1FM6A 5DKBA 2Q3YA 4NB6A 3FC6B 4B7WA 1NAXA 1XAPA 5ICKA 4YNKA 5E15A 5DVCA 5APJA 3VTCA 2YLYA 2PIRA 4N1YA 5DIEA 2QGTA 4Y29A 1T79A 4OZTU 3DZYA 2ZVTA 1Y9RA 2QXMA 3ERTA 1PQ6A 2E2RA 5DY8A 2GPUA 4MG9B 4Q13A 4J5WC 2AM9A 3X36A 5C4TA 5F9BA 3R5MA 2AX8A 5DZHA 2GL8A 2ATHA 1PK5A 4OKTA 5DWLA 3G0WA 4ZI1A 3AN4A 1XP1A 3CDSA 4ZNWA 4MG8A 4OLMA 2HC4A 1PCGA 3ZRBA 2ZNOA 1YYEA 5EGVA 1N4HA 3NSQA 4OHAA 1R6GA 1X7JA 4DM8A 3A2IA 4FNEA 2VV0A 3E7CA 5KD9A 3O1EA 4LSJA 3IPSA 1OVLB 1YMTA 2NPAA 2QW4A 2R6WA 3NOAA 3QT0A 3V9YA 2G0GA 3HC6A 4CSJA 2Z4JA 2XYWA 3K6PA 5GICA 3V49A 2P1TA 4LNWA 1G1UA 2GP7A 1X78A 3A2JA 3GYTA 3P0UA 3WWRA 1K4WA 2REWA 5EC9A 5KCCA 3Q95A 4P6WA 1VJBA 5GIEA 3F5CA 2PIUA 3H0AD 3OSIA 2Z4BA 5EJVA 4Q50A 4RUJA 3UUAB 3PRGA 5DVSA 5APHA 5DMFA 5AYGA 1NQ1A 1NRLA 2YLQA 1NYXA 2QA6A 1XIUA 3GBKA 3HODA 3KDTA 3LMPA 5DKGA 3GN8A 5DTVA 1M13A 2HAMA 2P7AA 2QZOB 5HYRA 3B65A 3MNEA 2ZASA 3HM1A 3WGPA 2IHQA 5DRJA 2Q59B 1ILHA 1RKGA 1ZH7A 1UOMA 4IV2A 4ZNHA 1XVPB
chains in the Genus database with same CATH topology
4DQMA 2HVCA 1IE9A 1P93A 2ZK0A 5DXBA 3DCTA 2QSEA 2OVHA 3WTQA 4WQPA 1Y0XX 4OKWA 4CI4A 3V3QA 3UUDB 5DRMA 5DUGA 5DX3B 5G42A 2HFPA 3A9EB 2HBHA 2XYXA 3G8IA 2ZXMA 2ZBSA 2AX6A 2POGA 1OVLA 5DXPA 3R8DA 3WT6A 4IV4A 1X7BA 1Z95A 4J5WA 4N73A 1Z5XU 4RZEA 4FGYA 4UDCA 3UU7B 3F7DA 4LTWA 3TX7B 3L0JA 3AUNA 3OSWA 4MG7B 4DK8A 5KCEA 5AAVB 3RLLA 3UVVA 2P54A 5DUHA 2QGWA 2ZLAA 4FN9A 1LV2A 1QKUA 2J7XA 4REEA 3FEJA 1T76A 1FCYA 3VRWA 4S0TA 3VT3A 3G9EA 2AXAA 3FUGA 3OMPA 3ADSA 5KRIA 3OMOA 1U3SA 1IE8A 5CJ6A 5DWJA 2ACLA 4F9MA 4E2JA 4IA1A 1GS4A 1SR7A 2ZFXA 4ZN9A 1PRGA 2JFAB 4J5XC 1MV9A 3OLSA 3B66A 1ZAFA 3BEJA 4WHGA 4X1FA 5KCUA 3KMRA 2BJ4B 2Q6RA 2B50A 1UHLA 3RUUA 4UDAA 4OH6A 4E4QA 1YOWA 3W0CA 5APKA 4PP3A 2PIVA 5G44A 2AMAA 3B68A 1PDUA 2R6YA 4HEEX 1MZNA 2AA5A 4DORA 3ET3A 3ET0A 3JZBA 5L11A 5IXKA 2QR9A 2Q5SA 2HARA 3KMGA 2PKLA 1T7RA 3FS1A 3KFCA 5G45A 3WT7A 2Q6JA 1R20D 2ZXZA 2B1ZA 3UU7A 2PIOA 4POJA 1KNUA 2GTKA 3LBDA 4MGAB 3CS8A 4ZO1X 5DXEA 5AAVA 5JJMB 2QA8B 5DZ3A 2I4ZA 3ADUA 1FM9A 2H77A 1T7TA 4IWFA 3ADWA 1NQ7A 1NQ0A 3VT7A 3VT8A 5C4UA 4DMAA 1M7WA 4N8RA 1RK3A 1L2JA 2GIUA 4MG5A 1YP0A 4JL4A 4JGVA 4PLDA 2P4YA 1NDEA 1PQCA 4TV1A 3BC5A 3L0EA 1U3QA 4EMAA 2V0VA 4WVDA 5A86A 5GT4A 3D5FA 3R8IA 2B1VA 1OSHA 2JFAA 3RY9A 2ZK6A 3MNOA 4PP5A 5K13A 4OFUA 1XP9A 1SJ0A 2I4PA 3KBAA 2BJ4A 3SZ1A 3GD2A 3B0TA 4M8EA 5KRKA 4RUPA 1I38A 4JYGA 5HJPB 1XNXA 5LGAA 3ADVA 3GWSX 5KCWA 1X76A 5DXMA 3ET1A 3OS8C 2YFEA 1S0ZA 1R1KD 1E3GA 3PEQA 5FQTA 4MGDB 3X1HA 3FALB 2B23A 4JYIA 4PP6A 1FBYA 2PIWA 2ZNQA 2R40D 4J5XA 5KYJA 3HQ5A 5C4SA 3ET2A 3K8SA 1P8DA 4OJ9A 5E0XA 2ZXNA 1ZDTA 2OZ7A 5ACCA 1MVCA 5JJMA 2QA8A 2VV1B 3AX8A 3TY0A 4RWVA 1K7LA 3VHWA 3B0QA 3K23A 2ZKCA 3OMQA 3PCUA 1SKXA 5E1CA 2PIQA 2QMVA 3H0AA 3GYUA 3WJ5A 5DV8A 4PPPA 2AA6A 4XAOA 2GPPA 2P7GA 1QKMA 1NQ2A 3WFGA 4HLWA 3D57A 3FC6A 1G2NA 4RUOX 3RVFA 5DXQA 3UP3A 3HLVA 4NIEA 1S9QA 2PIXA 5DYDA 3KDUA 4ITEA 4S14A 4S0SA 5IAWA 1I7IA 2P7ZA 5DZIA 3VI8A 1H9UA 1RDTA 2PRGA 3OMKA 2GWXA 4MG9A 1PZLA 4XI3A 3VRVA 4G21A 1RDTD 4RZFA 4ZNVA 1T63A 3W0JA 4XUHA 4R2UA 5DIGA 5KCTA 2G44A 2XYJA 3ERDA 4ZNSA 3VJHA 3R5NA 3FALA 5G46A 3U9QA 3TKCA 3OLFA 1ERRA 2YLPA 3AUQA 3UUCA 4K7AA 1OT7A 2Q7JA 2PNUA 3NSPA 1TFCA 3W0YA 1TXIA 1UPVA 1G5YA 2V7CA 3DY6A 5DL4A 4E4KA 1OSVA 4PXMA 1DB1A 3KWYA 2YJAB 4R06A 3OOKA 3EYBA 2Q6SA 1YUCA 4TUZB 2YLOA 4NQAB 3VJTA 3HZFA 4PRGA 3OS8A 3W0HA 4WPFA 4RE8A 1T73A 3R29A 5DK9A 5FQSA 2ZMHA 4A4VA 3B1MA 1FCZA 2XHSA 3D24A 4OK1A 1EXAA 2A3IA 3RUTA 3W5RA 1ZGYA 5L7EA 4LBDA 3P88A 4IU7A 3UUAA 2Q1VA 1WM0X 4DOSA 1XPCA 3L1BA 4ITFA 2PITA 2Q7LA 4OIVA 3MNPA 5KRFA 1HJ1A 3OKIA 4OZRE 2NV7A 2Q5GA 2OCFA 4ZNTA 2QZOA 4QL8A 5GIDA 5H1EA 1T65A 2EWPA 4OH5A 2QTUA 4IVYA 2Q59A 2AB2A 5DKEA 5KCFA 5ETHA 1S9PA 5JY3A 1XVPA 2AAXA 2GPVA 5EITA 1XV9B 4KZIA 2IOKA 5IZ0A 4JAZA 3AZ2A 3OAPA 4OJ4A 5DWEA 1SQNA 2VV4B 3R2AA 1KV6A 5DWIA 3UUDA 3VTDA 5DX3A 2ABIA 4L96A 4POHA 4LNXA 3A9EA 4KZJA 3BQDA 5KRJA 4QM0A 1XLSE 5DSHA 2LBDA 2OM9A 5AZVA 2QNVA 1R20A 1ZUCA 3O1DA 4G2IA 5KR9A 2QH6A 1U3RA 2GPOA 3IPQA 1NHZA 4L98A 3WJ4A 1T74A 1U9EA 1PQ9A 1ILGA 2NW4A 4TUZA 4MG7A 4IW8A 4XUMA 3VHUA 2Q60A 2Q70A 5DZ0A 3VHVA 4PWLA 4MGBB 3OSAA 4N5GA 2HWQA 3W0IA 4CI5A 4M8HA 3CQVA 5JI0D 2PIPL 2HB7A 3E94A 4RMDA 5G3JA 4JYHA 3OOFA 3V9TA 2O4JA 3OZJA 3CS4A 3VJSA 4S15A 3S9SA 2YATA 1G50A 4A4WA 2ZMIA 4OILA 4OZTE 5AVLA 2HCDA 4IUIA 1BSXA 2AA2A 5KRMA 4PF3A 3D6DA 3PO9A 4OKBA 3W0GA 3HO0A 5HZCA 2NXXE 3IXPD 5DXGA 5HCVA 4OGHA 1RKHA 5DUEA 4G1YA 4UDBA 1ZEOA 3VTBA 2Q7IA 1GWXA 3FLIA 1L2IA 5G5WA 4ZJWA 2FAIA 1XDKB 2HWRA 2VSTA 4XTAA 5DWGA 3W5PA 1XZXX 3X1IA 2OAXA 4XLDA 2QPYA 3B3KA 3DCUA 3T03A 1R1KA 3ADXA 3VSPA 2PINA 2W8YA 3WFFA 4APUA 4G20A 4OARA 1ZDUA 3Q95B 4DM6A 2ZY0A 1DKFB 2IOGA 4OFRA 2R40A 4EM9A 2H79A 1YIMA 3GWXA 5E7VA 3VRUA 3KPZA 3B0WA 4ZN7A 1FM6D 1EXXA 1M2ZA 5AZTA 4ZNUA 1A52A 