4E4QA

Crystal structure of ppargamma with the ligand fs214
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
268
structure length
268
Chain Sequence
ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New 2-(Aryloxy)-3-phenylpropanoic Acids as Peroxisome Proliferator-Activated Receptor alpha/gamma Dual Agonists Able To Upregulate Mitochondrial Carnitine Shuttle System Gene Expression.
pubmed doi rcsb
molecule keywords Peroxisome proliferator-activated receptor gamma
molecule tags Transcription
source organism Homo sapiens
total genus 97
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4e4qA00
4MG5A 1WM0X 4CSJA 4L98A 4PF3A 4ZNUA 3OSIA 4PLEA 3FXVA 2REWA 3R29A 5IAWA 1YMTA 1I7IA 5E1CA 1XLSE 5AZVA 3AN3A 2R6YA 2H77A 5DV3A 2G5OA 5DVCA 2E2RA 3CS6A 3R5NA 4RUPA 2YLOA 5AVLA 3V9TA 4A2JA 4A4WA 4RMCA 3W0JA 4E4QA 5LWPA 2J7YA 1FCXA 2ZFXA 1ZEOA 3GYTA 3PO9A 2XYXA 4FNEA 4OKBA 1OT7A 4RMEA 1FM9D 2Q6SA 3V9YA 5KRLA 3L0EA 2R40A 2R40D 3GWXA 4J5XA 5DUGA 5M96A 4ZJRA 2Z4BA 2Q6RA 4ZNHA 3AX8A 4OFRA 3V49A 5DWEA 1M7WA 3X36A 4TUZB 4IA2A 4OKWA 4FGYA 1U3SA 2BJ4A 3L0JA 1M13A 3AUQA 4PPSA 4S15A 4TV1A 3B68A 3UU7B 2FVJA 3AURA 3FLIA 2PIOA 5HCVA 4ZNWA 1OVLB 3FUGA 2QNVA 3HZFA 2QGWA 4MGDB 3W0HA 4POHA 3HM1A 2I0GA 4QL8A 1QKUA 5KYJA 3RUUA 3VJHA 4JYGA 3K23A 2NW4A 4YPQA 5EHJA 2Q59B 2HBHA 1RDTA 2EWPA 1A52A 1RDTD 3HC6A 3L0LA 1T7MA 3B0TA 1PZLA 5APKA 5FQRA 4R2UA 1T5ZA 1U9EA 4IA1A 3WT6A 1L2IA 2Z4JA 4IWFA 5JI0D 4JL4A 5DSHA 3A78A 4UDBA 2POGA 5E0XA 5KRJA 1ZDTA 2P7GA 5DU5A 1GWQA 3Q95A 2AX7A 1PQCA 1I37A 2QXMA 3ADVA 3L3XA 4UDCA 2G0GA 4RZGA 4XI3A 5DKEA 3QT0A 4XT9A 3E00D 3OGTA 5KRCA 2HB7A 1KNUA 2ZK0A 3FURA 3B3KA 1LBDA 2ZNPA 1YJEA 3ET2A 1KKQA 1TFCA 3OKHA 4OIUA 4PP6A 3DCTA 2ZK3A 4CI4A 1T76A 2QZOA 4K7AA 4OJ4A 5DXEA 5G3JA 3ERDA 3ILZA 1XZXX 1YUCA 5DMCA 5G44A 4O8FA 5KRMA 3FEJA 5DXKA 3TKMA 3X1HA 2NV7A 3WFGA 5G43A 2YLYA 3PEQA 3WT5A 1X7RA 2VV2A 5AVIA 5G5WA 3DZYA 3DZYD 1IE9A 5DMFA 3DZUD 5G42A 2HFPA 5KRIA 3VHVA 1NQ0A 2VV1A 3D5FA 1YOKA 2HB8A 1XPCA 4N8RA 2NXXA 2G44A 4XUHA 2AA7A 3VRWA 1RKGA 2Q61A 1S0ZA 3ZR7A 1XP1A 4OKXA 5DXRA 4ZN7A 3PRGA 2XYWA 2Q3YA 3DR1A 3K6PA 2Q59A 2P1TA 4OC7A 1T7RA 5KYAA 3A9EA 1T79A 4JGVA 1XJ7A 3OSAA 4OARA 4PP5A 1LV2A 3X1IA 2P1UA 3WGPA 1DKFA 2ZKCA 3B1MA 1KV6A 2ZXZA 5DVSA 3ADUA 1L2JA 2HASA 2PIVA 5DP0A 3HODA 2BJ4B 3A2JA 3AUNA 1SQNA 5DXGA 2JF9A 4ITFA 4XLDA 3VT5A 3R5MA 3W5TA 5JJMA 1E3GA 2IOKA 3A40X 2ZNNA 1YA3A 3PLZA 3RY9A 4EMAA 4IA3A 3AFRA 2QE4A 4LSJA 4RZEA 3W0IA 5L7GA 4NUFA 4OHAA 1R6GA 3WTQA 1UPWA 2P7ZA 3OMPA 4OEYA 2PITA 3HC5A 3OOFA 3FS1A 2ZK4A 4P6XA 4OZTE 2I4ZA 3VN2A 3OOKA 4ITEA 3BQDA 3MNOA 3UP3A 3WJ4A 2JJ3A 4R6SA 2ZXMA 4X1FA 3W5QA 1MVCA 2Q1VA 2FSZA 3G8OA 2POBA 2P54A 4POJA 2QPYA 1NHZA 1R5KA 1Q4XA 3F5CB 5E19A 5APJA 2V7CA 4PP3A 3Q95B 3KBAA 3VT7A 2B1ZA 3IPSA 5IZ0A 1X76A 5LGAA 4OGHA 3TX7B 2HWRA 1K4WA 3CTBA 3FC6A 3HLVA 4YNKA 1Y9RA 5E0WA 2ZMJA 3G0WA 4OH6A 4K6IA 1XIUA 3V9VA 4RUOX 4RE8A 4DMAA 4LNWA 1NRLA 5F9BA 5KROA 5KRHA 2AA6A 2QZOB 5KRKA 3CLDA 1NQ7A 2Q5GA 5DL4A 5L7EA 1ILGA 4OH5A 4MG6A 1MV9A 1VJBA 2AXAA 2NXXE 3GWSX 3VJTA 1MZNA 1RKHA 3LMPA 3V3QA 1NQ1A 3JZBA 5EJVA 4IV4A 3CJWA 1PDUA 5FQVA 5KCFA 1S9PA 3OZ0A 2LBDA 4L96A 3WFFA 2YHDA 4IW8A 4IVYA 2AMAA 1HJ1A 3VI8A 2A3IA 5AAUA 3B67A 2HC4A 4ZO1X 5SYZA 2ATHA 2Q70A 3ADTA 2AAXA 3ERTA 3KMZA 2VV1B 3OMMA 3PCUA 5DLRA 3W0YA 1SKXA 3E94A 1U3RA 1G2NA 3MNPA 1X7BA 3PBAA 2PIWA 4PVUA 3B66A 4YT1A 2AX6A 2OUZA 4G1YA 2AM9A 2PNUA 3G9EA 3A9EB 5DKBA 5AAVA 3CDPA 2GP7A 2VV3A 3OMKA 1X7EA 1ZDUA 1GWXA 5DWGA 1DKFB 4MGBB 3T03A 3BEJA 5KRAA 3UVVB 2QSEA 2ZK5A 3D6DA 3F5CA 5DKSA 4IQRA 4KZJA 1DB1A 3ADSA 5AWKA 5JJMB 4S14A 2HARA 4WPFA 4NQAB 3S9SA 2Q7IA 3MNEA 2Q7KA 2G0HA 5GIEA 4S0TA 5ETHA 1FBYA 3VTCA 1NQ2A 3GZ9A 4DM8A 3VJIA 5KCCA 1OSVA 1XP6A 3RLLA 1G1UA 1X78A 3P0UA 5GICA 1P93A 1UPVA 2AB2A 1I38A 5C4TA 4DK7A 1EREA 2I0JA 2QA8A 4IA7A 5AK2A 5DIDA 3A3ZX 4OKTA 4J26A 4LNXA 2O4JA 4WVDA 4FN9A 4OIVA 2ZBSA 3IPQA 2PIUA 4E2JA 2QH6A 2GPPA 4N73A 2XYJA 4RUJA 5A86A 2GPUA 4MGAA 3UUAA 1E3KA 1IE8A 2ZK2A 4OZRE 2ZMIA 2ZNOA 5DZ0A 4DORA 2O9IA 3N00A 4OJ9A 4IW6A 5DUHA 4UDDA 5DY8A 3ZRAA 1Y0SA 1TXIA 4IV2A 3FC6B 1YYEA 1PCGA 3AZ1A 1N4HA 2Q8SA 1ZUCA 4G1ZA 1NUOA 2GWXA 4WLBA 5G46A 5B5BA 5DZIA 5HYKA 5APHA 3D90A 2YATA 4LTWA 2BAWA 2ZK6A 2J4AA 3B5RA 2PIRA 3HQ5A 5DIEA 5L7HA 2F4BA 2ZNQA 3VT3A 5DK9A 2ZY0A 5L11A 5DXPA 2HAMA 5DRMA 1XVPA 4REEA 3JZCA 3VSOA 4MGBA 5DXMA 1XQ3A 1G5YA 5AWJA 3UVVA 4MDDA 1PQ9A 2I4PA 5DZ1A 4YMQA 2VV4A 5KCWA 1P8DA 5DRJA 1H9UA 4OEZA 5KRFA 3KMRA 1FM6A 1UOMA 3F7DA 1FM6D 1U3QA 3FALA 3P88A 4XAOA 3R8DA 3VT8A 5DTVA 5EC9A 4Y29A 5DV8A 3H0AA 1XAPA 3OAPA 2IHQA 2OVHA 3FEIA 2VSTA 4MG8A 1BSXA 5IXKA 1M2ZA 3W0GA 2Q60A 2AYRA 4QE8A 2QTUA 4J5WC 1EXAA 5HJPA 3IXPA 5AAVB 2O4RA 4N1YA 4WHGA 2VV0A 5KD9A 2J14A 3P89A 4WHFA 2Q7LA 1FCYA 2W8YA 4PRGA 3SP9A 3W0CA 3ADXA 3EYBA 1YY4A 3RVFA 2PIQA 5DWIA 3CDSA 4A4VA 2NPAA 4DOSA 4QE6A 4N5GA 3ET0A 2ZLAA 3L1BA 3VSPA 3ZQTA 2GPVA 1N83A 3HO0A 1XP9A 4FHHA 2GPOA 2ACLB 1T7FA 2OCFA 5DWLA 2QA6A 2AO6A 1HG4A 4E4KA 3KDTA 2GL8A 3V3EA 1OSHA 3A2HA 3IMYA 3OLLA 4RMDA 1GWRA 1YOWA 2I4JA 3OS9A 5AYGA 3GD2A 5I4VA 1FCZA 5G45A 1SR7A 4G20A 1ZKYA 2Q6JA 4Q13A 5E14A 4M8EA 3A2IA 5FQSA 2ZL9A 2P7AA 2QA8B 2QXSA 4JYIA 3VTDA 4J5XC 3G8IA 3O1DA 3OS8C 4OZRU 4LBDA 4NIEA 1YIMA 3VRTA 3AZ2A 3CS4A 3OLSA 1XV9A 1T65A 4G1DA 4IWCA 4P6WA 4MGAB 4XTAA 3UUAB 3RUTA 5C4UA 2H79A 2Q1HA 5DXQA 1SJ0A 4QM0A 5DX3A 2GIUA 5KCDA 1QKTA 5DKGA 2ABIA 3E7CA 5C4OA 3RLJA 4IU7A 4MG7A 5KCTA 5DYBA 3GN8A 3SP6A 3VHWA 1S0XA 2PIXA 2ZASA 1Y0XX 2QW4A 3LBDA 4OJBA 5E7VA 2XKWA 3B65A 5HJSA 5DYDA 1I7GA 3GBKA 1FM9A 3VT9A 4DK8A 4ZNVA 2QMVA 4S0SA 4REFA 4XHDA 3SZ1A 4G2IA 2OVMA 4HLWA 3OS8A 4M8HA 2YLQA 5ACCA 2PIPL 3ADWA 1XVPB 1T73A 5DUEA 4F9MA 1XDKB 3R8AA 2B1VA 4JYHA 2YJDA 3B0WA 4K4JA 3H52A 2P15A 2VV4B 3AN4A 1S9QA 3NSQA 3TY0A 2AWHA 1NYXA 1R1KA 2HVCA 4NB6A 1R1KD 1T7TA 5DV6A 1NAXA 3FALB 4EM9A 4DM6A 2ACLA 3CWDA 4OZTU 5EGVA 2PRGA 4ZO1B 3UUCA 3DT3A 3K22A 4MG8B 4RAKA 5HYRA 5DXBA 1Z5XE 3B0RA 1G50A 4RWVA 4PLDA 5K13A 5DZ3A 5HJPB 2YLPA 4PXMA 3UUDB 2JFAA 5GIDA 1RK3A 2ZLCA 1PRGA 4Q50A 4APUA 2VSRA 4MG9A 1FD0A 3BC5A 3ZRBA 1GS4A 2ZK1A 1R20A 1UHLA 1R20D 2OZ7A 1XB7A 3B0QA 5FQPA 3KPZA 2YFEA 3NSPA 3ET3A 4ZNTA 5DZHA 3WJ5A 1K7LA 4XUMA 3E00A 2ZVTA 5DIGA 4CI5A 2B23A 3K8SA 3P8XA 1XQCA 3ET1A 1ZAFA 1QKNA 1ILHA 4KZMA 4OILA 4ZN9A 4ZNSA 5EITA 4G21A 2J7XA 3R8IA 1Z95A 4OLMA 4OEDA 1YP0A 1PQ6A 4DQMA 4OEAA 3VT6A 2V0VA 2AMBA 5DI7A 3V4AA 4HEEX 3VJSA 2Q5PA 4J24A 2QGTA 3IA6A 4PWLA 5KCEA 5FQTA 3D57A 4B7WA 1XLSA 3WWRA 2P1VA 3DY6A 1N46A 4JAZA 1EXXA 2PKLA 3NOAA 3R2AA 4PPPA 4TUZA 5ICKA 4UDAA 1XV9B 1T63A 1XDKA 1X7JA 1RJKA 1NDEA 3L03A 3UU7A 2B50A 3VRVA 3DZUA 3KYTA 2AA2A 5DX3B 3OMOA 1OVLA 2ZXNA 1YINA 3AZ3A 3CQVA 4G2HA 4MGDA 4MG7B 3VTBA 1PK5A 5AZTA 1NAVA 5H1EA 3H0AD 3O1EA 2P4YA 2FAIA 1ZH7A 3W5PA 3U9QA 1XOWA 3IPUA 3VT4A 5EI1A 2PJLA 4OFUA 3X31A 4RZFA 4ZOMA 4NY9A 1XNNA 5KR9A 3IXPD 2Q7JA 3UUDA 4R06A 2AX9A 3OMQA 2IOGA 3OSWA 4RFWA 4FHIA 5B41A 4ONIA 2GTKA 3KDUA 4IVWA 4MGCA 4OK1A 1ZGYA 2QABA 5CJ6A 1S19A 3CS8A 2OAXA 3HVLA 4TV1B 3VHUA 5KCUA 5C4SA 4IS8A 3GYUA 4QJRA 3WT7A 5DWJA 3OLFA 3W5RA 4ZJWA 3KFCA 4BCRA 2HWQA 4Q0AC 2PINA 4ZI1A 1Z5XU 2HCDA 2QR9A 3OKIA 3WMHA 2ZMHA 3M7RA 4WQPA 4QK4A 5E15A 3DCUA 5DXBB 3KMGA 3L3ZA 5DVVA 4J5WA 4KZIA 5GT4A 1K74A 1XNXA 2Q5SA 1K74D 4IUIA 2YJAB 1ERRA 1T74A 4X1GA 2JFAB 3W0AA 2AA5A 1QKMA 3TKCA 4MG9B 3KWYA 2AX8A 2OM9A 3D24A 1UHLB 2XHSA 2R6WA 1A28A 3OZJA 3VRUA 5HZCA 5JY3A 3UP0A