5E0WA 3A3ZX 2HASA 4MGAA 2AMBA 4A2JA 3ZRAA 2Q61A 2I0GA 3DZYD 3B67A 4MGBA 4OJBA 4QK4A 5EHJA 4ZJRA 2ZL9A 3A78A 4QJRA 3CLDA 2JF9A 5L7HA 4DK7A 4PVUA 1T5ZA 1QKTA 2ZK4A 1EREA 1GWQA 1KKQA 4X1GA 1FCXA 5DLRA 5EI1A 2AO6A 3L0LA 5DXBB 4REFA 4OKXA 3G8OA 2Q7KA 5DKSA 4MDDA 2FSZA 4ZO1B 3W0AA 3VN2A 3V4AA 3OMMA 3DZUA 4FHIA 2ZK1A 2ZNPA 5FQVA 3DZUD 2G0HA 2VV2A 3CWDA 1FD0A 5DXRA 5E14A 3FEIA 3A2HA 3CJWA 1XDKA 1I37A 2VV3A 3WT5A 1LBDA 3H52A 4OEDA 5DV6A 2XKWA 4K4JA 5DV3A 1NUOA 2QE4A 3UVVB 3UP0A 2P1VA 3ILZA 2AWHA 3FXVA 1DKFA 1Q4XA 3KMZA 2J7YA 4MGDA 4QE8A 3DT3A 3PBAA 4UDDA 1T7MA 1YINA 1HG4A 3JZCA 3IPUA 3P8XA 5DIDA 1K74A 3VJIA 1Z5XE 3X31A 2I0JA 2G5OA 3V3EA 5AAUA 4NY9A 3RLJA 2ACLB 1K74D 2FVJA 3L3XA 3L03A 3L3ZA 3VT6A 4OEAA 3HC5A 2AX7A 3OS9A 5AVIA 3V9VA 2VV1A 2ZK5A 2ZK3A 4MGCA 3VRTA 3AFRA 1XNNA 2I4JA 3OKHA 5B41A 2AYRA 4XT9A 4NUFA 3IA6A 5DZ1A 5DVVA 3AURA 4G2HA 5E19A 1UHLB 3W5TA 5LWPA 4OEZA 2P1UA 5KRLA 1YJEA 2ZLCA 1RJKA 4WHFA 2YHDA 3DR1A 5DYBA 2J14A 2PJLA 3SP6A 2POBA 2QABA 4YPQA 4RAKA 4IVWA 3K22A 2P15A 3VT5A 5DU5A 4ZOMA 4QE6A 3WMHA 3HVLA 1S0XA 4WLBA 2BAWA 4G1DA 1Y0SA 3OGTA 1UPWA 5KRAA 1E3KA 4IA3A 1YOKA 3A40X 4OIUA 5KROA 3PLZA 2AX9A 2ZMJA 4O8FA 1I7GA 5DI7A 5HYKA 3P89A 4RMCA 4P6XA 5AK2A 2OVMA 3GZ9A 5I4VA 1ZKYA 2QXSA 4PPSA 5DMCA 2Q8SA 2O4RA 5KRCA 3AZ3A 3KYTA 4RMEA 4R6SA 3W5QA 1X7EA 5M96A 3ADTA 2J4AA 4OEYA 5SYZA 3CDPA 4FHHA 2YJDA 4TV1B 4IA2A 4G1ZA 3ZQTA 3SP9A 5KCDA 3AZ1A 5G43A 3CTBA 1XOWA 4ONIA 1N46A 4J24A 4OZRU 2OUZA 2HB8A 5HJSA 1XLSA 5HJPA 4OC7A 5AWJA 1XB7A 2JJ3A 1S19A 3AN3A 5B5BA 1X7RA 2VSRA 4Q0AC 4K6IA 4PLEA 3E00A 1XJ7A 5FQRA 1YY4A 2Q1HA 3VT9A 5L7GA 1T7FA 3E00D 4IS8A 3R8AA 4IQRA 4IW6A 4MG8B 3IXPA 3B0RA 3CS6A 3B5RA 3VT4A 2O9IA 4YMQA 3N00A 5DXKA 1XP6A 4IWCA 3TKMA 2ZNNA 3IMYA 3M7RA 1NAVA 4YT1A 3FURA 4MG6A 4BCRA 5C4OA 4J26A 2AA7A 1XV9A 2F4BA 1R5KA 5KYAA 2ZK2A 3D90A 2Q5PA 1QKNA 1YA3A 2VV4A 4XHDA 5DP0A 1XQ3A 4KZMA 1FM9D 4RFWA 5KRHA 4RZGA 3VSOA 1XQCA 1N83A 2NXXA 3ZR7A 4IA7A 3OZ0A 3F5CB 5FQPA 5AWKA 3OLLA 1A28A 1GWRA 1FM6A 5DKBA 2Q3YA 4NB6A 3FC6B 4B7WA 1NAXA 1XAPA 5ICKA 4YNKA 5E15A 5DVCA 5APJA 3VTCA 2YLYA 2PIRA 4N1YA 5DIEA 2QGTA 4Y29A 1T79A 4OZTU 3DZYA 2ZVTA 1Y9RA 2QXMA 3ERTA 1PQ6A 2E2RA 5DY8A 2GPUA 4MG9B 4Q13A 4J5WC 2AM9A 3X36A 5C4TA 5F9BA 3R5MA 2AX8A 5DZHA 2GL8A 2ATHA 1PK5A 4OKTA 5DWLA 3G0WA 4ZI1A 3AN4A 1XP1A 3CDSA 4ZNWA 4MG8A 4OLMA 2HC4A 1PCGA 3ZRBA 2ZNOA 1YYEA 5EGVA 1N4HA 3NSQA 4OHAA 1R6GA 1X7JA 4DM8A 3A2IA 4FNEA 2VV0A 3E7CA 5KD9A 3O1EA 4LSJA 3IPSA 1OVLB 1YMTA 2NPAA 2QW4A 2R6WA 3NOAA 3QT0A 3V9YA 2G0GA 3HC6A 4CSJA 2Z4JA 2XYWA 3K6PA 5GICA 3V49A 2P1TA 4LNWA 1G1UA 2GP7A 1X78A 3A2JA 3GYTA 3P0UA 3WWRA 1K4WA 2REWA 5EC9A 5KCCA 3Q95A 4P6WA 1VJBA 5GIEA 3F5CA 2PIUA 3H0AD 3OSIA 2Z4BA 5EJVA 4Q50A 4RUJA 3UUAB 3PRGA 5DVSA 5APHA 5DMFA 5AYGA 1NQ1A 1NRLA 2YLQA 1NYXA 2QA6A 1XIUA 3GBKA 3HODA 3KDTA 3LMPA 5DKGA 3GN8A 5DTVA 1M13A 2HAMA 2P7AA 2QZOB 5HYRA 3B65A 3MNEA 2ZASA 3HM1A 3WGPA 2IHQA 5DRJA 2Q59B 1ILHA 1RKGA 1ZH7A 1UOMA 4IV2A 4ZNHA 1XVPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DQM A;  2HVC A;  1IE9 A;  1P93 A;  2ZK0 A;  5DXB A;  3DCT A;  2QSE A;  2OVH A;  3WTQ A;  4WQP A;  1Y0X X;  4OKW A;  4CI4 A;  3V3Q A;  3UUD B;  5DRM A;  5DUG A;  5DX3 B;  5G42 A;  2HFP A;  3A9E B;  2HBH A;  2XYX A;  3G8I A;  2ZXM A;  2ZBS A;  2AX6 A;  2POG A;  1OVL A;  5DXP A;  3R8D A;  3WT6 A;  4IV4 A;  1X7B A;  1Z95 A;  4J5W A;  4N73 A;  1Z5X U;  4RZE A;  4FGY A;  4UDC A;  3UU7 B;  3F7D A;  4LTW A;  3TX7 B;  3L0J A;  3AUN A;  3OSW A;  4MG7 B;  4DK8 A;  5KCE A;  5AAV B;  3RLL A;  3UVV A;  2P54 A;  5DUH A;  2QGW A;  2ZLA A;  4FN9 A;  1LV2 A;  1QKU A;  2J7X A;  4REE A;  3FEJ A;  1T76 A;  1FCY A;  3VRW A;  4S0T A;  3VT3 A;  3G9E A;  2AXA A;  3FUG A;  3OMP A;  3ADS A;  5KRI A;  3OMO A;  1U3S A;  1IE8 A;  5CJ6 A;  5DWJ A;  2ACL A;  4F9M A;  4E2J A;  4IA1 A;  1GS4 A;  1SR7 A;  2ZFX A;  4ZN9 A;  1PRG A;  2JFA B;  4J5X C;  1MV9 A;  3OLS A;  3B66 A;  1ZAF A;  3BEJ A;  4WHG A;  4X1F A;  5KCU A;  3KMR A;  2BJ4 B;  2Q6R A;  2B50 A;  1UHL A;  3RUU A;  4UDA A;  4OH6 A;  4E4Q A;  1YOW A;  3W0C A;  5APK A;  4PP3 A;  2PIV A;  5G44 A;  2AMA A;  3B68 A;  1PDU A;  2R6Y A;  4HEE X;  1MZN A;  2AA5 A;  4DOR A;  3ET3 A;  3ET0 A;  3JZB A;  5L11 A;  5IXK A;  2QR9 A;  2Q5S A;  2HAR A;  3KMG A;  2PKL A;  1T7R A;  3FS1 A;  3KFC A;  5G45 A;  3WT7 A;  2Q6J A;  1R20 D;  2ZXZ A;  2B1Z A;  3UU7 A;  2PIO A;  4POJ A;  1KNU A;  2GTK A;  3LBD A;  4MGA B;  3CS8 A;  4ZO1 X;  5DXE A;  5AAV A;  5JJM B;  2QA8 B;  5DZ3 A;  2I4Z A;  3ADU A;  1FM9 A;  2H77 A;  1T7T A;  4IWF A;  3ADW A;  1NQ7 A;  1NQ0 A;  3VT7 A;  3VT8 A;  5C4U A;  4DMA A;  1M7W A;  4N8R A;  1RK3 A;  1L2J A;  2GIU A;  4MG5 A;  1YP0 A;  4JL4 A;  4JGV A;  4PLD A;  2P4Y A;  1NDE A;  1PQC A;  4TV1 A;  3BC5 A;  3L0E A;  1U3Q A;  4EMA A;  2V0V A;  4WVD A;  5A86 A;  5GT4 A;  3D5F A;  3R8I A;  2B1V A;  1OSH A;  2JFA A;  3RY9 A;  2ZK6 A;  3MNO A;  4PP5 A;  5K13 A;  4OFU A;  1XP9 A;  1SJ0 A;  2I4P A;  3KBA A;  2BJ4 A;  3SZ1 A;  3GD2 A;  3B0T A;  4M8E A;  5KRK A;  4RUP A;  1I38 A;  4JYG A;  5HJP B;  1XNX A;  5LGA A;  3ADV A;  3GWS X;  5KCW A;  1X76 A;  5DXM A;  3ET1 A;  3OS8 C;  2YFE A;  1S0Z A;  1R1K D;  1E3G A;  3PEQ A;  5FQT A;  4MGD B;  3X1H A;  3FAL B;  2B23 A;  4JYI A;  4PP6 A;  1FBY A;  2PIW A;  2ZNQ A;  2R40 D;  4J5X A;  5KYJ A;  3HQ5 A;  5C4S A;  3ET2 A;  3K8S A;  1P8D A;  4OJ9 A;  5E0X A;  2ZXN A;  1ZDT A;  2OZ7 A;  5ACC A;  1MVC A;  5JJM A;  2QA8 A;  2VV1 B;  3AX8 A;  3TY0 A;  4RWV A;  1K7L A;  3VHW A;  3B0Q A;  3K23 A;  2ZKC A;  3OMQ A;  3PCU A;  1SKX A;  5E1C A;  2PIQ A;  2QMV A;  3H0A A;  3GYU A;  3WJ5 A;  5DV8 A;  4PPP A;  2AA6 A;  4XAO A;  2GPP A;  2P7G A;  1QKM A;  1NQ2 A;  3WFG A;  4HLW A;  3D57 A;  3FC6 A;  1G2N A;  4RUO X;  3RVF A;  5DXQ A;  3UP3 A;  3HLV A;  4NIE A;  1S9Q A;  2PIX A;  5DYD A;  3KDU A;  4ITE A;  4S14 A;  4S0S A;  5IAW A;  1I7I A;  2P7Z A;  5DZI A;  3VI8 A;  1H9U A;  1RDT A;  2PRG A;  3OMK A;  2GWX A;  4MG9 A;  1PZL A;  4XI3 A;  3VRV A;  4G21 A;  1RDT D;  4RZF A;  4ZNV A;  1T63 A;  3W0J A;  4XUH A;  4R2U A;  5DIG A;  5KCT A;  2G44 A;  2XYJ A;  3ERD A;  4ZNS A;  3VJH A;  3R5N A;  3FAL A;  5G46 A;  3U9Q A;  3TKC A;  3OLF A;  1ERR A;  2YLP A;  3AUQ A;  3UUC A;  4K7A A;  1OT7 A;  2Q7J A;  2PNU A;  3NSP A;  1TFC A;  3W0Y A;  1TXI A;  1UPV A;  1G5Y A;  2V7C A;  3DY6 A;  5DL4 A;  4E4K A;  1OSV A;  4PXM A;  1DB1 A;  3KWY A;  2YJA B;  4R06 A;  3OOK A;  3EYB A;  2Q6S A;  1YUC A;  4TUZ B;  2YLO A;  4NQA B;  3VJT A;  3HZF A;  4PRG A;  3OS8 A;  3W0H A;  4WPF A;  4RE8 A;  1T73 A;  3R29 A;  5DK9 A;  5FQS A;  2ZMH A;  4A4V A;  3B1M A;  1FCZ A;  2XHS A;  3D24 A;  4OK1 A;  1EXA A;  2A3I A;  3RUT A;  3W5R A;  1ZGY A;  5L7E A;  4LBD A;  3P88 A;  4IU7 A;  3UUA A;  2Q1V A;  1WM0 X;  4DOS A;  1XPC A;  3L1B A;  4ITF A;  2PIT A;  2Q7L A;  4OIV A;  3MNP A;  5KRF A;  1HJ1 A;  3OKI A;  4OZR E;  2NV7 A;  2Q5G A;  2OCF A;  4ZNT A;  2QZO A;  4QL8 A;  5GID A;  5H1E A;  1T65 A;  2EWP A;  4OH5 A;  2QTU A;  4IVY A;  2Q59 A;  2AB2 A;  5DKE A;  5KCF A;  5ETH A;  1S9P A;  5JY3 A;  1XVP A;  2AAX A;  2GPV A;  5EIT A;  1XV9 B;  4KZI A;  2IOK A;  5IZ0 A;  4JAZ A;  3AZ2 A;  3OAP A;  4OJ4 A;  5DWE A;  1SQN A;  2VV4 B;  3R2A A;  1KV6 A;  5DWI A;  3UUD A;  3VTD A;  5DX3 A;  2ABI A;  4L96 A;  4POH A;  4LNX A;  3A9E A;  4KZJ A;  3BQD A;  5KRJ A;  4QM0 A;  1XLS E;  5DSH A;  2LBD A;  2OM9 A;  5AZV A;  2QNV A;  1R20 A;  1ZUC A;  3O1D A;  4G2I A;  5KR9 A;  2QH6 A;  1U3R A;  2GPO A;  3IPQ A;  1NHZ A;  4L98 A;  3WJ4 A;  1T74 A;  1U9E A;  1PQ9 A;  1ILG A;  2NW4 A;  4TUZ A;  4MG7 A;  4IW8 A;  4XUM A;  3VHU A;  2Q60 A;  2Q70 A;  5DZ0 A;  3VHV A;  4PWL A;  4MGB B;  3OSA A;  4N5G A;  2HWQ A;  3W0I A;  4CI5 A;  4M8H A;  3CQV A;  5JI0 D;  2PIP L;  2HB7 A;  3E94 A;  4RMD A;  5G3J A;  4JYH A;  3OOF A;  3V9T A;  2O4J A;  3OZJ A;  3CS4 A;  3VJS A;  4S15 A;  3S9S A;  2YAT A;  1G50 A;  4A4W A;  2ZMI A;  4OIL A;  4OZT E;  5AVL A;  2HCD A;  4IUI A;  1BSX A;  2AA2 A;  5KRM A;  4PF3 A;  3D6D A;  3PO9 A;  4OKB A;  3W0G A;  3HO0 A;  5HZC A;  2NXX E;  3IXP D;  5DXG A;  5HCV A;  4OGH A;  1RKH A;  5DUE A;  4G1Y A;  4UDB A;  1ZEO A;  3VTB A;  2Q7I A;  1GWX A;  3FLI A;  1L2I A;  5G5W A;  4ZJW A;  2FAI A;  1XDK B;  2HWR A;  2VST A;  4XTA A;  5DWG A;  3W5P A;  1XZX X;  3X1I A;  2OAX A;  4XLD A;  2QPY A;  3B3K A;  3DCU A;  3T03 A;  1R1K A;  3ADX A;  3VSP A;  2PIN A;  2W8Y A;  3WFF A;  4APU A;  4G20 A;  4OAR A;  1ZDU A;  3Q95 B;  4DM6 A;  2ZY0 A;  1DKF B;  2IOG A;  4OFR A;  2R40 A;  4EM9 A;  2H79 A;  1YIM A;  3GWX A;  5E7V A;  3VRU A;  3KPZ A;  3B0W A;  4ZN7 A;  1FM6 D;  1EXX A;  1M2Z A;  5AZT A;  4ZNU A;  1A52 A;  5E0W A;  3A3Z X;  2HAS A;  4MGA A;  2AMB A;  4A2J A;  3ZRA A;  2Q61 A;  2I0G A;  3DZY D;  3B67 A;  4MGB A;  4OJB A;  4QK4 A;  5EHJ A;  4ZJR A;  2ZL9 A;  3A78 A;  4QJR A;  3CLD A;  2JF9 A;  5L7H A;  4DK7 A;  4PVU A;  1T5Z A;  1QKT A;  2ZK4 A;  1ERE A;  1GWQ A;  1KKQ A;  4X1G A;  1FCX A;  5DLR A;  5EI1 A;  2AO6 A;  3L0L A;  5DXB B;  4REF A;  4OKX A;  3G8O A;  2Q7K A;  5DKS A;  4MDD A;  2FSZ A;  4ZO1 B;  3W0A A;  3VN2 A;  3V4A A;  3OMM A;  3DZU A;  4FHI A;  2ZK1 A;  2ZNP A;  5FQV A;  3DZU D;  2G0H A;  2VV2 A;  3CWD A;  1FD0 A;  5DXR A;  5E14 A;  3FEI A;  3A2H A;  3CJW A;  1XDK A;  1I37 A;  2VV3 A;  3WT5 A;  1LBD A;  3H52 A;  4OED A;  5DV6 A;  2XKW A;  4K4J A;  5DV3 A;  1NUO A;  2QE4 A;  3UVV B;  3UP0 A;  2P1V A;  3ILZ A;  2AWH A;  3FXV A;  1DKF A;  1Q4X A;  3KMZ A;  2J7Y A;  4MGD A;  4QE8 A;  3DT3 A;  3PBA A;  4UDD A;  1T7M A;  1YIN A;  1HG4 A;  3JZC A;  3IPU A;  3P8X A;  5DID A;  1K74 A;  3VJI A;  1Z5X E;  3X31 A;  2I0J A;  2G5O A;  3V3E A;  5AAU A;  4NY9 A;  3RLJ A;  2ACL B;  1K74 D;  2FVJ A;  3L3X A;  3L03 A;  3L3Z A;  3VT6 A;  4OEA A;  3HC5 A;  2AX7 A;  3OS9 A;  5AVI A;  3V9V A;  2VV1 A;  2ZK5 A;  2ZK3 A;  4MGC A;  3VRT A;  3AFR A;  1XNN A;  2I4J A;  3OKH A;  5B41 A;  2AYR A;  4XT9 A;  4NUF A;  3IA6 A;  5DZ1 A;  5DVV A;  3AUR A;  4G2H A;  5E19 A;  1UHL B;  3W5T A;  5LWP A;  4OEZ A;  2P1U A;  5KRL A;  1YJE A;  2ZLC A;  1RJK A;  4WHF A;  2YHD A;  3DR1 A;  5DYB A;  2J14 A;  2PJL A;  3SP6 A;  2POB A;  2QAB A;  4YPQ A;  4RAK A;  4IVW A;  3K22 A;  2P15 A;  3VT5 A;  5DU5 A;  4ZOM A;  4QE6 A;  3WMH A;  3HVL A;  1S0X A;  4WLB A;  2BAW A;  4G1D A;  1Y0S A;  3OGT A;  1UPW A;  5KRA A;  1E3K A;  4IA3 A;  1YOK A;  3A40 X;  4OIU A;  5KRO A;  3PLZ A;  2AX9 A;  2ZMJ A;  4O8F A;  1I7G A;  5DI7 A;  5HYK A;  3P89 A;  4RMC A;  4P6X A;  5AK2 A;  2OVM A;  3GZ9 A;  5I4V A;  1ZKY A;  2QXS A;  4PPS A;  5DMC A;  2Q8S A;  2O4R A;  5KRC A;  3AZ3 A;  3KYT A;  4RME A;  4R6S A;  3W5Q A;  1X7E A;  5M96 A;  3ADT A;  2J4A A;  4OEY A;  5SYZ A;  3CDP A;  4FHH A;  2YJD A;  4TV1 B;  4IA2 A;  4G1Z A;  3ZQT A;  3SP9 A;  5KCD A;  3AZ1 A;  5G43 A;  3CTB A;  1XOW A;  4ONI A;  1N46 A;  4J24 A;  4OZR U;  2OUZ A;  2HB8 A;  5HJS A;  1XLS A;  5HJP A;  4OC7 A;  5AWJ A;  1XB7 A;  2JJ3 A;  1S19 A;  3AN3 A;  5B5B A;  1X7R A;  2VSR A;  4Q0A C;  4K6I A;  4PLE A;  3E00 A;  1XJ7 A;  5FQR A;  1YY4 A;  2Q1H A;  3VT9 A;  5L7G A;  1T7F A;  3E00 D;  4IS8 A;  3R8A A;  4IQR A;  4IW6 A;  4MG8 B;  3IXP A;  3B0R A;  3CS6 A;  3B5R A;  3VT4 A;  2O9I A;  4YMQ A;  3N00 A;  5DXK A;  1XP6 A;  4IWC A;  3TKM A;  2ZNN A;  3IMY A;  3M7R A;  1NAV A;  4YT1 A;  3FUR A;  4MG6 A;  4BCR A;  5C4O A;  4J26 A;  2AA7 A;  1XV9 A;  2F4B A;  1R5K A;  5KYA A;  2ZK2 A;  3D90 A;  2Q5P A;  1QKN A;  1YA3 A;  2VV4 A;  4XHD A;  5DP0 A;  1XQ3 A;  4KZM A;  1FM9 D;  4RFW A;  5KRH A;  4RZG A;  3VSO A;  1XQC A;  1N83 A;  2NXX A;  3ZR7 A;  4IA7 A;  3OZ0 A;  3F5C B;  5FQP A;  5AWK A;  3OLL A;  1A28 A;  1GWR A;  1FM6 A;  5DKB A;  2Q3Y A;  4NB6 A;  3FC6 B;  4B7W A;  1NAX A;  1XAP A;  5ICK A;  4YNK A;  5E15 A;  5DVC A;  5APJ A;  3VTC A;  2YLY A;  2PIR A;  4N1Y A;  5DIE A;  2QGT A;  4Y29 A;  1T79 A;  4OZT U;  3DZY A;  2ZVT A;  1Y9R A;  2QXM A;  3ERT A;  1PQ6 A;  2E2R A;  5DY8 A;  2GPU A;  4MG9 B;  4Q13 A;  4J5W C;  2AM9 A;  3X36 A;  5C4T A;  5F9B A;  3R5M A;  2AX8 A;  5DZH A;  2GL8 A;  2ATH A;  1PK5 A;  4OKT A;  5DWL A;  3G0W A;  4ZI1 A;  3AN4 A;  1XP1 A;  3CDS A;  4ZNW A;  4MG8 A;  4OLM A;  2HC4 A;  1PCG A;  3ZRB A;  2ZNO A;  1YYE A;  5EGV A;  1N4H A;  3NSQ A;  4OHA A;  1R6G A;  1X7J A;  4DM8 A;  3A2I A;  4FNE A;  2VV0 A;  3E7C A;  5KD9 A;  3O1E A;  4LSJ A;  3IPS A;  1OVL B;  1YMT A;  2NPA A;  2QW4 A;  2R6W A;  3NOA A;  3QT0 A;  3V9Y A;  2G0G A;  3HC6 A;  4CSJ A;  2Z4J A;  2XYW A;  3K6P A;  5GIC A;  3V49 A;  2P1T A;  4LNW A;  1G1U A;  2GP7 A;  1X78 A;  3A2J A;  3GYT A;  3P0U A;  3WWR A;  1K4W A;  2REW A;  5EC9 A;  5KCC A;  3Q95 A;  4P6W A;  1VJB A;  5GIE A;  3F5C A;  2PIU A;  3H0A D;  3OSI A;  2Z4B A;  5EJV A;  4Q50 A;  4RUJ A;  3UUA B;  3PRG A;  5DVS A;  5APH A;  5DMF A;  5AYG A;  1NQ1 A;  1NRL A;  2YLQ A;  1NYX A;  2QA6 A;  1XIU A;  3GBK A;  3HOD A;  3KDT A;  3LMP A;  5DKG A;  3GN8 A;  5DTV A;  1M13 A;  2HAM A;  2P7A A;  2QZO B;  5HYR A;  3B65 A;  3MNE A;  2ZAS A;  3HM1 A;  3WGP A;  2IHQ A;  5DRJ A;  2Q59 B;  1ILH A;  1RKG A;  1ZH7 A;  1UOM A;  4IV2 A;  4ZNH A;  1XVP B; 
#chains in the Genus database with same CATH topology
 4DQM A;  2HVC A;  1IE9 A;  1P93 A;  2ZK0 A;  5DXB A;  3DCT A;  2QSE A;  2OVH A;  3WTQ A;  4WQP A;  1Y0X X;  4OKW A;  4CI4 A;  3V3Q A;  3UUD B;  5DRM A;  5DUG A;  5DX3 B;  5G42 A;  2HFP A;  3A9E B;  2HBH A;  2XYX A;  3G8I A;  2ZXM A;  2ZBS A;  2AX6 A;  2POG A;  1OVL A;  5DXP A;  3R8D A;  3WT6 A;  4IV4 A;  1X7B A;  1Z95 A;  4J5W A;  4N73 A;  1Z5X U;  4RZE A;  4FGY A;  4UDC A;  3UU7 B;  3F7D A;  4LTW A;  3TX7 B;  3L0J A;  3AUN A;  3OSW A;  4MG7 B;  4DK8 A;  5KCE A;  5AAV B;  3RLL A;  3UVV A;  2P54 A;  5DUH A;  2QGW A;  2ZLA A;  4FN9 A;  1LV2 A;  1QKU A;  2J7X A;  4REE A;  3FEJ A;  1T76 A;  1FCY A;  3VRW A;  4S0T A;  3VT3 A;  3G9E A;  2AXA A;  3FUG A;  3OMP A;  3ADS A;  5KRI A;  3OMO A;  1U3S A;  1IE8 A;  5CJ6 A;  5DWJ A;  2ACL A;  4F9M A;  4E2J A;  4IA1 A;  1GS4 A;  1SR7 A;  2ZFX A;  4ZN9 A;  1PRG A;  2JFA B;  4J5X C;  1MV9 A;  3OLS A;  3B66 A;  1ZAF A;  3BEJ A;  4WHG A;  4X1F A;  5KCU A;  3KMR A;  2BJ4 B;  2Q6R A;  2B50 A;  1UHL A;  3RUU A;  4UDA A;  4OH6 A;  4E4Q A;  1YOW A;  3W0C A;  5APK A;  4PP3 A;  2PIV A;  5G44 A;  2AMA A;  3B68 A;  1PDU A;  2R6Y A;  4HEE X;  1MZN A;  2AA5 A;  4DOR A;  3ET3 A;  