chains in the Genus database with same CATH superfamily
4MG5A 1WM0X 4CSJA 4L98A 4PF3A 4ZNUA 3OSIA 4PLEA 3FXVA 2REWA 3R29A 5IAWA 1YMTA 1I7IA 5E1CA 1XLSE 5AZVA 3AN3A 2R6YA 2H77A 5DV3A 2G5OA 5DVCA 2E2RA 3CS6A 3R5NA 4RUPA 2YLOA 5AVLA 3V9TA 4A2JA 4A4WA 4RMCA 3W0JA 4E4QA 5LWPA 2J7YA 1FCXA 2ZFXA 1ZEOA 3GYTA 3PO9A 2XYXA 4FNEA 4OKBA 1OT7A 4RMEA 1FM9D 2Q6SA 3V9YA 5KRLA 3L0EA 2R40A 2R40D 3GWXA 4J5XA 5DUGA 5M96A 4ZJRA 2Z4BA 2Q6RA 4ZNHA 3AX8A 4OFRA 3V49A 5DWEA 1M7WA 3X36A 4TUZB 4IA2A 4OKWA 4FGYA 1U3SA 2BJ4A 3L0JA 1M13A 3AUQA 4PPSA 4S15A 4TV1A 3B68A 3UU7B 2FVJA 3AURA 3FLIA 2PIOA 5HCVA 4ZNWA 1OVLB 3FUGA 2QNVA 3HZFA 2QGWA 4MGDB 3W0HA 4POHA 3HM1A 2I0GA 4QL8A 1QKUA 5KYJA 3RUUA 3VJHA 4JYGA 3K23A 2NW4A 4YPQA 5EHJA 2Q59B 2HBHA 1RDTA 2EWPA 1A52A 1RDTD 3HC6A 3L0LA 1T7MA 3B0TA 1PZLA 5APKA 5FQRA 4R2UA 1T5ZA 1U9EA 4IA1A 3WT6A 1L2IA 2Z4JA 4IWFA 5JI0D 4JL4A 5DSHA 3A78A 4UDBA 2POGA 5E0XA 5KRJA 1ZDTA 2P7GA 5DU5A 1GWQA 3Q95A 2AX7A 1PQCA 1I37A 2QXMA 3ADVA 3L3XA 4UDCA 2G0GA 4RZGA 4XI3A 5DKEA 3QT0A 4XT9A 3E00D 3OGTA 5KRCA 2HB7A 1KNUA 2ZK0A 3FURA 3B3KA 1LBDA 2ZNPA 1YJEA 3ET2A 1KKQA 1TFCA 3OKHA 4OIUA 4PP6A 3DCTA 2ZK3A 4CI4A 1T76A 2QZOA 4K7AA 4OJ4A 5DXEA 5G3JA 3ERDA 3ILZA 1XZXX 1YUCA 5DMCA 5G44A 4O8FA 5KRMA 3FEJA 5DXKA 3TKMA 3X1HA 2NV7A 3WFGA 5G43A 2YLYA 3PEQA 3WT5A 1X7RA 2VV2A 5AVIA 5G5WA 3DZYA 3DZYD 1IE9A 5DMFA 3DZUD 5G42A 2HFPA 5KRIA 3VHVA 1NQ0A 2VV1A 3D5FA 1YOKA 2HB8A 1XPCA 4N8RA 2NXXA 2G44A 4XUHA 2AA7A 3VRWA 1RKGA 2Q61A 1S0ZA 3ZR7A 1XP1A 4OKXA 5DXRA 4ZN7A 3PRGA 2XYWA 2Q3YA 3DR1A 3K6PA 2Q59A 2P1TA 4OC7A 1T7RA 5KYAA 3A9EA 1T79A 4JGVA 1XJ7A 3OSAA 4OARA 4PP5A 1LV2A 3X1IA 2P1UA 3WGPA 1DKFA 2ZKCA 3B1MA 1KV6A 2ZXZA 5DVSA 3ADUA 1L2JA 2HASA 2PIVA 5DP0A 3HODA 2BJ4B 3A2JA 3AUNA 1SQNA 5DXGA 2JF9A 4ITFA 4XLDA 3VT5A 3R5MA 3W5TA 5JJMA 1E3GA 2IOKA 3A40X 2ZNNA 1YA3A 3PLZA 3RY9A 4EMAA 4IA3A 3AFRA 2QE4A 4LSJA 4RZEA 3W0IA 5L7GA 4NUFA 4OHAA 1R6GA 3WTQA 1UPWA 2P7ZA 3OMPA 4OEYA 2PITA 3HC5A 3OOFA 3FS1A 2ZK4A 4P6XA 4OZTE 2I4ZA 3VN2A 3OOKA 4ITEA 3BQDA 3MNOA 3UP3A 3WJ4A 2JJ3A 4R6SA 2ZXMA 4X1FA 3W5QA 1MVCA 2Q1VA 2FSZA 3G8OA 2POBA 2P54A 4POJA 2QPYA 1NHZA 1R5KA 1Q4XA 3F5CB 5E19A 5APJA 2V7CA 4PP3A 3Q95B 3KBAA 3VT7A 2B1ZA 3IPSA 5IZ0A 1X76A 5LGAA 4OGHA 3TX7B 2HWRA 1K4WA 3CTBA 3FC6A 3HLVA 4YNKA 1Y9RA 5E0WA 2ZMJA 3G0WA 4OH6A 4K6IA 1XIUA 3V9VA 4RUOX 4RE8A 4DMAA 4LNWA 1NRLA 5F9BA 5KROA 5KRHA 2AA6A 2QZOB 5KRKA 3CLDA 1NQ7A 2Q5GA 5DL4A 5L7EA 1ILGA 4OH5A 4MG6A 1MV9A 1VJBA 2AXAA 2NXXE 3GWSX 3VJTA 1MZNA 1RKHA 3LMPA 3V3QA 1NQ1A 3JZBA 5EJVA 4IV4A 3CJWA 1PDUA 5FQVA 5KCFA 1S9PA 3OZ0A 2LBDA 4L96A 3WFFA 2YHDA 4IW8A 4IVYA 2AMAA 1HJ1A 3VI8A 2A3IA 5AAUA 3B67A 2HC4A 4ZO1X 5SYZA 2ATHA 2Q70A 3ADTA 2AAXA 3ERTA 3KMZA 2VV1B 3OMMA 3PCUA 5DLRA 3W0YA 1SKXA 3E94A 1U3RA 1G2NA 3MNPA 1X7BA 3PBAA 2PIWA 4PVUA 3B66A 4YT1A 2AX6A 2OUZA 4G1YA 2AM9A 2PNUA 3G9EA 3A9EB 5DKBA 5AAVA 3CDPA 2GP7A 2VV3A 3OMKA 1X7EA 1ZDUA 1GWXA 5DWGA 1DKFB 4MGBB 3T03A 3BEJA 5KRAA 3UVVB 2QSEA 2ZK5A 3D6DA 3F5CA 5DKSA 4IQRA 4KZJA 1DB1A 3ADSA 5AWKA 5JJMB 4S14A 2HARA 4WPFA 4NQAB 3S9SA 2Q7IA 3MNEA 2Q7KA 2G0HA 5GIEA 4S0TA 5ETHA 1FBYA 3VTCA 1NQ2A 3GZ9A 4DM8A 3VJIA 5KCCA 1OSVA 1XP6A 3RLLA 1G1UA 1X78A 3P0UA 5GICA 1P93A 1UPVA 2AB2A 1I38A 5C4TA 4DK7A 1EREA 2I0JA 2QA8A 4IA7A 5AK2A 5DIDA 3A3ZX 4OKTA 4J26A 4LNXA 2O4JA 4WVDA 4FN9A 4OIVA 2ZBSA 3IPQA 2PIUA 4E2JA 2QH6A 2GPPA 4N73A 2XYJA 4RUJA 5A86A 2GPUA 4MGAA 3UUAA 1E3KA 1IE8A 2ZK2A 4OZRE 2ZMIA 2ZNOA 5DZ0A 4DORA 2O9IA 3N00A 4OJ9A 4IW6A 5DUHA 4UDDA 5DY8A 3ZRAA 1Y0SA 1TXIA 4IV2A 3FC6B 1YYEA 1PCGA 3AZ1A 1N4HA 2Q8SA 1ZUCA 4G1ZA 1NUOA 2GWXA 4WLBA 5G46A 5B5BA 5DZIA 5HYKA 5APHA 3D90A 2YATA 4LTWA 2BAWA 2ZK6A 2J4AA 3B5RA 2PIRA 3HQ5A 5DIEA 5L7HA 2F4BA 2ZNQA 3VT3A 5DK9A 2ZY0A 5L11A 5DXPA 2HAMA 5DRMA 1XVPA 4REEA 3JZCA 3VSOA 4MGBA 5DXMA 1XQ3A 1G5YA 5AWJA 3UVVA 4MDDA 1PQ9A 2I4PA 5DZ1A 4YMQA 2VV4A 5KCWA 1P8DA 5DRJA 1H9UA 4OEZA 5KRFA 3KMRA 1FM6A 1UOMA 3F7DA 1FM6D 1U3QA 3FALA 3P88A 4XAOA 3R8DA 3VT8A 5DTVA 5EC9A 4Y29A 5DV8A 3H0AA 1XAPA 3OAPA 2IHQA 2OVHA 3FEIA 2VSTA 4MG8A 1BSXA 5IXKA 1M2ZA 3W0GA 2Q60A 2AYRA 4QE8A 2QTUA 4J5WC 1EXAA 5HJPA 3IXPA 5AAVB 2O4RA 4N1YA 4WHGA 2VV0A 5KD9A 2J14A 3P89A 4WHFA 2Q7LA 1FCYA 2W8YA 4PRGA 3SP9A 3W0CA 3ADXA 3EYBA 1YY4A 3RVFA 2PIQA 5DWIA 3CDSA 4A4VA 2NPAA 4DOSA 4QE6A 4N5GA 3ET0A 2ZLAA 3L1BA 3VSPA 3ZQTA 2GPVA 1N83A 3HO0A 1XP9A 4FHHA 2GPOA 2ACLB 1T7FA 2OCFA 5DWLA 2QA6A 2AO6A 1HG4A 4E4KA 3KDTA 2GL8A 3V3EA 1OSHA 3A2HA 3IMYA 3OLLA 4RMDA 1GWRA 1YOWA 2I4JA 3OS9A 5AYGA 3GD2A 5I4VA 1FCZA 5G45A 1SR7A 4G20A 1ZKYA 2Q6JA 4Q13A 5E14A 4M8EA 3A2IA 5FQSA 2ZL9A 2P7AA 2QA8B 2QXSA 4JYIA 3VTDA 4J5XC 3G8IA 3O1DA 3OS8C 4OZRU 4LBDA 4NIEA 1YIMA 3VRTA 3AZ2A 3CS4A 3OLSA 1XV9A 1T65A 4G1DA 4IWCA 4P6WA 4MGAB 4XTAA 3UUAB 3RUTA 5C4UA 2H79A 2Q1HA 5DXQA 1SJ0A 4QM0A 5DX3A 2GIUA 5KCDA 1QKTA 5DKGA 2ABIA 3E7CA 5C4OA 3RLJA 4IU7A 4MG7A 5KCTA 5DYBA 3GN8A 3SP6A 3VHWA 1S0XA 2PIXA 2ZASA 1Y0XX 2QW4A 3LBDA 4OJBA 5E7VA 2XKWA 3B65A 5HJSA 5DYDA 1I7GA 3GBKA 1FM9A 3VT9A 4DK8A 4ZNVA 2QMVA 4S0SA 4REFA 4XHDA 3SZ1A 4G2IA 2OVMA 4HLWA 3OS8A 4M8HA 2YLQA 5ACCA 2PIPL 3ADWA 1XVPB 1T73A 5DUEA 4F9MA 1XDKB 3R8AA 2B1VA 4JYHA 2YJDA 3B0WA 4K4JA 3H52A 2P15A 2VV4B 3AN4A 1S9QA 3NSQA 3TY0A 2AWHA 1NYXA 1R1KA 2HVCA 4NB6A 1R1KD 1T7TA 5DV6A 1NAXA 3FALB 4EM9A 4DM6A 2ACLA 3CWDA 4OZTU 5EGVA 2PRGA 4ZO1B 3UUCA 3DT3A 3K22A 4MG8B 4RAKA 5HYRA 5DXBA 1Z5XE 3B0RA 1G50A 4RWVA 4PLDA 5K13A 5DZ3A 5HJPB 2YLPA 4PXMA 3UUDB 2JFAA 5GIDA 1RK3A 2ZLCA 1PRGA 4Q50A 4APUA 2VSRA 4MG9A 1FD0A 3BC5A 3ZRBA 1GS4A 2ZK1A 1R20A 1UHLA 