3ET0 A;  3JZB A;  5L11 A;  5IXK A;  2QR9 A;  2Q5S A;  2HAR A;  3KMG A;  2PKL A;  1T7R A;  3FS1 A;  3KFC A;  5G45 A;  3WT7 A;  2Q6J A;  1R20 D;  2ZXZ A;  2B1Z A;  3UU7 A;  2PIO A;  4POJ A;  1KNU A;  2GTK A;  3LBD A;  4MGA B;  3CS8 A;  4ZO1 X;  5DXE A;  5AAV A;  5JJM B;  2QA8 B;  5DZ3 A;  2I4Z A;  3ADU A;  1FM9 A;  2H77 A;  1T7T A;  4IWF A;  3ADW A;  1NQ7 A;  1NQ0 A;  3VT7 A;  3VT8 A;  5C4U A;  4DMA A;  1M7W A;  4N8R A;  1RK3 A;  1L2J A;  2GIU A;  4MG5 A;  1YP0 A;  4JL4 A;  4JGV A;  4PLD A;  2P4Y A;  1NDE A;  1PQC A;  4TV1 A;  3BC5 A;  3L0E A;  1U3Q A;  4EMA A;  2V0V A;  4WVD A;  5A86 A;  5GT4 A;  3D5F A;  3R8I A;  2B1V A;  1OSH A;  2JFA A;  3RY9 A;  2ZK6 A;  3MNO A;  4PP5 A;  5K13 A;  4OFU A;  1XP9 A;  1SJ0 A;  2I4P A;  3KBA A;  2BJ4 A;  3SZ1 A;  3GD2 A;  3B0T A;  4M8E A;  5KRK A;  4RUP A;  1I38 A;  4JYG A;  5HJP B;  1XNX A;  5LGA A;  3ADV A;  3GWS X;  5KCW A;  1X76 A;  5DXM A;  3ET1 A;  3OS8 C;  2YFE A;  1S0Z A;  1R1K D;  1E3G A;  3PEQ A;  5FQT A;  4MGD B;  3X1H A;  3FAL B;  2B23 A;  4JYI A;  4PP6 A;  1FBY A;  2PIW A;  2ZNQ A;  2R40 D;  4J5X A;  5KYJ A;  3HQ5 A;  5C4S A;  3ET2 A;  3K8S A;  1P8D A;  4OJ9 A;  5E0X A;  2ZXN A;  1ZDT A;  2OZ7 A;  5ACC A;  1MVC A;  5JJM A;  2QA8 A;  2VV1 B;  3AX8 A;  3TY0 A;  4RWV A;  1K7L A;  3VHW A;  3B0Q A;  3K23 A;  2ZKC A;  3OMQ A;  3PCU A;  1SKX A;  5E1C A;  2PIQ A;  2QMV A;  3H0A A;  3GYU A;  3WJ5 A;  5DV8 A;  4PPP A;  2AA6 A;  4XAO A;  2GPP A;  2P7G A;  1QKM A;  1NQ2 A;  3WFG A;  4HLW A;  3D57 A;  3FC6 A;  1G2N A;  4RUO X;  3RVF A;  5DXQ A;  3UP3 A;  3HLV A;  4NIE A;  1S9Q A;  2PIX A;  5DYD A;  3KDU A;  4ITE A;  4S14 A;  4S0S A;  5IAW A;  1I7I A;  2P7Z A;  5DZI A;  3VI8 A;  1H9U A;  1RDT A;  2PRG A;  3OMK A;  2GWX A;  4MG9 A;  1PZL A;  4XI3 A;  3VRV A;  4G21 A;  1RDT D;  4RZF A;  4ZNV A;  1T63 A;  3W0J A;  4XUH A;  4R2U A;  5DIG A;  5KCT A;  2G44 A;  2XYJ A;  3ERD A;  4ZNS A;  3VJH A;  3R5N A;  3FAL A;  5G46 A;  3U9Q A;  3TKC A;  3OLF A;  1ERR A;  2YLP A;  3AUQ A;  3UUC A;  4K7A A;  1OT7 A;  2Q7J A;  2PNU A;  3NSP A;  1TFC A;  3W0Y A;  1TXI A;  1UPV A;  1G5Y A;  2V7C A;  3DY6 A;  5DL4 A;  4E4K A;  1OSV A;  4PXM A;  1DB1 A;  3KWY A;  2YJA B;  4R06 A;  3OOK A;  3EYB A;  2Q6S A;  1YUC A;  4TUZ B;  2YLO A;  4NQA B;  3VJT A;  3HZF A;  4PRG A;  3OS8 A;  3W0H A;  4WPF A;  4RE8 A;  1T73 A;  3R29 A;  5DK9 A;  5FQS A;  2ZMH A;  4A4V A;  3B1M A;  1FCZ A;  2XHS A;  3D24 A;  4OK1 A;  1EXA A;  2A3I A;  3RUT A;  3W5R A;  1ZGY A;  5L7E A;  4LBD A;  3P88 A;  4IU7 A;  3UUA A;  2Q1V A;  1WM0 X;  4DOS A;  1XPC A;  3L1B A;  4ITF A;  2PIT A;  2Q7L A;  4OIV A;  3MNP A;  5KRF A;  1HJ1 A;  3OKI A;  4OZR E;  2NV7 A;  2Q5G A;  2OCF A;  4ZNT A;  2QZO A;  4QL8 A;  5GID A;  5H1E A;  1T65 A;  2EWP A;  4OH5 A;  2QTU A;  4IVY A;  2Q59 A;  2AB2 A;  5DKE A;  5KCF A;  5ETH A;  1S9P A;  5JY3 A;  1XVP A;  2AAX A;  2GPV A;  5EIT A;  1XV9 B;  4KZI A;  2IOK A;  5IZ0 A;  4JAZ A;  3AZ2 A;  3OAP A;  4OJ4 A;  5DWE A;  1SQN A;  2VV4 B;  3R2A A;  1KV6 A;  5DWI A;  3UUD A;  3VTD A;  5DX3 A;  2ABI A;  4L96 A;  4POH A;  4LNX A;  3A9E A;  4KZJ A;  3BQD A;  5KRJ A;  4QM0 A;  1XLS E;  5DSH A;  2LBD A;  2OM9 A;  5AZV A;  2QNV A;  1R20 A;  1ZUC A;  3O1D A;  4G2I A;  5KR9 A;  2QH6 A;  1U3R A;  2GPO A;  3IPQ A;  1NHZ A;  4L98 A;  3WJ4 A;  1T74 A;  1U9E A;  1PQ9 A;  1ILG A;  2NW4 A;  4TUZ A;  4MG7 A;  4IW8 A;  4XUM A;  3VHU A;  2Q60 A;  2Q70 A;  5DZ0 A;  3VHV A;  4PWL A;  4MGB B;  3OSA A;  4N5G A;  2HWQ A;  3W0I A;  4CI5 A;  4M8H A;  3CQV A;  5JI0 D;  2PIP L;  2HB7 A;  3E94 A;  4RMD A;  5G3J A;  4JYH A;  3OOF A;  3V9T A;  2O4J A;  3OZJ A;  3CS4 A;  3VJS A;  4S15 A;  3S9S A;  2YAT A;  1G50 A;  4A4W A;  2ZMI A;  4OIL A;  4OZT E;  5AVL A;  2HCD A;  4IUI A;  1BSX A;  2AA2 A;  5KRM A;  4PF3 A;  3D6D A;  3PO9 A;  4OKB A;  3W0G A;  3HO0 A;  5HZC A;  2NXX E;  3IXP D;  5DXG A;  5HCV A;  4OGH A;  1RKH A;  5DUE A;  4G1Y A;  4UDB A;  1ZEO A;  3VTB A;  2Q7I A;  1GWX A;  3FLI A;  1L2I A;  5G5W A;  4ZJW A;  2FAI A;  1XDK B;  2HWR A;  2VST A;  4XTA A;  5DWG A;  3W5P A;  1XZX X;  3X1I A;  2OAX A;  4XLD A;  2QPY A;  3B3K A;  3DCU A;  3T03 A;  1R1K A;  3ADX A;  3VSP A;  2PIN A;  2W8Y A;  3WFF A;  4APU A;  4G20 A;  4OAR A;  1ZDU A;  3Q95 B;  4DM6 A;  2ZY0 A;  1DKF B;  2IOG A;  4OFR A;  2R40 A;  4EM9 A;  2H79 A;  1YIM A;  3GWX A;  5E7V A;  3VRU A;  3KPZ A;  3B0W A;  4ZN7 A;  1FM6 D;  1EXX A;  1M2Z A;  5AZT A;  4ZNU A;  1A52 A;  5E0W A;  3A3Z X;  2HAS A;  4MGA A;  2AMB A;  4A2J A;  3ZRA A;  2Q61 A;  2I0G A;  3DZY D;  3B67 A;  4MGB A;  4OJB A;  4QK4 A;  5EHJ A;  4ZJR A;  2ZL9 A;  3A78 A;  4QJR A;  3CLD A;  2JF9 A;  5L7H A;  4DK7 A;  4PVU A;  1T5Z A;  1QKT A;  2ZK4 A;  1ERE A;  1GWQ A;  1KKQ A;  4X1G A;  1FCX A;  5DLR A;  