1R20D 2OZ7A 1XB7A 3B0QA 5FQPA 3KPZA 2YFEA 3NSPA 3ET3A 4ZNTA 5DZHA 3WJ5A 1K7LA 4XUMA 3E00A 2ZVTA 5DIGA 4CI5A 2B23A 3K8SA 3P8XA 1XQCA 3ET1A 1ZAFA 1QKNA 1ILHA 4KZMA 4OILA 4ZN9A 4ZNSA 5EITA 4G21A 2J7XA 3R8IA 1Z95A 4OLMA 4OEDA 1YP0A 1PQ6A 4DQMA 4OEAA 3VT6A 2V0VA 2AMBA 5DI7A 3V4AA 4HEEX 3VJSA 2Q5PA 4J24A 2QGTA 3IA6A 4PWLA 5KCEA 5FQTA 3D57A 4B7WA 1XLSA 3WWRA 2P1VA 3DY6A 1N46A 4JAZA 1EXXA 2PKLA 3NOAA 3R2AA 4PPPA 4TUZA 5ICKA 4UDAA 1XV9B 1T63A 1XDKA 1X7JA 1RJKA 1NDEA 3L03A 3UU7A 2B50A 3VRVA 3DZUA 3KYTA 2AA2A 5DX3B 3OMOA 1OVLA 2ZXNA 1YINA 3AZ3A 3CQVA 4G2HA 4MGDA 4MG7B 3VTBA 1PK5A 5AZTA 1NAVA 5H1EA 3H0AD 3O1EA 2P4YA 2FAIA 1ZH7A 3W5PA 3U9QA 1XOWA 3IPUA 3VT4A 5EI1A 2PJLA 4OFUA 3X31A 4RZFA 4ZOMA 4NY9A 1XNNA 5KR9A 3IXPD 2Q7JA 3UUDA 4R06A 2AX9A 3OMQA 2IOGA 3OSWA 4RFWA 4FHIA 5B41A 4ONIA 2GTKA 3KDUA 4IVWA 4MGCA 4OK1A 1ZGYA 2QABA 5CJ6A 1S19A 3CS8A 2OAXA 3HVLA 4TV1B 3VHUA 5KCUA 5C4SA 4IS8A 3GYUA 4QJRA 3WT7A 5DWJA 3OLFA 3W5RA 4ZJWA 3KFCA 4BCRA 2HWQA 4Q0AC 2PINA 4ZI1A 1Z5XU 2HCDA 2QR9A 3OKIA 3WMHA 2ZMHA 3M7RA 4WQPA 4QK4A 5E15A 3DCUA 5DXBB 3KMGA 3L3ZA 5DVVA 4J5WA 4KZIA 5GT4A 1K74A 1XNXA 2Q5SA 1K74D 4IUIA 2YJAB 1ERRA 1T74A 4X1GA 2JFAB 3W0AA 2AA5A 1QKMA 3TKCA 4MG9B 3KWYA 2AX8A 2OM9A 3D24A 1UHLB 2XHSA 2R6WA 1A28A 3OZJA 3VRUA 5HZCA 5JY3A 3UP0A
chains in the Genus database with same CATH topology
4MG5A 1WM0X 4CSJA 4L98A 4PF3A 4ZNUA 3OSIA 4PLEA 3FXVA 2REWA 3R29A 5IAWA 1YMTA 1I7IA 5E1CA 1XLSE 5AZVA 3AN3A 2R6YA 2H77A 5DV3A 2G5OA 5DVCA 2E2RA 3CS6A 3R5NA 4RUPA 2YLOA 5AVLA 3V9TA 4A2JA 4A4WA 4RMCA 3W0JA 4E4QA 5LWPA 2J7YA 1FCXA 2ZFXA 1ZEOA 3GYTA 3PO9A 2XYXA 4FNEA 4OKBA 1OT7A 4RMEA 1FM9D 2Q6SA 3V9YA 5KRLA 3L0EA 2R40A 2R40D 3GWXA 4J5XA 5DUGA 5M96A 4ZJRA 2Z4BA 2Q6RA 4ZNHA 3AX8A 4OFRA 3V49A 5DWEA 1M7WA 3X36A 4TUZB 4IA2A 4OKWA 4FGYA 1U3SA 2BJ4A 3L0JA 1M13A 3AUQA 4PPSA 4S15A 4TV1A 3B68A 3UU7B 2FVJA 3AURA 3FLIA 2PIOA 5HCVA 4ZNWA 1OVLB 3FUGA 2QNVA 3HZFA 2QGWA 4MGDB 3W0HA 4POHA 3HM1A 2I0GA 4QL8A 1QKUA 5KYJA 3RUUA 3VJHA 4JYGA 3K23A 2NW4A 4YPQA 5EHJA 2Q59B 2HBHA 1RDTA 2EWPA 1A52A 1RDTD 3HC6A 3L0LA 1T7MA 3B0TA 1PZLA 5APKA 5FQRA 4R2UA 1T5ZA 1U9EA 4IA1A 3WT6A 1L2IA 2Z4JA 4IWFA 5JI0D 4JL4A 5DSHA 3A78A 4UDBA 2POGA 5E0XA 5KRJA 1ZDTA 2P7GA 5DU5A 1GWQA 3Q95A 2AX7A 1PQCA 1I37A 2QXMA 3ADVA 3L3XA 4UDCA 2G0GA 4RZGA 4XI3A 5DKEA 3QT0A 4XT9A 3E00D 3OGTA 5KRCA 2HB7A 1KNUA 2ZK0A 3FURA 3B3KA 1LBDA 2ZNPA 1YJEA 3ET2A 1KKQA 1TFCA 3OKHA 4OIUA 4PP6A 3DCTA 2ZK3A 4CI4A 1T76A 2QZOA 4K7AA 4OJ4A 5DXEA 5G3JA 3ERDA 3ILZA 1XZXX 1YUCA 5DMCA 5G44A 4O8FA 5KRMA 3FEJA 5DXKA 3TKMA 3X1HA 2NV7A 3WFGA 5G43A 2YLYA 3PEQA 3WT5A 1X7RA 2VV2A 5AVIA 5G5WA 3DZYA 3DZYD 1IE9A 5DMFA 3DZUD 5G42A 2HFPA 5KRIA 3VHVA 1NQ0A 2VV1A 3D5FA 1YOKA 2HB8A 1XPCA 4N8RA 2NXXA 2G44A 4XUHA 2AA7A 3VRWA 1RKGA 2Q61A 1S0ZA 3ZR7A 1XP1A 4OKXA 5DXRA 4ZN7A 3PRGA 2XYWA 2Q3YA 3DR1A 3K6PA 2Q59A 2P1TA 4OC7A 1T7RA 5KYAA 3A9EA 1T79A 4JGVA 1XJ7A 3OSAA 4OARA 4PP5A 1LV2A 3X1IA 2P1UA 3WGPA 1DKFA 2ZKCA 3B1MA 1KV6A 2ZXZA 5DVSA 3ADUA 1L2JA 2HASA 2PIVA 5DP0A 3HODA 2BJ4B 3A2JA 3AUNA 1SQNA 5DXGA 2JF9A 4ITFA 4XLDA 3VT5A 3R5MA 3W5TA 5JJMA 1E3GA 2IOKA 3A40X 2ZNNA 1YA3A 3PLZA 3RY9A 4EMAA 4IA3A 3AFRA 2QE4A 4LSJA 4RZEA 3W0IA 5L7GA 4NUFA 4OHAA 1R6GA 3WTQA 1UPWA 2P7ZA 3OMPA 4OEYA 2PITA 3HC5A 3OOFA 3FS1A 2ZK4A 4P6XA 4OZTE 2I4ZA 3VN2A 3OOKA 4ITEA 3BQDA 3MNOA 3UP3A 3WJ4A 2JJ3A 4R6SA 2ZXMA 4X1FA 3W5QA 1MVCA 2Q1VA 2FSZA 3G8OA 2POBA 2P54A 4POJA 2QPYA 1NHZA 1R5KA 1Q4XA 3F5CB 5E19A 5APJA 2V7CA 4PP3A 3Q95B 3KBAA 3VT7A 2B1ZA 3IPSA 5IZ0A 1X76A 5LGAA 4OGHA 3TX7B 2HWRA 1K4WA 3CTBA 3FC6A 3HLVA 4YNKA 1Y9RA 5E0WA 2ZMJA 3G0WA 4OH6A 4K6IA 1XIUA 3V9VA 4RUOX 4RE8A 4DMAA 4LNWA 1NRLA 5F9BA 5KROA 5KRHA 2AA6A 2QZOB 5KRKA 3CLDA 1NQ7A 2Q5GA 5DL4A 5L7EA 1ILGA 4OH5A 4MG6A 1MV9A 1VJBA 2AXAA 2NXXE 3GWSX 3VJTA 1MZNA 1RKHA 3LMPA 3V3QA 1NQ1A 3JZBA 5EJVA 4IV4A 3CJWA 1PDUA 5FQVA 5KCFA 1S9PA 3OZ0A 2LBDA 4L96A 3WFFA 2YHDA 4IW8A 4IVYA 2AMAA 1HJ1A 3VI8A 2A3IA 5AAUA 3B67A 2HC4A 4ZO1X 5SYZA 2ATHA 2Q70A 3ADTA 2AAXA 3ERTA 3KMZA 2VV1B 3OMMA 3PCUA 5DLRA 3W0YA 1SKXA 3E94A 1U3RA 1G2NA 3MNPA 1X7BA 3PBAA 2PIWA 4PVUA 3B66A 4YT1A 2AX6A 2OUZA 4G1YA 2AM9A 2PNUA 3G9EA 3A9EB 5DKBA 5AAVA 3CDPA 2GP7A 2VV3A 3OMKA 1X7EA 1ZDUA 1GWXA 5DWGA 1DKFB 4MGBB 3T03A 3BEJA 5KRAA 3UVVB 2QSEA 2ZK5A 3D6DA 3F5CA 5DKSA 4IQRA 4KZJA 1DB1A 3ADSA 5AWKA 5JJMB 4S14A 2HARA 4WPFA 4NQAB 3S9SA 2Q7IA 3MNEA 2Q7KA 2G0HA 5GIEA 4S0TA 5ETHA 1FBYA 3VTCA 1NQ2A 3GZ9A 4DM8A 3VJIA 5KCCA 1OSVA 1XP6A 3RLLA 1G1UA 1X78A 3P0UA 5GICA 1P93A 1UPVA 2AB2A 1I38A 5C4TA 4DK7A 1EREA 2I0JA 2QA8A 4IA7A 5AK2A 5DIDA 3A3ZX 4OKTA 4J26A 4LNXA 2O4JA 4WVDA 4FN9A 4OIVA 2ZBSA 3IPQA 2PIUA 4E2JA 2QH6A 2GPPA 4N73A 2XYJA 4RUJA 5A86A 2GPUA 4MGAA 3UUAA 1E3KA 1IE8A 2ZK2A 4OZRE 2ZMIA 2ZNOA 5DZ0A 4DORA 2O9IA 3N00A 4OJ9A 4IW6A 5DUHA 4UDDA 5DY8A 3ZRAA 1Y0SA 1TXIA 4IV2A 3FC6B 1YYEA 1PCGA 3AZ1A 1N4HA 2Q8SA 1ZUCA 4G1ZA 1NUOA 2GWXA 4WLBA 5G46A 5B5BA 5DZIA 5HYKA 5APHA 3D90A 2YATA 4LTWA 2BAWA 2ZK6A 2J4AA 3B5RA 2PIRA 3HQ5A 5DIEA 5L7HA 2F4BA 2ZNQA 3VT3A 5DK9A 2ZY0A 5L11A 5DXPA 2HAMA 5DRMA 1XVPA 4REEA 3JZCA 3VSOA 4MGBA 5DXMA 1XQ3A 1G5YA 5AWJA 3UVVA 4MDDA 1PQ9A 2I4PA 5DZ1A 4YMQA 2VV4A 5KCWA 1P8DA 5DRJA 1H9UA 4OEZA 5KRFA 3KMRA 1FM6A 1UOMA 3F7DA 1FM6D 1U3QA 3FALA 3P88A 4XAOA 3R8DA 3VT8A 5DTVA 5EC9A 4Y29A 5DV8A 3H0AA 1XAPA 3OAPA 2IHQA 2OVHA 3FEIA 2VSTA 4MG8A 1BSXA 5IXKA 1M2ZA 3W0GA 2Q60A 2AYRA 4QE8A 2QTUA 4J5WC 1EXAA 5HJPA 3IXPA 5AAVB 2O4RA 4N1YA 4WHGA 2VV0A 5KD9A 2J14A 3P89A 4WHFA 2Q7LA 1FCYA 2W8YA 4PRGA 3SP9A 3W0CA 3ADXA 3EYBA 1YY4A 3RVFA 2PIQA 5DWIA 3CDSA 4A4VA 2NPAA 4DOSA 4QE6A 4N5GA 3ET0A 2ZLAA 3L1BA 3VSPA 3ZQTA 2GPVA 1N83A 3HO0A 1XP9A 4FHHA 2GPOA 2ACLB 1T7FA 2OCFA 5DWLA 2QA6A 2AO6A 1HG4A 4E4KA 3KDTA 2GL8A 3V3EA 1OSHA 3A2HA 3IMYA 3OLLA 4RMDA 1GWRA 1YOWA 2I4JA 3OS9A 5AYGA 3GD2A 5I4VA 1FCZA 5G45A 1SR7A 4G20A 1ZKYA 2Q6JA 4Q13A 5E14A 4M8EA 3A2IA 5FQSA 2ZL9A 2P7AA 2QA8B 2QXSA 4JYIA 3VTDA 4J5XC 3G8IA 3O1DA 3OS8C 4OZRU 4LBDA 4NIEA 1YIMA 3VRTA 3AZ2A 3CS4A 3OLSA 1XV9A 1T65A 4G1DA 4IWCA 4P6WA 4MGAB 4XTAA 3UUAB 3RUTA 5C4UA 2H79A 2Q1HA 5DXQA 1SJ0A 4QM0A 5DX3A 2GIUA 5KCDA 1QKTA 5DKGA 2ABIA 3E7CA 5C4OA 3RLJA 4IU7A 4MG7A 5KCTA 5DYBA 3GN8A 3SP6A 3VHWA 1S0XA 2PIXA 2ZASA 1Y0XX 2QW4A 3LBDA 4OJBA 5E7VA 2XKWA 3B65A 5HJSA 5DYDA 1I7GA 3GBKA 1FM9A 3VT9A 4DK8A 4ZNVA 2QMVA 4S0SA 4REFA 4XHDA 3SZ1A 4G2IA 2OVMA 4HLWA 3OS8A 4M8HA 2YLQA 5ACCA 2PIPL 3ADWA 1XVPB 1T73A 5DUEA 4F9MA 1XDKB 3R8AA 2B1VA 4JYHA 2YJDA 3B0WA 4K4JA 3H52A 2P15A 2VV4B 3AN4A 1S9QA 3NSQA 3TY0A 2AWHA 1NYXA 1R1KA 2HVCA 4NB6A 1R1KD 1T7TA 5DV6A 1NAXA 3FALB 4EM9A 4DM6A 2ACLA 3CWDA 4OZTU 5EGVA 2PRGA 4ZO1B 3UUCA 3DT3A 3K22A 4MG8B 4RAKA 5HYRA 5DXBA 1Z5XE 3B0RA 1G50A 4RWVA 4PLDA 5K13A 5DZ3A 5HJPB 2YLPA 4PXMA 3UUDB 2JFAA 5GIDA 1RK3A 2ZLCA 1PRGA 4Q50A 4APUA 2VSRA 4MG9A 1FD0A 3BC5A 3ZRBA 1GS4A 2ZK1A 1R20A 1UHLA 1R20D 2OZ7A 1XB7A 3B0QA 5FQPA 3KPZA 2YFEA 3NSPA 3ET3A 4ZNTA 5DZHA 3WJ5A 1K7LA 4XUMA 3E00A 2ZVTA 5DIGA 4CI5A 2B23A 3K8SA 3P8XA 1XQCA 3ET1A 1ZAFA 1QKNA 1ILHA 4KZMA 4OILA 4ZN9A 4ZNSA 5EITA 4G21A 2J7XA 3R8IA 1Z95A 4OLMA 4OEDA 1YP0A 1PQ6A 4DQMA 4OEAA 3VT6A 2V0VA 2AMBA 5DI7A 3V4AA 4HEEX 3VJSA 2Q5PA 4J24A 2QGTA 3IA6A 4PWLA 5KCEA 5FQTA 3D57A 4B7WA 1XLSA 3WWRA 2P1VA 3DY6A 1N46A 4JAZA 1EXXA 2PKLA 3NOAA 3R2AA 4PPPA 4TUZA 5ICKA 4UDAA 1XV9B 1T63A 1XDKA 1X7JA 1RJKA 1NDEA 3L03A 3UU7A 2B50A 3VRVA 3DZUA 3KYTA 2AA2A 5DX3B 3OMOA 1OVLA 2ZXNA 1YINA 3AZ3A 3CQVA 4G2HA 4MGDA 4MG7B 3VTBA 1PK5A 5AZTA 1NAVA 5H1EA 3H0AD 3O1EA 2P4YA 2FAIA 1ZH7A 3W5PA 3U9QA 1XOWA 3IPUA 3VT4A 5EI1A 2PJLA 4OFUA 3X31A 4RZFA 4ZOMA 4NY9A 1XNNA 5KR9A 3IXPD 2Q7JA 3UUDA 4R06A 2AX9A 3OMQA 2IOGA 3OSWA 4RFWA 4FHIA 5B41A 4ONIA 2GTKA 3KDUA 4IVWA 4MGCA 4OK1A 1ZGYA 2QABA 5CJ6A 1S19A 3CS8A 2OAXA 3HVLA 4TV1B 3VHUA 5KCUA 5C4SA 4IS8A 3GYUA 4QJRA 3WT7A 5DWJA 3OLFA 3W5RA 4ZJWA 3KFCA 4BCRA 2HWQA 4Q0AC 2PINA 4ZI1A 1Z5XU 2HCDA 2QR9A 3OKIA 3WMHA 2ZMHA 3M7RA 4WQPA 4QK4A 5E15A 3DCUA 5DXBB 3KMGA 3L3ZA 5DVVA 4J5WA 4KZIA 5GT4A 1K74A 1XNXA 2Q5SA 1K74D 4IUIA 2YJAB 1ERRA 1T74A 4X1GA 2JFAB 3W0AA 2AA5A 1QKMA 3TKCA 4MG9B 3KWYA 2AX8A 2OM9A 3D24A 1UHLB 2XHSA 2R6WA 1A28A 3OZJA 3VRUA 5HZCA 5JY3A 3UP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MG5 A;  1WM0 X;  4CSJ A;  4L98 A;  4PF3 A;  4ZNU A;  3OSI A;  4PLE A;  3FXV A;  2REW A;  3R29 A;  5IAW A;  1YMT A;  1I7I A;  5E1C A;  1XLS E;  5AZV A;  3AN3 A;  2R6Y A;  2H77 A;  5DV3 A;  2G5O A;  5DVC A;  2E2R A;  3CS6 A;  3R5N A;  4RUP A;  2YLO A;  5AVL A;  3V9T A;  4A2J A;  4A4W A;  4RMC A;  3W0J A;  4E4Q A;  5LWP A;  2J7Y A;  1FCX A;  2ZFX A;  1ZEO A;  3GYT A;  3PO9 A;  2XYX A;  4FNE A;  4OKB A;  1OT7 A;  4RME A;  1FM9 D;  2Q6S A;  3V9Y A;  5KRL A;  3L0E A;  2R40 A;  2R40 D;  3GWX A;  4J5X A;  5DUG A;  5M96 A;  4ZJR A;  2Z4B A;  2Q6R A;  4ZNH A;  3AX8 A;  4OFR A;  3V49 A;  5DWE A;  1M7W A;  3X36 A;  4TUZ B;  4IA2 A;  4OKW A;  4FGY A;  1U3S A;  2BJ4 A;  3L0J A;  1M13 A;  3AUQ A;  4PPS A;  4S15 A;  4TV1 A;  3B68 A;  3UU7 B;  2FVJ A;  3AUR A;  3FLI A;  2PIO A;  5HCV A;  4ZNW A;  1OVL B;  3FUG A;  2QNV A;  3HZF A;  2QGW A;  4MGD B;  3W0H A;  4POH A;  3HM1 A;  2I0G A;  4QL8 A;  1QKU A;  5KYJ A;  3RUU A;  3VJH A;  4JYG A;  3K23 A;  2NW4 A;  4YPQ A;  5EHJ A;  2Q59 B;  2HBH A;  1RDT A;  2EWP A;  1A52 A;  1RDT D;  3HC6 A;  3L0L A;  1T7M A;  3B0T A;  1PZL A;  5APK A;  5FQR A;  4R2U A;  1T5Z A;  1U9E A;  4IA1 A;  3WT6 A;  1L2I A;  2Z4J A;  4IWF A;  5JI0 D;  4JL4 A;  5DSH A;  3A78 A;  4UDB A;  2POG A;  5E0X A;  5KRJ A;  1ZDT A;  2P7G A;  5DU5 A;  1GWQ A;  3Q95 A;  2AX7 A;  1PQC A;  1I37 A;  2QXM A;  3ADV A;  3L3X A;  4UDC A;  2G0G A;  4RZG A;  4XI3 A;  5DKE A;  3QT0 A;  4XT9 A;  3E00 D;  3OGT A;  5KRC A;  2HB7 A;  1KNU A;  2ZK0 A;  3FUR A;  3B3K A;  1LBD A;  2ZNP A;  1YJE A;  3ET2 A;  1KKQ A;  1TFC A;  3OKH A;  4OIU A;  4PP6 A;  3DCT A;  2ZK3 A;  4CI4 A;  1T76 A;  2QZO A;  4K7A A;  4OJ4 A;  5DXE A;  5G3J A;  3ERD A;  3ILZ A;  1XZX X;  1YUC A;  5DMC A;  5G44 A;  4O8F A;  5KRM A;  3FEJ A;  5DXK A;  3TKM A;  3X1H A;  2NV7 A;  3WFG A;  5G43 A;  2YLY A;  3PEQ A;  3WT5 A;  1X7R A;  2VV2 A;  5AVI A;  5G5W A;  3DZY A;  3DZY D;  1IE9 A;  5DMF A;  3DZU D;  5G42 A;  2HFP A;  5KRI A;  3VHV A;  1NQ0 A;  2VV1 A;  3D5F A;  1YOK A;  2HB8 A;  1XPC A;  4N8R A;  2NXX A;  2G44 A;  4XUH A;  2AA7 A;  3VRW A;  1RKG A;  2Q61 A;  1S0Z A;  3ZR7 A;  1XP1 A;  4OKX A;  5DXR A;  4ZN7 A;  3PRG A;  2XYW A;  2Q3Y A;  3DR1 A;  3K6P A;  2Q59 A;  2P1T A;  4OC7 A;  1T7R A;  5KYA A;  3A9E A;  1T79 A;  4JGV A;  1XJ7 A;  3OSA A;  4OAR A;  4PP5 A;  1LV2 A;  3X1I A;  2P1U A;  3WGP A;  1DKF A;  2ZKC A;  3B1M A;  1KV6 A;  2ZXZ A;  5DVS A;  3ADU A;  1L2J A;  2HAS A;  2PIV A;  5DP0 A;  3HOD A;  2BJ4 B;  3A2J A;  3AUN A;  1SQN A;  5DXG A;  2JF9 A;  4ITF A;  4XLD A;  3VT5 A;  3R5M A;  3W5T A;  5JJM A;  1E3G A;  2IOK A;  3A40 X;  2ZNN A;  1YA3 A;  3PLZ A;  3RY9 A;  4EMA A;  4IA3 A;  3AFR A;  2QE4 A;  4LSJ A;  4RZE A;  3W0I A;  5L7G A;  4NUF A;  4OHA A;  1R6G A;  3WTQ A;  1UPW A;  2P7Z A;  3OMP A;  4OEY A;  2PIT A;  3HC5 A;  3OOF A;  3FS1 A;  2ZK4 A;  4P6X A;  4OZT E;  2I4Z A;  3VN2 A;  3OOK A;  4ITE A;  3BQD A;  3MNO A;  3UP3 A;  3WJ4 A;  2JJ3 A;  4R6S A;  2ZXM A;  4X1F A;  3W5Q A;  1MVC A;  2Q1V A;  2FSZ A;  3G8O A;  2POB A;  2P54 A;  4POJ A;  2QPY A;  1NHZ A;  1R5K A;  1Q4X A;  3F5C B;  5E19 A;  5APJ A;  2V7C A;  4PP3 A;  3Q95 B;  3KBA A;  3VT7 A;  2B1Z A;  3IPS A;  5IZ0 A;  1X76 A;  5LGA A;  4OGH A;  3TX7 B;  2HWR A;  1K4W A;  3CTB A;  3FC6 A;  3HLV A;  4YNK A;  1Y9R A;  5E0W A;  2ZMJ A;  3G0W A;  4OH6 A;  4K6I A;  1XIU A;  3V9V A;  4RUO X;  4RE8 A;  4DMA A;  4LNW A;  1NRL A;  5F9B A;  5KRO A;  5KRH A;  2AA6 A;  2QZO B;  5KRK A;  3CLD A;  1NQ7 A;  2Q5G A;  5DL4 A;  5L7E A;  1ILG A;  4OH5 A;  4MG6 A;  1MV9 A;  1VJB A;  2AXA A;  2NXX E;  3GWS X;  3VJT A;  1MZN A;  1RKH A;  3LMP A;  3V3Q A;  1NQ1 A;  3JZB A;  5EJV A;  4IV4 A;  3CJW A;  1PDU A;  5FQV A;  5KCF A;  1S9P A;  3OZ0 A;  2LBD A;  4L96 A;  3WFF A;  2YHD A;  4IW8 A;  4IVY A;  2AMA A;  1HJ1 A;  3VI8 A;  2A3I A;  5AAU A;  3B67 A;  2HC4 A;  4ZO1 X;  5SYZ A;  2ATH A;  2Q70 A;  3ADT A;  2AAX A;  3ERT A;  3KMZ A;  2VV1 B;  3OMM A;  3PCU A;  5DLR A;  3W0Y A;  1SKX A;  3E94 A;  1U3R A;  1G2N A;  3MNP A;  1X7B A;  3PBA A;  2PIW A;  4PVU A;  3B66 A;  4YT1 A;  2AX6 A;  2OUZ A;  4G1Y A;  2AM9 A;  2PNU A;  3G9E A;  3A9E B;  5DKB A;  5AAV A;  3CDP A;  2GP7 A;  2VV3 A;  3OMK A;  1X7E A;  1ZDU A;  1GWX A;  5DWG A;  1DKF B;  4MGB B;  3T03 A;  3BEJ A;  5KRA A;  3UVV B;  2QSE A;  2ZK5 A;  3D6D A;  3F5C A;  5DKS A;  4IQR A;  4KZJ A;  1DB1 A;  3ADS A;  5AWK A;  5JJM B;  4S14 A;  2HAR A;  4WPF A;  4NQA B;  3S9S A;  2Q7I A;  3MNE A;  2Q7K A;  2G0H A;  5GIE A;  4S0T A;  5ETH A;  1FBY A;  3VTC A;  1NQ2 A;  3GZ9 A;  4DM8 A;  3VJI A;  5KCC A;  1OSV A;  1XP6 A;  3RLL A;  1G1U A;  1X78 A;  3P0U A;  5GIC A;  1P93 A;  1UPV A;  2AB2 A;  1I38 A;  5C4T A;  