5EI1 A;  2AO6 A;  3L0L A;  5DXB B;  4REF A;  4OKX A;  3G8O A;  2Q7K A;  5DKS A;  4MDD A;  2FSZ A;  4ZO1 B;  3W0A A;  3VN2 A;  3V4A A;  3OMM A;  3DZU A;  4FHI A;  2ZK1 A;  2ZNP A;  5FQV A;  3DZU D;  2G0H A;  2VV2 A;  3CWD A;  1FD0 A;  5DXR A;  5E14 A;  3FEI A;  3A2H A;  3CJW A;  1XDK A;  1I37 A;  2VV3 A;  3WT5 A;  1LBD A;  3H52 A;  4OED A;  5DV6 A;  2XKW A;  4K4J A;  5DV3 A;  1NUO A;  2QE4 A;  3UVV B;  3UP0 A;  2P1V A;  3ILZ A;  2AWH A;  3FXV A;  1DKF A;  1Q4X A;  3KMZ A;  2J7Y A;  4MGD A;  4QE8 A;  3DT3 A;  3PBA A;  4UDD A;  1T7M A;  1YIN A;  1HG4 A;  3JZC A;  3IPU A;  3P8X A;  5DID A;  1K74 A;  3VJI A;  1Z5X E;  3X31 A;  2I0J A;  2G5O A;  3V3E A;  5AAU A;  4NY9 A;  3RLJ A;  2ACL B;  1K74 D;  2FVJ A;  3L3X A;  3L03 A;  3L3Z A;  3VT6 A;  4OEA A;  3HC5 A;  2AX7 A;  3OS9 A;  5AVI A;  3V9V A;  2VV1 A;  2ZK5 A;  2ZK3 A;  4MGC A;  3VRT A;  3AFR A;  1XNN A;  2I4J A;  3OKH A;  5B41 A;  2AYR A;  4XT9 A;  4NUF A;  3IA6 A;  5DZ1 A;  5DVV A;  3AUR A;  4G2H A;  5E19 A;  1UHL B;  3W5T A;  5LWP A;  4OEZ A;  2P1U A;  5KRL A;  1YJE A;  2ZLC A;  1RJK A;  4WHF A;  2YHD A;  3DR1 A;  5DYB A;  2J14 A;  2PJL A;  3SP6 A;  2POB A;  2QAB A;  4YPQ A;  4RAK A;  4IVW A;  3K22 A;  2P15 A;  3VT5 A;  5DU5 A;  4ZOM A;  4QE6 A;  3WMH A;  3HVL A;  1S0X A;  4WLB A;  2BAW A;  4G1D A;  1Y0S A;  3OGT A;  1UPW A;  5KRA A;  1E3K A;  4IA3 A;  1YOK A;  3A40 X;  4OIU A;  5KRO A;  3PLZ A;  2AX9 A;  2ZMJ A;  4O8F A;  1I7G A;  5DI7 A;  5HYK A;  3P89 A;  4RMC A;  4P6X A;  5AK2 A;  2OVM A;  3GZ9 A;  5I4V A;  1ZKY A;  2QXS A;  4PPS A;  5DMC A;  2Q8S A;  2O4R A;  5KRC A;  3AZ3 A;  3KYT A;  4RME A;  4R6S A;  3W5Q A;  1X7E A;  5M96 A;  3ADT A;  2J4A A;  4OEY A;  5SYZ A;  3CDP A;  4FHH A;  2YJD A;  4TV1 B;  4IA2 A;  4G1Z A;  3ZQT A;  3SP9 A;  5KCD A;  3AZ1 A;  5G43 A;  3CTB A;  1XOW A;  4ONI A;  1N46 A;  4J24 A;  4OZR U;  2OUZ A;  2HB8 A;  5HJS A;  1XLS A;  5HJP A;  4OC7 A;  5AWJ A;  1XB7 A;  2JJ3 A;  1S19 A;  3AN3 A;  5B5B A;  1X7R A;  2VSR A;  4Q0A C;  4K6I A;  4PLE A;  3E00 A;  1XJ7 A;  5FQR A;  1YY4 A;  2Q1H A;  3VT9 A;  5L7G A;  1T7F A;  3E00 D;  4IS8 A;  3R8A A;  4IQR A;  4IW6 A;  4MG8 B;  3IXP A;  3B0R A;  3CS6 A;  3B5R A;  3VT4 A;  2O9I A;  4YMQ A;  3N00 A;  5DXK A;  1XP6 A;  4IWC A;  3TKM A;  2ZNN A;  3IMY A;  3M7R A;  1NAV A;  4YT1 A;  3FUR A;  4MG6 A;  4BCR A;  5C4O A;  4J26 A;  2AA7 A;  1XV9 A;  2F4B A;  1R5K A;  5KYA A;  2ZK2 A;  3D90 A;  2Q5P A;  1QKN A;  1YA3 A;  2VV4 A;  4XHD A;  5DP0 A;  1XQ3 A;  4KZM A;  1FM9 D;  4RFW A;  5KRH A;  4RZG A;  3VSO A;  1XQC A;  1N83 A;  2NXX A;  3ZR7 A;  4IA7 A;  3OZ0 A;  3F5C B;  5FQP A;  5AWK A;  3OLL A;  1A28 A;  1GWR A;  1FM6 A;  5DKB A;  2Q3Y A;  4NB6 A;  3FC6 B;  4B7W A;  1NAX A;  1XAP A;  5ICK A;  4YNK A;  5E15 A;  5DVC A;  5APJ A;  3VTC A;  2YLY A;  2PIR A;  4N1Y A;  5DIE A;  2QGT A;  4Y29 A;  1T79 A;  4OZT U;  3DZY A;  2ZVT A;  1Y9R A;  2QXM A;  3ERT A;  1PQ6 A;  2E2R A;  5DY8 A;  2GPU A;  4MG9 B;  4Q13 A;  4J5W C;  2AM9 A;  3X36 A;  5C4T A;  5F9B A;  3R5M A;  2AX8 A;  5DZH A;  2GL8 A;  2ATH A;  1PK5 A;  4OKT A;  5DWL A;  3G0W A;  4ZI1 A;  3AN4 A;  1XP1 A;  3CDS A;  4ZNW A;  4MG8 A;  4OLM A;  2HC4 A;  1PCG A;  3ZRB A;  2ZNO A;  1YYE A;  5EGV A;  1N4H A;  3NSQ A;  4OHA A;  1R6G A;  1X7J A;  4DM8 A;  3A2I A;  4FNE A;  2VV0 A;  3E7C A;  5KD9 A;  3O1E A;  4LSJ A;  3IPS A;  1OVL B;  1YMT A;  2NPA A;  2QW4 A;  2R6W A;  3NOA A;  3QT0 A;  3V9Y A;  2G0G A;  3HC6 A;  4CSJ A;  2Z4J A;  2XYW A;  3K6P A;  5GIC A;  3V49 A;  2P1T A;  4LNW A;  1G1U A;  2GP7 A;  1X78 A;  3A2J A;  3GYT A;  3P0U A;  3WWR A;  1K4W A;  2REW A;  5EC9 A;  5KCC A;  3Q95 A;  4P6W A;  1VJB A;  5GIE A;  3F5C A;  2PIU A;  3H0A D;  3OSI A;  2Z4B A;  5EJV A;  4Q50 A;  4RUJ A;  3UUA B;  3PRG A;  5DVS A;  5APH A;  5DMF A;  5AYG A;  1NQ1 A;  1NRL A;  2YLQ A;  1NYX A;  2QA6 A;  1XIU A;  3GBK A;  3HOD A;  3KDT A;  3LMP A;  5DKG A;  3GN8 A;  5DTV A;  1M13 A;  2HAM A;  2P7A A;  2QZO B;  5HYR A;  3B65 A;  3MNE A;  2ZAS A;  3HM1 A;  3WGP A;  2IHQ A;  5DRJ A;  2Q59 B;  1ILH A;  1RKG A;  1ZH7 A;  1UOM A;  4IV2 A;  4ZNH A;  1XVP B; 
#chains in the Genus database with same CATH homology