4DK7 A;  1ERE A;  2I0J A;  2QA8 A;  4IA7 A;  5AK2 A;  5DID A;  3A3Z X;  4OKT A;  4J26 A;  4LNX A;  2O4J A;  4WVD A;  4FN9 A;  4OIV A;  2ZBS A;  3IPQ A;  2PIU A;  4E2J A;  2QH6 A;  2GPP A;  4N73 A;  2XYJ A;  4RUJ A;  5A86 A;  2GPU A;  4MGA A;  3UUA A;  1E3K A;  1IE8 A;  2ZK2 A;  4OZR E;  2ZMI A;  2ZNO A;  5DZ0 A;  4DOR A;  2O9I A;  3N00 A;  4OJ9 A;  4IW6 A;  5DUH A;  4UDD A;  5DY8 A;  3ZRA A;  1Y0S A;  1TXI A;  4IV2 A;  3FC6 B;  1YYE A;  1PCG A;  3AZ1 A;  1N4H A;  2Q8S A;  1ZUC A;  4G1Z A;  1NUO A;  2GWX A;  4WLB A;  5G46 A;  5B5B A;  5DZI A;  5HYK A;  5APH A;  3D90 A;  2YAT A;  4LTW A;  2BAW A;  2ZK6 A;  2J4A A;  3B5R A;  2PIR A;  3HQ5 A;  5DIE A;  5L7H A;  2F4B A;  2ZNQ A;  3VT3 A;  5DK9 A;  2ZY0 A;  5L11 A;  5DXP A;  2HAM A;  5DRM A;  1XVP A;  4REE A;  3JZC A;  3VSO A;  4MGB A;  5DXM A;  1XQ3 A;  1G5Y A;  5AWJ A;  3UVV A;  4MDD A;  1PQ9 A;  2I4P A;  5DZ1 A;  4YMQ A;  2VV4 A;  5KCW A;  1P8D A;  5DRJ A;  1H9U A;  4OEZ A;  5KRF A;  3KMR A;  1FM6 A;  1UOM A;  3F7D A;  1FM6 D;  1U3Q A;  3FAL A;  3P88 A;  4XAO A;  3R8D A;  3VT8 A;  5DTV A;  5EC9 A;  4Y29 A;  5DV8 A;  3H0A A;  1XAP A;  3OAP A;  2IHQ A;  2OVH A;  3FEI A;  2VST A;  4MG8 A;  1BSX A;  5IXK A;  1M2Z A;  3W0G A;  2Q60 A;  2AYR A;  4QE8 A;  2QTU A;  4J5W C;  1EXA A;  5HJP A;  3IXP A;  5AAV B;  2O4R A;  4N1Y A;  4WHG A;  2VV0 A;  5KD9 A;  2J14 A;  3P89 A;  4WHF A;  2Q7L A;  1FCY A;  2W8Y A;  4PRG A;  3SP9 A;  3W0C A;  3ADX A;  3EYB A;  1YY4 A;  3RVF A;  2PIQ A;  5DWI A;  3CDS A;  4A4V A;  2NPA A;  4DOS A;  4QE6 A;  4N5G A;  3ET0 A;  2ZLA A;  3L1B A;  3VSP A;  3ZQT A;  2GPV A;  1N83 A;  3HO0 A;  1XP9 A;  4FHH A;  2GPO A;  2ACL B;  1T7F A;  2OCF A;  5DWL A;  2QA6 A;  2AO6 A;  1HG4 A;  4E4K A;  3KDT A;  2GL8 A;  3V3E A;  1OSH A;  3A2H A;  3IMY A;  3OLL A;  4RMD A;  1GWR A;  1YOW A;  2I4J A;  3OS9 A;  5AYG A;  3GD2 A;  5I4V A;  1FCZ A;  5G45 A;  1SR7 A;  4G20 A;  1ZKY A;  2Q6J A;  4Q13 A;  5E14 A;  4M8E A;  3A2I A;  5FQS A;  2ZL9 A;  2P7A A;  2QA8 B;  2QXS A;  4JYI A;  3VTD A;  4J5X C;  3G8I A;  3O1D A;  3OS8 C;  4OZR U;  4LBD A;  4NIE A;  1YIM A;  3VRT A;  3AZ2 A;  3CS4 A;  3OLS A;  1XV9 A;  1T65 A;  4G1D A;  4IWC A;  4P6W A;  4MGA B;  4XTA A;  3UUA B;  3RUT A;  5C4U A;  2H79 A;  2Q1H A;  5DXQ A;  1SJ0 A;  4QM0 A;  5DX3 A;  2GIU A;  5KCD A;  1QKT A;  5DKG A;  2ABI A;  3E7C A;  5C4O A;  3RLJ A;  4IU7 A;  4MG7 A;  5KCT A;  5DYB A;  3GN8 A;  3SP6 A;  3VHW A;  1S0X A;  2PIX A;  2ZAS A;  1Y0X X;  2QW4 A;  3LBD A;  4OJB A;  5E7V A;  2XKW A;  3B65 A;  5HJS A;  5DYD A;  1I7G A;  3GBK A;  1FM9 A;  3VT9 A;  4DK8 A;  4ZNV A;  2QMV A;  4S0S A;  4REF A;  4XHD A;  3SZ1 A;  4G2I A;  2OVM A;  4HLW A;  3OS8 A;  4M8H A;  2YLQ A;  5ACC A;  2PIP L;  3ADW A;  1XVP B;  1T73 A;  5DUE A;  4F9M A;  1XDK B;  3R8A A;  2B1V A;  4JYH A;  2YJD A;  3B0W A;  4K4J A;  3H52 A;  2P15 A;  2VV4 B;  3AN4 A;  1S9Q A;  3NSQ A;  3TY0 A;  2AWH A;  1NYX A;  1R1K A;  2HVC A;  4NB6 A;  1R1K D;  1T7T A;  5DV6 A;  1NAX A;  3FAL B;  4EM9 A;  4DM6 A;  2ACL A;  3CWD A;  4OZT U;  5EGV A;  2PRG A;  4ZO1 B;  3UUC A;  3DT3 A;  3K22 A;  4MG8 B;  4RAK A;  5HYR A;  5DXB A;  1Z5X E;  3B0R A;  1G50 A;  4RWV A;  4PLD A;  5K13 A;  5DZ3 A;  5HJP B;  2YLP A;  4PXM A;  3UUD B;  2JFA A;  5GID A;  1RK3 A;  2ZLC A;  1PRG A;  4Q50 A;  4APU A;  2VSR A;  4MG9 A;  1FD0 A;  3BC5 A;  3ZRB A;  1GS4 A;  2ZK1 A;  1R20 A;  1UHL A;  1R20 D;  2OZ7 A;  1XB7 A;  3B0Q A;  5FQP A;  3KPZ A;  2YFE A;  3NSP A;  3ET3 A;  4ZNT A;  5DZH A;  3WJ5 A;  1K7L A;  4XUM A;  3E00 A;  2ZVT A;  5DIG A;  4CI5 A;  2B23 A;  3K8S A;  3P8X A;  1XQC A;  3ET1 A;  1ZAF A;  1QKN A;  1ILH A;  4KZM A;  4OIL A;  4ZN9 A;  4ZNS A;  5EIT A;  4G21 A;  2J7X A;  3R8I A;  1Z95 A;  4OLM A;  4OED A;  1YP0 A;  1PQ6 A;  4DQM A;  4OEA A;  3VT6 A;  2V0V A;  2AMB A;  5DI7 A;  3V4A A;  4HEE X;  3VJS A;  2Q5P A;  4J24 A;  2QGT A;  3IA6 A;  4PWL A;  5KCE A;  5FQT A;  3D57 A;  4B7W A;  1XLS A;  3WWR A;  2P1V A;  3DY6 A;  1N46 A;  4JAZ A;  1EXX A;  2PKL A;  3NOA A;  3R2A A;  4PPP A;  4TUZ A;  5ICK A;  4UDA A;  1XV9 B;  1T63 A;  1XDK A;  1X7J A;  1RJK A;  1NDE A;  3L03 A;  3UU7 A;  2B50 A;  3VRV A;  3DZU A;  3KYT A;  2AA2 A;  5DX3 B;  3OMO A;  1OVL A;  2ZXN A;  1YIN A;  3AZ3 A;  3CQV A;  4G2H A;  4MGD A;  4MG7 B;  3VTB A;  1PK5 A;  5AZT A;  1NAV A;  5H1E A;  3H0A D;  3O1E A;  2P4Y A;  2FAI A;  1ZH7 A;  3W5P A;  3U9Q A;  1XOW A;  3IPU A;  3VT4 A;  5EI1 A;  2PJL A;  4OFU A;  3X31 A;  4RZF A;  4ZOM A;  4NY9 A;  1XNN A;  5KR9 A;  3IXP D;  2Q7J A;  3UUD A;  4R06 A;  2AX9 A;  3OMQ A;  2IOG A;  3OSW A;  4RFW A;  4FHI A;  5B41 A;  4ONI A;  2GTK A;  3KDU A;  4IVW A;  4MGC A;  4OK1 A;  1ZGY A;  2QAB A;  5CJ6 A;  1S19 A;  3CS8 A;  2OAX A;  3HVL A;  4TV1 B;  3VHU A;  5KCU A;  5C4S A;  4IS8 A;  3GYU A;  4QJR A;  3WT7 A;  5DWJ A;  3OLF A;  3W5R A;  4ZJW A;  3KFC A;  4BCR A;  2HWQ A;  4Q0A C;  2PIN A;  4ZI1 A;  1Z5X U;  2HCD A;  2QR9 A;  3OKI A;  3WMH A;  2ZMH A;  3M7R A;  4WQP A;  4QK4 A;  5E15 A;  3DCU A;  5DXB B;  3KMG A;  3L3Z A;  5DVV A;  4J5W A;  4KZI A;  5GT4 A;  1K74 A;  1XNX A;  2Q5S A;  1K74 D;  4IUI A;  2YJA B;  1ERR A;  1T74 A;  4X1G A;  2JFA B;  3W0A A;  2AA5 A;  1QKM A;  3TKC A;  4MG9 B;  3KWY A;  2AX8 A;  2OM9 A;  3D24 A;  1UHL B;  2XHS A;  2R6W A;  1A28 A;  3OZJ A;  3VRU A;  5HZC A;  5JY3 A;  3UP0 A; 
#chains in the Genus database with same CATH topology
 4MG5 A;  1WM0 X;  4CSJ A;  4L98 A;  4PF3 A;  4ZNU A;  3OSI A;  4PLE A;  3FXV A;  2REW A;  3R29 A;  5IAW A;  1YMT A;  1I7I A;  5E1C A;  1XLS E;  5AZV A;  3AN3 A;  2R6Y A;  2H77 A;  5DV3 A;  2G5O A;  5DVC A;  2E2R A;  3CS6 A;  3R5N A;  4RUP A;  2YLO A;  5AVL A;  3V9T A;  4A2J A;  4A4W A;  4RMC A;  3W0J A;  4E4Q A;  5LWP A;  2J7Y A;  1FCX A;  2ZFX A;  1ZEO A;  3GYT A;  3PO9 A;  2XYX A;  4FNE A;  4OKB A;  1OT7 A;  4RME A;  1FM9 D;  2Q6S A;  3V9Y A;  5KRL A;  3L0E A;  2R40 A;  2R40 D;  3GWX A;  4J5X A;  5DUG A;  5M96 A;  4ZJR A;  2Z4B A;  2Q6R A;  4ZNH A;  3AX8 A;  4OFR A;  3V49 A;  5DWE A;  1M7W A;  3X36 A;  4TUZ B;  4IA2 A;  4OKW A;  4FGY A;  1U3S A;  2BJ4 A;  3L0J A;  1M13 A;  3AUQ A;  4PPS A;  4S15 A;  4TV1 A;  3B68 A;  3UU7 B;  2FVJ A;  3AUR A;  3FLI A;  2PIO A;  5HCV A;  4ZNW A;  1OVL B;  3FUG A;  2QNV A;  3HZF A;  2QGW A;  4MGD B;  3W0H A;  4POH A;  3HM1 A;  2I0G A;  4QL8 A;  1QKU A;  5KYJ A;  3RUU A;  3VJH A;  4JYG A;  3K23 A;  2NW4 A;  4YPQ A;  5EHJ A;  2Q59 B;  2HBH A;  1RDT A;  2EWP A;  1A52 A;  1RDT D;  3HC6 A;  3L0L A;  1T7M A;  3B0T A;  1PZL A;  5APK A;  5FQR A;  4R2U A;  1T5Z A;  1U9E A;  4IA1 A;  3WT6 A;  1L2I A;  2Z4J A;  4IWF A;  5JI0 D;  4JL4 A;  5DSH A;  3A78 A;  4UDB A;  2POG A;  5E0X A;  5KRJ A;  1ZDT A;  2P7G A;  5DU5 A;  1GWQ A;  3Q95 A;  2AX7 A;  1PQC A;  1I37 A;  2QXM A;  3ADV A;  3L3X A;  4UDC A;  2G0G A;  4RZG A;  4XI3 A;  5DKE A;  3QT0 A;  4XT9 A;  3E00 D;  3OGT A;  5KRC A;  2HB7 A;  1KNU A;  2ZK0 A;  3FUR A;  3B3K A;  1LBD A;  2ZNP A;  1YJE A;  3ET2 A;  1KKQ A;  1TFC A;  3OKH A;  4OIU A;  4PP6 A;  3DCT A;  2ZK3 A;  4CI4 A;  1T76 A;  2QZO A;  4K7A A;  4OJ4 A;  5DXE A;  5G3J A;  3ERD A;  3ILZ A;  1XZX X;  1YUC A;  5DMC A;  5G44 A;  4O8F A;  5KRM A;  3FEJ A;  5DXK A;  3TKM A;  3X1H A;  2NV7 A;  3WFG A;  5G43 A;  2YLY A;  3PEQ A;  3WT5 A;  1X7R A;  2VV2 A;  5AVI A;  5G5W A;  3DZY A;  3DZY D;  1IE9 A;  5DMF A;  3DZU D;  5G42 A;  2HFP A;  5KRI A;  3VHV A;  1NQ0 A;  2VV1 A;  3D5F A;  1YOK A;  2HB8 A;  1XPC A;  4N8R A;  2NXX A;  2G44 A;  4XUH A;  2AA7 A;  3VRW A;  1RKG A;  2Q61 A;  1S0Z A;  3ZR7 A;  1XP1 A;  4OKX A;  5DXR A;  4ZN7 A;  3PRG A;  2XYW A;  2Q3Y A;  3DR1 A;  3K6P A;  2Q59 A;  2P1T A;  4OC7 A;  1T7R A;  5KYA A;  3A9E A;  1T79 A;  4JGV A;  1XJ7 A;  3OSA A;  4OAR A;  4PP5 A;  1LV2 A;  3X1I A;  2P1U A;  3WGP A;  1DKF A;  2ZKC A;  3B1M A;  1KV6 A;  2ZXZ A;  5DVS A;  3ADU A;  1L2J A;  2HAS A;  2PIV A;  5DP0 A;  3HOD A;  2BJ4 B;  3A2J A;  3AUN A;  1SQN A;  5DXG A;  2JF9 A;  4ITF A;  4XLD A;  3VT5 A;  3R5M A;  3W5T A;  5JJM A;  1E3G A;  2IOK A;  3A40 X;  2ZNN A;  1YA3 A;  3PLZ A;  3RY9 A;  4EMA A;  4IA3 A;  3AFR A;  2QE4 A;  4LSJ A;  4RZE A;  3W0I A;  5L7G A;  4NUF A;  4OHA A;  1R6G A;  3WTQ A;  1UPW A;  2P7Z A;  3OMP A;  4OEY A;  2PIT A;  3HC5 A;  3OOF A;  3FS1 A;  2ZK4 A;  4P6X A;  4OZT E;  2I4Z A;  3VN2 A;  3OOK A;  4ITE A;  3BQD A;  3MNO A;  3UP3 A;  3WJ4 A;  2JJ3 A;  4R6S A;  2ZXM A;  4X1F A;  3W5Q A;  1MVC A;  2Q1V A;  2FSZ A;  3G8O A;  2POB A;  2P54 A;  4POJ A;  2QPY A;  1NHZ A;  1R5K A;  1Q4X A;  3F5C B;  5E19 A;  5APJ A;  2V7C A;  4PP3 A;  3Q95 B;  3KBA A;  3VT7 A;  2B1Z A;  3IPS A;  5IZ0 A;  1X76 A;  5LGA A;  4OGH A;  3TX7 B;  2HWR A;  1K4W A;  3CTB A;  3FC6 A;  3HLV A;  4YNK A;  1Y9R A;  5E0W A;  2ZMJ A;  3G0W A;  4OH6 A;  4K6I A;  1XIU A;  3V9V A;  4RUO X;  4RE8 A;  4DMA A;  4LNW A;  1NRL A;  5F9B A;  5KRO A;  5KRH A;  2AA6 A;  2QZO B;  5KRK A;  3CLD A;  1NQ7 A;  2Q5G A;  5DL4 A;  5L7E A;  1ILG A;  4OH5 A;  4MG6 A;  1MV9 A;  1VJB A;  2AXA A;  2NXX E;  3GWS X;  3VJT A;  1MZN A;  1RKH A;  3LMP A;  3V3Q A;  1NQ1 A;  3JZB A;  5EJV A;  4IV4 A;  3CJW A;  1PDU A;  5FQV A;  5KCF A;  1S9P A;  3OZ0 A;  2LBD A;  4L96 A;  3WFF A;  2YHD A;  4IW8 A;  4IVY A;  2AMA A;  1HJ1 A;  3VI8 A;  2A3I A;  5AAU A;  3B67 A;  2HC4 A;  4ZO1 X;  5SYZ A;  2ATH A;  2Q70 A;  3ADT A;  2AAX A;  3ERT A;  3KMZ A;  2VV1 B;  3OMM A;  3PCU A;  5DLR A;  3W0Y A;  1SKX A;  3E94 A;  1U3R A;  1G2N A;  3MNP A;  1X7B A;  3PBA A;  2PIW A;  4PVU A;  3B66 A;  4YT1 A;  2AX6 A;  2OUZ A;  4G1Y A;  2AM9 A;  2PNU A;  3G9E A;  3A9E B;  5DKB A;  5AAV A;  3CDP A;  2GP7 A;  2VV3 A;  3OMK A;  1X7E A;  1ZDU A;  1GWX A;  5DWG A;  1DKF B;  4MGB B;  3T03 A;  3BEJ A;  5KRA A;  3UVV B;  2QSE A;  2ZK5 A;  3D6D A;  3F5C A;  5DKS A;  4IQR A;  4KZJ A;  1DB1 A;  3ADS A;  5AWK A;  5JJM B;  4S14 A;  2HAR A;  4WPF A;  4NQA B;  3S9S A;  2Q7I A;  3MNE A;  2Q7K A;  2G0H A;  5GIE A;  4S0T A;  5ETH A;  1FBY A;  3VTC A;  1NQ2 A;  3GZ9 A;  4DM8 A;  3VJI A;  5KCC A;  1OSV A;  1XP6 A;  3RLL A;  1G1U A;  1X78 A;  3P0U A;  5GIC A;  1P93 A;  1UPV A;  2AB2 A;  1I38 A;  5C4T A;  4DK7 A;  1ERE A;  2I0J A;  2QA8 A;  4IA7 A;  5AK2 A;  5DID A;  3A3Z X;  4OKT A;  4J26 A;  4LNX A;  2O4J A;  4WVD A;  4FN9 A;  4OIV A;  2ZBS A;  3IPQ A;  2PIU A;  4E2J A;  2QH6 A;  2GPP A;  4N73 A;  2XYJ A;  4RUJ A;  5A86 A;  2GPU A;  4MGA A;  3UUA A;  1E3K A;  1IE8 A;  2ZK2 A;  4OZR E;  2ZMI A;  2ZNO A;  5DZ0 A;  4DOR A;  2O9I A;  3N00 A;  4OJ9 A;  4IW6 A;  5DUH A;  4UDD A;  5DY8 A;  3ZRA A;  1Y0S A;  1TXI A;  4IV2 A;  3FC6 B;  1YYE A;  1PCG A;  3AZ1 A;  1N4H A;  2Q8S A;  1ZUC A;  4G1Z A;  1NUO A;  2GWX A;  4WLB A;  5G46 A;  5B5B A;  5DZI A;  5HYK A;  5APH A;  3D90 A;  2YAT A;  4LTW A;  2BAW A;  2ZK6 A;  2J4A A;  3B5R A;  2PIR A;  3HQ5 A;  5DIE A;  5L7H A;  2F4B A;  2ZNQ A;  3VT3 A;  5DK9 A;  2ZY0 A;  5L11 A;  5DXP A;  2HAM A;  5DRM A;  1XVP A;  4REE A;  3JZC A;  3VSO A;  4MGB A;  5DXM A;  1XQ3 A;  1G5Y A;  5AWJ A;  3UVV A;  4MDD A;  1PQ9 A;  2I4P A;  5DZ1 A;  4YMQ A;  2VV4 A;  5KCW A;  1P8D A;  5DRJ A;  1H9U A;  4OEZ A;  5KRF A;  3KMR A;  1FM6 A;  1UOM A;  3F7D A;  1FM6 D;  1U3Q A;  3FAL A;  3P88 A;  4XAO A;  3R8D A;  3VT8 A;  5DTV A;  5EC9 A;  4Y29 A;  5DV8 A;  3H0A A;  1XAP A;  3OAP A;  2IHQ A;  2OVH A;  3FEI A;  2VST A;  4MG8 A;  1BSX A;  5IXK A;  1M2Z A;  3W0G A;  2Q60 A;  2AYR A;  4QE8 A;  2QTU A;  4J5W C;  1EXA A;  5HJP A;  3IXP A;  5AAV B;  2O4R A;  4N1Y A;  4WHG A;  2VV0 A;  5KD9 A;  2J14 A;  3P89 A;  4WHF A;  2Q7L A;  1FCY A;  2W8Y A;  4PRG A;  3SP9 A;  3W0C A;  3ADX A;  3EYB A;  1YY4 A;  3RVF A;  2PIQ A;  5DWI A;  3CDS A;  4A4V A;  2NPA A;  4DOS A;  4QE6 A;  4N5G A;  3ET0 A;  2ZLA A;  3L1B A;  3VSP A;  3ZQT A;  2GPV A;  1N83 A;  3HO0 A;  1XP9 A;  4FHH A;  2GPO A;  2ACL B;  1T7F A;  2OCF A;  5DWL A;  2QA6 A;  2AO6 A;  1HG4 A;  4E4K A;  3KDT A;  2GL8 A;  3V3E A;  1OSH A;  3A2H A;  3IMY A;  3OLL A;  4RMD A;  1GWR A;  1YOW A;  2I4J A;  3OS9 A;  5AYG A;  3GD2 A;  5I4V A;  1FCZ A;  5G45 A;  1SR7 A;  4G20 A;  1ZKY A;  2Q6J A;  4Q13 A;  5E14 A;  4M8E A;  3A2I A;  5FQS A;  2ZL9 A;  2P7A A;  2QA8 B;  2QXS A;  4JYI A;  3VTD A;  4J5X C;  3G8I A;  3O1D A;  3OS8 C;  4OZR U;  4LBD A;  4NIE A;  1YIM A;  3VRT A;  3AZ2 A;  3CS4 A;  3OLS A;  1XV9 A;  1T65 A;  4G1D A;  4IWC A;  4P6W A;  4MGA B;  4XTA A;  3UUA B;  3RUT A;  5C4U A;  2H79 A;  2Q1H A;  5DXQ A;  1SJ0 A;  4QM0 A;  5DX3 A;  2GIU A;  5KCD A;  1QKT A;  5DKG A;  2ABI A;  3E7C A;  5C4O A;  3RLJ A;  4IU7 A;  4MG7 A;  5KCT A;  5DYB A;  3GN8 A;  3SP6 A;  3VHW A;  1S0X A;  2PIX A;  2ZAS A;  1Y0X X;  2QW4 A;  3LBD A;  4OJB A;  5E7V A;  2XKW A;  3B65 A;  5HJS A;  5DYD A;  1I7G A;  3GBK A;  1FM9 A;  3VT9 A;  4DK8 A;  4ZNV A;  2QMV A;  4S0S A;  4REF A;  4XHD A;  3SZ1 A;  4G2I A;  2OVM A;  4HLW A;  3OS8 A;  4M8H A;  2YLQ A;  5ACC A;  2PIP L;  3ADW A;  1XVP B;  1T73 A;  5DUE A;  4F9M A;  1XDK B;  3R8A A;  2B1V A;  4JYH A;  2YJD A;  3B0W A;  4K4J A;  3H52 A;  2P15 A;  2VV4 B;  3AN4 A;  1S9Q A;  3NSQ A;  3TY0 A;  2AWH A;  1NYX A;  1R1K A;  2HVC A;  4NB6 A;  1R1K D;  1T7T A;  5DV6 A;  1NAX A;  3FAL B;  4EM9 A;  4DM6 A;  2ACL A;  3CWD A;  4OZT U;  5EGV A;  2PRG A;  4ZO1 B;  3UUC A;  3DT3 A;  3K22 A;  4MG8 B;  4RAK A;  5HYR A;  5DXB A;  1Z5X E;  3B0R A;  1G50 A;  4RWV A;  4PLD A;  5K13 A;  5DZ3 A;  5HJP B;  2YLP A;  4PXM A;  3UUD B;  2JFA A;  5GID A;  1RK3 A;  2ZLC A;  1PRG A;  4Q50 A;  4APU A;  2VSR A;  4MG9 A;  1FD0 A;  3BC5 A;  3ZRB A;  1GS4 A;  2ZK1 A;  1R20 A;  1UHL A;  1R20 D;  2OZ7 A;  1XB7 A;  3B0Q A;  5FQP A;  3KPZ A;  2YFE A;  3NSP A;  3ET3 A;  4ZNT A;  5DZH A;  3WJ5 A;  1K7L A;  4XUM A;  3E00 A;  2ZVT A;  5DIG A;  4CI5 A;  2B23 A;  3K8S A;  3P8X A;  1XQC A;  3ET1 A;  1ZAF A;  1QKN A;  1ILH A;  4KZM A;  4OIL A;  4ZN9 A;  4ZNS A;  5EIT A;  4G21 A;  2J7X A;  3R8I A;  1Z95 A;  4OLM A;  4OED A;  1YP0 A;  1PQ6 A;  4DQM A;  4OEA A;  3VT6 A;  2V0V A;  2AMB A;  5DI7 A;  3V4A A;  4HEE X;  3VJS A;  2Q5P A;  4J24 A;  2QGT A;  3IA6 A;  4PWL A;  5KCE A;  5FQT A;  3D57 A;  4B7W A;  1XLS A;  3WWR A;  2P1V A;  3DY6 A;  1N46 A;  4JAZ A;  1EXX A;  2PKL A;  3NOA A;  3R2A A;  4PPP A;  4TUZ A;  5ICK A;  4UDA A;  1XV9 B;  1T63 A;  1XDK A;  1X7J A;  1RJK A;  1NDE A;  3L03 A;  3UU7 A;  2B50 A;  3VRV A;  3DZU A;  3KYT A;  2AA2 A;  5DX3 B;  3OMO A;  1OVL A;  2ZXN A;  1YIN A;  3AZ3 A;  3CQV A;  4G2H A;  4MGD A;  4MG7 B;  3VTB A;  1PK5 A;  5AZT A;  1NAV A;  5H1E A;  3H0A D;  3O1E A;  2P4Y A;  2FAI A;  1ZH7 A;  3W5P A;  3U9Q A;  1XOW A;  3IPU A;  3VT4 A;  5EI1 A;  2PJL A;  4OFU A;  3X31 A;  4RZF A;  4ZOM A;  4NY9 A;  1XNN A;  5KR9 A;  3IXP D;  2Q7J A;  3UUD A;  4R06 A;  2AX9 A;  3OMQ A;  2IOG A;  3OSW A;  4RFW A;  4FHI A;  5B41 A;  4ONI A;  2GTK A;  3KDU A;  4IVW A;  4MGC A;  4OK1 A;  1ZGY A;  2QAB A;  5CJ6 A;  1S19 A;  3CS8 A;  2OAX A;  3HVL A;  4TV1 B;  3VHU A;  5KCU A;  5C4S A;  4IS8 A;  3GYU A;  4QJR A;  3WT7 A;  5DWJ A;  3OLF A;  3W5R A;  4ZJW A;  3KFC A;  4BCR A;  2HWQ A;  4Q0A C;  2PIN A;  4ZI1 A;  1Z5X U;  2HCD A;  2QR9 A;  3OKI A;  3WMH A;  2ZMH A;  3M7R A;  4WQP A;  4QK4 A;  5E15 A;  3DCU A;  5DXB B;  3KMG A;  3L3Z A;  5DVV A;  4J5W A;  4KZI A;  5GT4 A;  1K74 A;  1XNX A;  2Q5S A;  1K74 D;  4IUI A;  2YJA B;  1ERR A;  1T74 A;  4X1G A;  2JFA B;  3W0A A;  2AA5 A;  1QKM A;  3TKC A;  4MG9 B;  3KWY A;  2AX8 A;  2OM9 A;  3D24 A;  1UHL B;  2XHS A;  2R6W A;  1A28 A;  3OZJ A;  3VRU A;  5HZC A;  5JY3 A;  3UP0 A; 
#chains in the Genus database with same CATH homology
 4MG5 A;  1WM0 X;  4CSJ A;  4L98 A;  4PF3 A;  4ZNU A;  3OSI A;  4PLE A;  3FXV A;  2REW A;  3R29 A;  5IAW A;  1YMT A;  1I7I A;  5E1C A;  1XLS E;  5AZV A;  3AN3 A;  2R6Y A;  2H77 A;  5DV3 A;  2G5O A;  5DVC A;  2E2R A;  3CS6 A;  3R5N A;  4RUP A;  2YLO A;  5AVL A;  3V9T A;  4A2J A;  4A4W A;  4RMC A;  3W0J A;  4E4Q A;  5LWP A;  2J7Y A;  1FCX A;  2ZFX A;  1ZEO A;  3GYT A;  3PO9 A;  2XYX A;  4FNE A;  4OKB A;  1OT7 A;  4RME A;  1FM9 D;  2Q6S A;  3V9Y A;  5KRL A;  3L0E A;  2R40 A;  2R40 D;  3GWX A;  4J5X A;  5DUG A;  5M96 A;  4ZJR A;  2Z4B A;  2Q6R A;  4ZNH A;  3AX8 A;  4OFR A;  3V49 A;  5DWE A;  1M7W A;  3X36 A;  4TUZ B;  4IA2 A;  4OKW A;  4FGY A;  1U3S A;  2BJ4 A;  3L0J A;  1M13 A;  3AUQ A;  4PPS A;  4S15 A;  4TV1 A;  3B68 A;  3UU7 B;  2FVJ A;  3AUR A;  3FLI A;  2PIO A;  5HCV A;  4ZNW A;  1OVL B;  3FUG A;  2QNV A;  3HZF A;  2QGW A;  4MGD B;  3W0H A;  4POH A;  3HM1 A;  2I0G A;  4QL8 A;  1QKU A;  5KYJ A;  3RUU A;  3VJH A;  4JYG A;  3K23 A;  2NW4 A;  4YPQ A;  5EHJ A;  2Q59 B;  2HBH A;  1RDT A;  2EWP A;  1A52 A;  1RDT D;  3HC6 A;  3L0L A;  1T7M A;  3B0T A;  1PZL A;  5APK A;  5FQR A;  4R2U A;  1T5Z A;  1U9E A;  4IA1 A;  3WT6 A;  1L2I A;  2Z4J A;  4IWF A;  5JI0 D;  4JL4 A;  5DSH A;  3A78 A;  4UDB A;  2POG A;  5E0X A;  5KRJ A;  1ZDT A;  2P7G A;  5DU5 A;  1GWQ A;  3Q95 A;  2AX7 A;  1PQC A;  1I37 A;  2QXM A;  3ADV A;  3L3X A;  4UDC A;  2G0G A;  4RZG A;  4XI3 A;  5DKE A;  3QT0 A;  4XT9 A;  3E00 D;  3OGT A;  5KRC A;  2HB7 A;  1KNU A;  2ZK0 A;  3FUR A;  3B3K A;  1LBD A;  2ZNP A;  1YJE A;  3ET2 A;  1KKQ A;  1TFC A;  3OKH A;  4OIU A;  4PP6 A;  3DCT A;  2ZK3 A;  4CI4 A;  1T76 A;  2QZO A;  4K7A A;  4OJ4 A;  5DXE A;  5G3J A;  3ERD A;  3ILZ A;  1XZX X;  1YUC A;  5DMC A;  5G44 A;  4O8F A;  5KRM A;  3FEJ A;  5DXK A;  3TKM A;  3X1H A;  2NV7 A;  3WFG A;  5G43 A;  2YLY A;  3PEQ A;  3WT5 A;  1X7R A;  2VV2 A;  5AVI A;  5G5W A;  3DZY A;  3DZY D;  1IE9 A;  5DMF A;  3DZU D;  5G42 A;  2HFP A;  5KRI A;  3VHV A;  1NQ0 A;  2VV1 A;  3D5F A;  1YOK A;  2HB8 A;  1XPC A;  4N8R A;  2NXX A;  2G44 A;  4XUH A;  2AA7 A;  3VRW A;  1RKG A;  2Q61 A;  1S0Z A;  3ZR7 A;  1XP1 A;  4OKX A;  5DXR A;  4ZN7 A;  3PRG A;  2XYW A;  2Q3Y A;  3DR1 A;  3K6P A;  2Q59 A;  2P1T A;  4OC7 A;  1T7R A;  5KYA A;  3A9E A;  1T79 A;  4JGV A;  1XJ7 A;  3OSA A;  4OAR A;  4PP5 A;  1LV2 A;  3X1I A;  2P1U A;  3WGP A;  1DKF A;  2ZKC A;  3B1M A;  1KV6 A;  2ZXZ A;  5DVS A;  3ADU A;  1L2J A;  2HAS A;  2PIV A;  5DP0 A;  3HOD A;  2BJ4 B;  3A2J A;  3AUN A;  1SQN A;  5DXG A;  2JF9 A;  4ITF A;  4XLD A;  3VT5 A;  3R5M A;  3W5T A;  5JJM A;  1E3G A;  2IOK A;  3A40 X;  2ZNN A;  1YA3 A;  3PLZ A;  3RY9 A;  4EMA A;  4IA3 A;  3AFR A;  2QE4 A;  4LSJ A;  4RZE A;  3W0I A;  5L7G A;  4NUF A;  4OHA A;  1R6G A;  3WTQ A;  1UPW A;  2P7Z A;  3OMP A;  4OEY A;  2PIT A;  3HC5 A;  3OOF A;  3FS1 A;  2ZK4 A;  4P6X A;  4OZT E;  2I4Z A;  3VN2 A;  3OOK A;  4ITE A;  3BQD A;  3MNO A;  3UP3 A;  3WJ4 A;  2JJ3 A;  4R6S A;  2ZXM A;  4X1F A;  3W5Q A;  1MVC A;  2Q1V A;  2FSZ A;  3G8O A;  2POB A;  2P54 A;  4POJ A;  2QPY A;  1NHZ A;  1R5K A;  1Q4X A;  3F5C B;  5E19 A;  5APJ A;  2V7C A;  4PP3 A;  3Q95 B;  3KBA A;  3VT7 A;  2B1Z A;  3IPS A;  5IZ0 A;  1X76 A;  5LGA A;  4OGH A;  3TX7 B;  2HWR A;  1K4W A;  3CTB A;  3FC6 A;  3HLV A;  4YNK A;  1Y9R A;  5E0W A;  2ZMJ A;  3G0W A;  4OH6 A;  4K6I A;  1XIU A;  3V9V A;  4RUO X;  4RE8 A;  4DMA A;  4LNW A;  1NRL A;  5F9B A;  5KRO A;  5KRH A;  2AA6 A;  2QZO B;  5KRK A;  3CLD A;  1NQ7 A;  2Q5G A;  5DL4 A;  5L7E A;  1ILG A;  4OH5 A;  4MG6 A;  1MV9 A;  1VJB A;  2AXA A;  2NXX E;  3GWS X;  3VJT A;  1MZN A;  1RKH A;  3LMP A;  3V3Q A;  1NQ1 A;  3JZB A;  5EJV A;  4IV4 A;  3CJW A;  