 4DQM A;  2HVC A;  1IE9 A;  1P93 A;  2ZK0 A;  5DXB A;  3DCT A;  2QSE A;  2OVH A;  3WTQ A;  4WQP A;  1Y0X X;  4OKW A;  4CI4 A;  3V3Q A;  3UUD B;  5DRM A;  5DUG A;  5DX3 B;  5G42 A;  2HFP A;  3A9E B;  2HBH A;  2XYX A;  3G8I A;  2ZXM A;  2ZBS A;  2AX6 A;  2POG A;  1OVL A;  5DXP A;  3R8D A;  3WT6 A;  4IV4 A;  1X7B A;  1Z95 A;  4J5W A;  4N73 A;  1Z5X U;  4RZE A;  4FGY A;  4UDC A;  3UU7 B;  3F7D A;  4LTW A;  3TX7 B;  3L0J A;  3AUN A;  3OSW A;  4MG7 B;  4DK8 A;  5KCE A;  5AAV B;  3RLL A;  3UVV A;  2P54 A;  5DUH A;  2QGW A;  2ZLA A;  4FN9 A;  1LV2 A;  1QKU A;  2J7X A;  4REE A;  3FEJ A;  1T76 A;  1FCY A;  3VRW A;  4S0T A;  3VT3 A;  3G9E A;  2AXA A;  3FUG A;  3OMP A;  3ADS A;  5KRI A;  3OMO A;  1U3S A;  1IE8 A;  5CJ6 A;  5DWJ A;  2ACL A;  4F9M A;  4E2J A;  4IA1 A;  1GS4 A;  1SR7 A;  2ZFX A;  4ZN9 A;  1PRG A;  2JFA B;  4J5X C;  1MV9 A;  3OLS A;  3B66 A;  1ZAF A;  3BEJ A;  4WHG A;  4X1F A;  5KCU A;  3KMR A;  2BJ4 B;  2Q6R A;  2B50 A;  1UHL A;  3RUU A;  4UDA A;  4OH6 A;  4E4Q A;  1YOW A;  3W0C A;  5APK A;  4PP3 A;  2PIV A;  5G44 A;  2AMA A;  3B68 A;  1PDU A;  2R6Y A;  4HEE X;  1MZN A;  2AA5 A;  4DOR A;  3ET3 A;  3ET0 A;  3JZB A;  5L11 A;  5IXK A;  2QR9 A;  2Q5S A;  2HAR A;  3KMG A;  2PKL A;  1T7R A;  3FS1 A;  3KFC A;  5G45 A;  3WT7 A;  2Q6J A;  1R20 D;  2ZXZ A;  2B1Z A;  3UU7 A;  2PIO A;  4POJ A;  1KNU A;  2GTK A;  3LBD A;  4MGA B;  3CS8 A;  4ZO1 X;  5DXE A;  5AAV A;  5JJM B;  2QA8 B;  5DZ3 A;  2I4Z A;  3ADU A;  1FM9 A;  2H77 A;  1T7T A;  4IWF A;  3ADW A;  1NQ7 A;  1NQ0 A;  3VT7 A;  3VT8 A;  5C4U A;  4DMA A;  1M7W A;  4N8R A;  1RK3 A;  1L2J A;  2GIU A;  4MG5 A;  1YP0 A;  4JL4 A;  4JGV A;  4PLD A;  2P4Y A;  1NDE A;  1PQC A;  4TV1 A;  3BC5 A;  3L0E A;  1U3Q A;  4EMA A;  2V0V A;  4WVD A;  5A86 A;  5GT4 A;  3D5F A;  3R8I A;  2B1V A;  1OSH A;  2JFA A;  3RY9 A;  2ZK6 A;  3MNO A;  4PP5 A;  5K13 A;  4OFU A;  1XP9 A;  1SJ0 A;  2I4P A;  3KBA A;  2BJ4 A;  3SZ1 A;  3GD2 A;  3B0T A;  4M8E A;  5KRK A;  4RUP A;  1I38 A;  4JYG A;  5HJP B;  1XNX A;  5LGA A;  3ADV A;  3GWS X;  5KCW A;  1X76 A;  5DXM A;  3ET1 A;  3OS8 C;  2YFE A;  1S0Z A;  1R1K D;  1E3G A;  3PEQ A;  5FQT A;  4MGD B;  3X1H A;  3FAL B;  2B23 A;  4JYI A;  4PP6 A;  1FBY A;  2PIW A;  2ZNQ A;  2R40 D;  4J5X A;  5KYJ A;  3HQ5 A;  5C4S A;  3ET2 A;  3K8S A;  1P8D A;  4OJ9 A;  5E0X A;  2ZXN A;  1ZDT A;  2OZ7 A;  5ACC A;  1MVC A;  5JJM A;  2QA8 A;  2VV1 B;  3AX8 A;  3TY0 A;  4RWV A;  1K7L A;  3VHW A;  3B0Q A;  3K23 A;  2ZKC A;  3OMQ A;  3PCU A;  1SKX A;  5E1C A;  2PIQ A;  2QMV A;  3H0A A;  3GYU A;  3WJ5 A;  5DV8 A;  4PPP A;  2AA6 A;  4XAO A;  2GPP A;  2P7G A;  1QKM A;  1NQ2 A;  3WFG A;  4HLW A;  3D57 A;  3FC6 A;  1G2N A;  4RUO X;  3RVF A;  5DXQ A;  3UP3 A;  3HLV A;  4NIE A;  1S9Q A;  2PIX A;  5DYD A;  3KDU A;  4ITE A;  4S14 A;  4S0S A;  5IAW A;  1I7I A;  2P7Z A;  5DZI A;  3VI8 A;  1H9U A;  1RDT A;  2PRG A;  3OMK A;  2GWX A;  4MG9 A;  1PZL A;  4XI3 A;  3VRV A;  4G21 A;  1RDT D;  4RZF A;  4ZNV A;  1T63 A;  3W0J A;  4XUH A;  4R2U A;  5DIG A;  5KCT A;  2G44 A;  2XYJ A;  3ERD A;  4ZNS A;  3VJH A;  3R5N A;  3FAL A;  5G46 A;  3U9Q A;  3TKC A;  3OLF A;  1ERR A;  2YLP A;  3AUQ A;  3UUC A;  4K7A A;  1OT7 A;  2Q7J A;  2PNU A;  3NSP A;  1TFC A;  3W0Y A;  1TXI A;  1UPV A;  1G5Y A;  2V7C A;  3DY6 A;  5DL4 A;  4E4K A;  1OSV A;  4PXM A;  1DB1 A;  3KWY A;  2YJA B;  4R06 A;  3OOK A;  3EYB A;  2Q6S A;  1YUC A;  4TUZ B;  2YLO A;  4NQA B;  3VJT A;  3HZF A;  4PRG A;  3OS8 A;  3W0H A;  4WPF A;  4RE8 A;  1T73 A;  3R29 A;  5DK9 A;  5FQS A;  2ZMH A;  4A4V A;  3B1M A;  1FCZ A;  2XHS A;  3D24 A;  4OK1 A;  1EXA A;  2A3I A;  3RUT A;  3W5R A;  1ZGY A;  5L7E A;  4LBD A;  3P88 A;  4IU7 A;  3UUA A;  2Q1V A;  1WM0 X;  4DOS A;  1XPC A;  3L1B A;  4ITF A;  2PIT A;  2Q7L A;  4OIV A;  3MNP A;  5KRF A;  1HJ1 A;  3OKI A;  4OZR E;  2NV7 A;  2Q5G A;  2OCF A;  4ZNT A;  2QZO A;  4QL8 A;  5GID A;  5H1E A;  1T65 A;  2EWP A;  4OH5 A;  2QTU A;  4IVY A;  2Q59 A;  2AB2 A;  5DKE A;  5KCF A;  5ETH A;  1S9P A;  5JY3 A;  1XVP A;  2AAX A;  2GPV A;  5EIT A;  1XV9 B;  4KZI A;  2IOK A;  5IZ0 A;  4JAZ A;  3AZ2 A;  3OAP A;  4OJ4 A;  5DWE A;  1SQN A;  2VV4 B;  3R2A A;  1KV6 A;  5DWI A;  3UUD A;  3VTD A;  5DX3 A;  2ABI A;  4L96 A;  4POH A;  4LNX A;  3A9E A;  4KZJ A;  3BQD A;  5KRJ A;  4QM0 A;  1XLS E;  5DSH A;  2LBD A;  2OM9 A;  5AZV A;  2QNV A;  1R20 A;  1ZUC A;  3O1D A;  4G2I A;  5KR9 A;  2QH6 A;  1U3R A;  2GPO A;  3IPQ A;  1NHZ A;  4L98 A;  3WJ4 A;  1T74 A;  1U9E A;  1PQ9 A;  1ILG A;  2NW4 A;  4TUZ A;  4MG7 A;  4IW8 A;  4XUM A;  3VHU A;  2Q60 A;  2Q70 A;  5DZ0 A;  3VHV A;  4PWL A;  4MGB B;  3OSA A;  4N5G A;  2HWQ A;  3W0I A;  4CI5 A;  4M8H A;  3CQV A;  5JI0 D;  2PIP L;  2HB7 A;  3E94 A;  4RMD A;  5G3J A;  4JYH A;  3OOF A;  3V9T A;  2O4J A;  3OZJ A;  3CS4 A;  3VJS A;  4S15 A;  3S9S A;  2YAT A;  1G50 A;  4A4W A;  2ZMI A;  4OIL A;  4OZT E;  5AVL A;  2HCD A;  4IUI A;  1BSX A;  2AA2 A;  5KRM A;  4PF3 A;  3D6D A;  3PO9 A;  4OKB A;  3W0G A;  3HO0 A;  5HZC A;  2NXX E;  3IXP D;  5DXG A;  5HCV A;  4OGH A;  1RKH A;  5DUE A;  4G1Y A;  4UDB A;  1ZEO A;  3VTB A;  2Q7I A;  1GWX A;  3FLI A;  1L2I A;  5G5W A;  4ZJW A;  2FAI A;  1XDK B;  2HWR A;  2VST A;  4XTA A;  5DWG A;  3W5P A;  1XZX X;  3X1I A;  2OAX A;  4XLD A;  2QPY A;  3B3K A;  3DCU A;  3T03 A;  1R1K A;  3ADX A;  3VSP