1PDU A;  5FQV A;  5KCF A;  1S9P A;  3OZ0 A;  2LBD A;  4L96 A;  3WFF A;  2YHD A;  4IW8 A;  4IVY A;  2AMA A;  1HJ1 A;  3VI8 A;  2A3I A;  5AAU A;  3B67 A;  2HC4 A;  4ZO1 X;  5SYZ A;  2ATH A;  2Q70 A;  3ADT A;  2AAX A;  3ERT A;  3KMZ A;  2VV1 B;  3OMM A;  3PCU A;  5DLR A;  3W0Y A;  1SKX A;  3E94 A;  1U3R A;  1G2N A;  3MNP A;  1X7B A;  3PBA A;  2PIW A;  4PVU A;  3B66 A;  4YT1 A;  2AX6 A;  2OUZ A;  4G1Y A;  2AM9 A;  2PNU A;  3G9E A;  3A9E B;  5DKB A;  5AAV A;  3CDP A;  2GP7 A;  2VV3 A;  3OMK A;  1X7E A;  1ZDU A;  1GWX A;  5DWG A;  1DKF B;  4MGB B;  3T03 A;  3BEJ A;  5KRA A;  3UVV B;  2QSE A;  2ZK5 A;  3D6D A;  3F5C A;  5DKS A;  4IQR A;  4KZJ A;  1DB1 A;  3ADS A;  5AWK A;  5JJM B;  4S14 A;  2HAR A;  4WPF A;  4NQA B;  3S9S A;  2Q7I A;  3MNE A;  2Q7K A;  2G0H A;  5GIE A;  4S0T A;  5ETH A;  1FBY A;  3VTC A;  1NQ2 A;  3GZ9 A;  4DM8 A;  3VJI A;  5KCC A;  1OSV A;  1XP6 A;  3RLL A;  1G1U A;  1X78 A;  3P0U A;  5GIC A;  1P93 A;  1UPV A;  2AB2 A;  1I38 A;  5C4T A;  4DK7 A;  1ERE A;  2I0J A;  2QA8 A;  4IA7 A;  5AK2 A;  5DID A;  3A3Z X;  4OKT A;  4J26 A;  4LNX A;  2O4J A;  4WVD A;  4FN9 A;  4OIV A;  2ZBS A;  3IPQ A;  2PIU A;  4E2J A;  2QH6 A;  2GPP A;  4N73 A;  2XYJ A;  4RUJ A;  5A86 A;  2GPU A;  4MGA A;  3UUA A;  1E3K A;  1IE8 A;  2ZK2 A;  4OZR E;  2ZMI A;  2ZNO A;  5DZ0 A;  4DOR A;  2O9I A;  3N00 A;  4OJ9 A;  4IW6 A;  5DUH A;  4UDD A;  5DY8 A;  3ZRA A;  1Y0S A;  1TXI A;  4IV2 A;  3FC6 B;  1YYE A;  1PCG A;  3AZ1 A;  1N4H A;  2Q8S A;  1ZUC A;  4G1Z A;  1NUO A;  2GWX A;  4WLB A;  5G46 A;  5B5B A;  5DZI A;  5HYK A;  5APH A;  3D90 A;  2YAT A;  4LTW A;  2BAW A;  2ZK6 A;  2J4A A;  3B5R A;  2PIR A;  3HQ5 A;  5DIE A;  5L7H A;  2F4B A;  2ZNQ A;  3VT3 A;  5DK9 A;  2ZY0 A;  5L11 A;  5DXP A;  2HAM A;  5DRM A;  1XVP A;  4REE A;  3JZC A;  3VSO A;  4MGB A;  5DXM A;  1XQ3 A;  1G5Y A;  5AWJ A;  3UVV A;  4MDD A;  1PQ9 A;  2I4P A;  5DZ1 A;  4YMQ A;  2VV4 A;  5KCW A;  1P8D A;  5DRJ A;  1H9U A;  4OEZ A;  5KRF A;  3KMR A;  1FM6 A;  1UOM A;  3F7D A;  1FM6 D;  1U3Q A;  3FAL A;  3P88 A;  4XAO A;  3R8D A;  3VT8 A;  5DTV A;  5EC9 A;  4Y29 A;  5DV8 A;  3H0A A;  1XAP A;  3OAP A;  2IHQ A;  2OVH A;  3FEI A;  2VST A;  4MG8 A;  1BSX A;  5IXK A;  1M2Z A;  3W0G A;  2Q60 A;  2AYR A;  4QE8 A;  2QTU A;  4J5W C;  1EXA A;  5HJP A;  3IXP A;  5AAV B;  2O4R A;  4N1Y A;  4WHG A;  2VV0 A;  5KD9 A;  2J14 A;  3P89 A;  4WHF A;  2Q7L A;  1FCY A;  2W8Y A;  4PRG A;  3SP9 A;  3W0C A;  3ADX A;  3EYB A;  1YY4 A;  3RVF A;  2PIQ A;  5DWI A;  3CDS A;  4A4V A;  2NPA A;  4DOS A;  4QE6 A;  4N5G A;  3ET0 A;  2ZLA A;  3L1B A;  3VSP A;  3ZQT A;  2GPV A;  1N83 A;  3HO0 A;  1XP9 A;  4FHH A;  2GPO A;  2ACL B;  1T7F A;  2OCF A;  5DWL A;  2QA6 A;  2AO6 A;  1HG4 A;  4E4K A;  3KDT A;  2GL8 A;  3V3E A;  1OSH A;  3A2H A;  3IMY A;  3OLL A;  4RMD A;  1GWR A;  1YOW A;  2I4J A;  3OS9 A;  5AYG A;  3GD2 A;  5I4V A;  1FCZ A;  5G45 A;  1SR7 A;  4G20 A;  1ZKY A;  2Q6J A;  4Q13 A;  5E14 A;  4M8E A;  3A2I A;  5FQS A;  2ZL9 A;  2P7A A;  2QA8 B;  2QXS A;  4JYI A;  3VTD A;  4J5X C;  3G8I A;  3O1D A;  3OS8 C;  4OZR U;  4LBD A;  4NIE A;  1YIM A;  3VRT A;  3AZ2 A;  3CS4 A;  3OLS A;  1XV9 A;  1T65 A;  4G1D A;  4IWC A;  4P6W A;  4MGA B;  4XTA A;  3UUA B;  3RUT A;  5C4U A;  2H79 A;  2Q1H A;  5DXQ A;  1SJ0 A;  4QM0 A;  5DX3 A;  2GIU A;  5KCD A;  1QKT A;  5DKG A;  2ABI A;  3E7C A;  5C4O A;  3RLJ A;  4IU7 A;  4MG7 A;  5KCT A;  5DYB A;  3GN8 A;  3SP6 A;  3VHW A;  1S0X A;  2PIX A;  2ZAS A;  1Y0X X;  2QW4 A;  3LBD A;  4OJB A;  5E7V A;  2XKW A;  3B65 A;  5HJS A;  5DYD A;  1I7G A;  3GBK A;  1FM9 A;  3VT9 A;  4DK8 A;  4ZNV A;  2QMV A;  4S0S A;  4REF A;  4XHD A;  3SZ1 A;  4G2I A;  2OVM A;  4HLW A;  3OS8 A;  4M8H A;  2YLQ A;  5ACC A;  2PIP L;  3ADW A;  1XVP B;  1T73 A;  5DUE A;  4F9M A;  1XDK B;  3R8A A;  2B1V A;  4JYH A;  2YJD A;  3B0W A;  4K4J A;  3H52 A;  2P15 A;  2VV4 B;  3AN4 A;  1S9Q A;  3NSQ A;  3TY0 A;  2AWH A;  1NYX A;  1R1K A;  2HVC A;  4NB6 A;  1R1K D;  1T7T A;  5DV6 A;  1NAX A;  3FAL B;  4EM9 A;  4DM6 A;  2ACL A;  3CWD A;  4OZT U;  5EGV A;  2PRG A;  4ZO1 B;  3UUC A;  3DT3 A;  3K22 A;  4MG8 B;  4RAK A;  5HYR A;  5DXB A;  1Z5X E;  3B0R A;  1G50 A;  4RWV A;  4PLD A;  5K13 A;  5DZ3 A;  5HJP B;  2YLP A;  4PXM A;  3UUD B;  2JFA A;  5GID A;  1RK3 A;  2ZLC A;  1PRG A;  4Q50 A;  4APU A;  2VSR A;  4MG9 A;  1FD0 A;  3BC5 A;  3ZRB A;  1GS4 A;  2ZK1 A;  1R20 A;  1UHL A;  1R20 D;  2OZ7 A;  1XB7 A;  3B0Q A;  5FQP A;  3KPZ A;  2YFE A;  3NSP A;  3ET3 A;  4ZNT A;  5DZH A;  3WJ5 A;  1K7L A;  4XUM A;  3E00 A;  2ZVT A;  5DIG A;  4CI5 A;  2B23 A;  3K8S A;  3P8X A;  1XQC A;  3ET1 A;  1ZAF A;  1QKN A;  1ILH A;  4KZM A;  4OIL A;  4ZN9 A;  4ZNS A;  5EIT A;  4G21 A;  2J7X A;  3R8I A;  1Z95 A;  4OLM A;  4OED A;  1YP0 A;  1PQ6 A;  4DQM A;  4OEA A;  3VT6 A;  2V0V A;  2AMB A;  5DI7 A;  3V4A A;  4HEE X;  3VJS A;  2Q5P A;  4J24 A;  2QGT A;  3IA6 A;  4PWL A;  5KCE A;  5FQT A;  3D57 A;  4B7W A;  1XLS A;  3WWR A;  2P1V A;  3DY6 A;  1N46 A;  4JAZ A;  1EXX A;  2PKL A;  3NOA A;  3R2A A;  4PPP A;  4TUZ A;  5ICK A;  4UDA A;  1XV9 B;  1T63 A;  1XDK A;  1X7J A;  1RJK A;  1NDE A;  3L03 A;  3UU7 A;  2B50 A;  3VRV A;  3DZU A;  3KYT A;  2AA2 A;  5DX3 B;  3OMO A;  1OVL A;  2ZXN A;  1YIN A;  3AZ3 A;  3CQV A;  4G2H A;  4MGD A;  4MG7 B;  3VTB A;  1PK5 A;  5AZT A;  1NAV A;  5H1E A;  3H0A D;  3O1E A;  2P4Y A;  2FAI A;  1ZH7 A;  3W5P A;  3U9Q A;  1XOW A;  3IPU A;  3VT4 A;  5EI1 A;  2PJL A;  4OFU A;  3X31 A;  4RZF A;  4ZOM A;  4NY9 A;  1XNN A;  5KR9 A;  3IXP D;  2Q7J A;  3UUD A;  4R06 A;  2AX9 A;  3OMQ A;  2IOG A;  3OSW A;  4RFW A;  4FHI A;  5B41 A;  4ONI A;  2GTK A;  3KDU A;  4IVW A;  4MGC A;  4OK1 A;  1ZGY A;  2QAB A;  5CJ6 A;  1S19 A;  3CS8 A;  2OAX A;  3HVL A;  4TV1 B;  3VHU A;  5KCU A;  5C4S A;  4IS8 A;  3GYU A;  4QJR A;  3WT7 A;  5DWJ A;  3OLF A;  3W5R A;  4ZJW A;  3KFC A;  4BCR A;  2HWQ A;  4Q0A C;  2PIN A;  4ZI1 A;  1Z5X U;  2HCD A;  2QR9 A;  3OKI A;  3WMH A;  2ZMH A;  3M7R A;  4WQP A;  4QK4 A;  5E15 A;  3DCU A;  5DXB B;  3KMG A;  3L3Z A;  5DVV A;  4J5W A;  4KZI A;  5GT4 A;  1K74 A;  1XNX A;  2Q5S A;  1K74 D;  4IUI A;  2YJA B;  1ERR A;  1T74 A;  4X1G A;  2JFA B;  3W0A A;  2AA5 A;  1QKM A;  3TKC A;  4MG9 B;  3KWY A;  2AX8 A;  2OM9 A;  3D24 A;  1UHL B;  2XHS A;  2R6W A;  1A28 A;  3OZJ A;  3VRU A;  5HZC A;  5JY3 A;  3UP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...