A;  2PIN A;  2W8Y A;  3WFF A;  4APU A;  4G20 A;  4OAR A;  1ZDU A;  3Q95 B;  4DM6 A;  2ZY0 A;  1DKF B;  2IOG A;  4OFR A;  2R40 A;  4EM9 A;  2H79 A;  1YIM A;  3GWX A;  5E7V A;  3VRU A;  3KPZ A;  3B0W A;  4ZN7 A;  1FM6 D;  1EXX A;  1M2Z A;  5AZT A;  4ZNU A;  1A52 A;  5E0W A;  3A3Z X;  2HAS A;  4MGA A;  2AMB A;  4A2J A;  3ZRA A;  2Q61 A;  2I0G A;  3DZY D;  3B67 A;  4MGB A;  4OJB A;  4QK4 A;  5EHJ A;  4ZJR A;  2ZL9 A;  3A78 A;  4QJR A;  3CLD A;  2JF9 A;  5L7H A;  4DK7 A;  4PVU A;  1T5Z A;  1QKT A;  2ZK4 A;  1ERE A;  1GWQ A;  1KKQ A;  4X1G A;  1FCX A;  5DLR A;  5EI1 A;  2AO6 A;  3L0L A;  5DXB B;  4REF A;  4OKX A;  3G8O A;  2Q7K A;  5DKS A;  4MDD A;  2FSZ A;  4ZO1 B;  3W0A A;  3VN2 A;  3V4A A;  3OMM A;  3DZU A;  4FHI A;  2ZK1 A;  2ZNP A;  5FQV A;  3DZU D;  2G0H A;  2VV2 A;  3CWD A;  1FD0 A;  5DXR A;  5E14 A;  3FEI A;  3A2H A;  3CJW A;  1XDK A;  1I37 A;  2VV3 A;  3WT5 A;  1LBD A;  3H52 A;  4OED A;  5DV6 A;  2XKW A;  4K4J A;  5DV3 A;  1NUO A;  2QE4 A;  3UVV B;  3UP0 A;  2P1V A;  3ILZ A;  2AWH A;  3FXV A;  1DKF A;  1Q4X A;  3KMZ A;  2J7Y A;  4MGD A;  4QE8 A;  3DT3 A;  3PBA A;  4UDD A;  1T7M A;  1YIN A;  1HG4 A;  3JZC A;  3IPU A;  3P8X A;  5DID A;  1K74 A;  3VJI A;  1Z5X E;  3X31 A;  2I0J A;  2G5O A;  3V3E A;  5AAU A;  4NY9 A;  3RLJ A;  2ACL B;  1K74 D;  2FVJ A;  3L3X A;  3L03 A;  3L3Z A;  3VT6 A;  4OEA A;  3HC5 A;  2AX7 A;  3OS9 A;  5AVI A;  3V9V A;  2VV1 A;  2ZK5 A;  2ZK3 A;  4MGC A;  3VRT A;  3AFR A;  1XNN A;  2I4J A;  3OKH A;  5B41 A;  2AYR A;  4XT9 A;  4NUF A;  3IA6 A;  5DZ1 A;  5DVV A;  3AUR A;  4G2H A;  5E19 A;  1UHL B;  3W5T A;  5LWP A;  4OEZ A;  2P1U A;  5KRL A;  1YJE A;  2ZLC A;  1RJK A;  4WHF A;  2YHD A;  3DR1 A;  5DYB A;  2J14 A;  2PJL A;  3SP6 A;  2POB A;  2QAB A;  4YPQ A;  4RAK A;  4IVW A;  3K22 A;  2P15 A;  3VT5 A;  5DU5 A;  4ZOM A;  4QE6 A;  3WMH A;  3HVL A;  1S0X A;  4WLB A;  2BAW A;  4G1D A;  1Y0S A;  3OGT A;  1UPW A;  5KRA A;  1E3K A;  4IA3 A;  1YOK A;  3A40 X;  4OIU A;  5KRO A;  3PLZ A;  2AX9 A;  2ZMJ A;  4O8F A;  1I7G A;  5DI7 A;  5HYK A;  3P89 A;  4RMC A;  4P6X A;  5AK2 A;  2OVM A;  3GZ9 A;  5I4V A;  1ZKY A;  2QXS A;  4PPS A;  5DMC A;  2Q8S A;  2O4R A;  5KRC A;  3AZ3 A;  3KYT A;  4RME A;  4R6S A;  3W5Q A;  1X7E A;  5M96 A;  3ADT A;  2J4A A;  4OEY A;  5SYZ A;  3CDP A;  4FHH A;  2YJD A;  4TV1 B;  4IA2 A;  4G1Z A;  3ZQT A;  3SP9 A;  5KCD A;  3AZ1 A;  5G43 A;  3CTB A;  1XOW A;  4ONI A;  1N46 A;  4J24 A;  4OZR U;  2OUZ A;  2HB8 A;  5HJS A;  1XLS A;  5HJP A;  4OC7 A;  5AWJ A;  1XB7 A;  2JJ3 A;  1S19 A;  3AN3 A;  5B5B A;  1X7R A;  2VSR A;  4Q0A C;  4K6I A;  4PLE A;  3E00 A;  1XJ7 A;  5FQR A;  1YY4 A;  2Q1H A;  3VT9 A;  5L7G A;  1T7F A;  3E00 D;  4IS8 A;  3R8A A;  4IQR A;  4IW6 A;  4MG8 B;  3IXP A;  3B0R A;  3CS6 A;  3B5R A;  3VT4 A;  2O9I A;  4YMQ A;  3N00 A;  5DXK A;  1XP6 A;  4IWC A;  3TKM A;  2ZNN A;  3IMY A;  3M7R A;  1NAV A;  4YT1 A;  3FUR A;  4MG6 A;  4BCR A;  5C4O A;  4J26 A;  2AA7 A;  1XV9 A;  2F4B A;  1R5K A;  5KYA A;  2ZK2 A;  3D90 A;  2Q5P A;  1QKN A;  1YA3 A;  2VV4 A;  4XHD A;  5DP0 A;  1XQ3 A;  4KZM A;  1FM9 D;  4RFW A;  5KRH A;  4RZG A;  3VSO A;  1XQC A;  1N83 A;  2NXX A;  3ZR7 A;  4IA7 A;  3OZ0 A;  3F5C B;  5FQP A;  5AWK A;  3OLL A;  1A28 A;  1GWR A;  1FM6 A;  5DKB A;  2Q3Y A;  4NB6 A;  3FC6 B;  4B7W A;  1NAX A;  1XAP A;  5ICK A;  4YNK A;  5E15 A;  5DVC A;  5APJ A;  3VTC A;  2YLY A;  2PIR A;  4N1Y A;  5DIE A;  2QGT A;  4Y29 A;  1T79 A;  4OZT U;  3DZY A;  2ZVT A;  1Y9R A;  2QXM A;  3ERT A;  1PQ6 A;  2E2R A;  5DY8 A;  2GPU A;  4MG9 B;  4Q13 A;  4J5W C;  2AM9 A;  3X36 A;  5C4T A;  5F9B A;  3R5M A;  2AX8 A;  5DZH A;  2GL8 A;  2ATH A;  1PK5 A;  4OKT A;  5DWL A;  3G0W A;  4ZI1 A;  3AN4 A;  1XP1 A;  3CDS A;  4ZNW A;  4MG8 A;  4OLM A;  2HC4 A;  1PCG A;  3ZRB A;  2ZNO A;  1YYE A;  5EGV A;  1N4H A;  3NSQ A;  4OHA A;  1R6G A;  1X7J A;  4DM8 A;  3A2I A;  4FNE A;  2VV0 A;  3E7C A;  5KD9 A;  3O1E A;  4LSJ A;  3IPS A;  1OVL B;  1YMT A;  2NPA A;  2QW4 A;  2R6W A;  3NOA A;  3QT0 A;  3V9Y A;  2G0G A;  3HC6 A;  4CSJ A;  2Z4J A;  2XYW A;  3K6P A;  5GIC A;  3V49 A;  2P1T A;  4LNW A;  1G1U A;  2GP7 A;  1X78 A;  3A2J A;  3GYT A;  3P0U A;  3WWR A;  1K4W A;  2REW A;  5EC9 A;  5KCC A;  3Q95 A;  4P6W A;  1VJB A;  5GIE A;  3F5C A;  2PIU A;  3H0A D;  3OSI A;  2Z4B A;  5EJV A;  4Q50 A;  4RUJ A;  3UUA B;  3PRG A;  5DVS A;  5APH A;  5DMF A;  5AYG A;  1NQ1 A;  1NRL A;  2YLQ A;  1NYX A;  2QA6 A;  1XIU A;  3GBK A;  3HOD A;  3KDT A;  3LMP A;  5DKG A;  3GN8 A;  5DTV A;  1M13 A;  2HAM A;  2P7A A;  2QZO B;  5HYR A;  3B65 A;  3MNE A;  2ZAS A;  3HM1 A;  3WGP A;  2IHQ A;  5DRJ A;  2Q59 B;  1ILH A;  1RKG A;  1ZH7 A;  1UOM A;  4IV2 A;  4ZNH A;  1XVP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...