3AZ3A

Crystal structure analysis of vitamin d receptor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
253
structure length
250
Chain Sequence
LRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel nonsecosteroidal vitamin D(3) carboxylic acid analogs for osteoporosis, and SAR analysis.
pubmed doi rcsb
molecule keywords Vitamin D3 receptor
molecule tags Hormone receptor
source organism Homo sapiens
total genus 101
structure length 250
sequence length 253
ec nomenclature
pdb deposition date 2011-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3az3A00
3OAPA 3OZJA 3G8IA 4G2HA 4DM6A 2ZK1A 5DZ3A 2ZNNA 1P93A 3OKHA 4FNEA 4JYGA 4OEYA 3KWYA 1XV9A 4G1DA 5DWLA 1T7MA 3B3KA 1NQ0A 3AN3A 3ADXA 2I0JA 2Z4BA 3X36A 5HYRA 5DMCA 3RVFA 3B5RA 3CWDA 5E1CA 2ZK0A 1NHZA 4PPSA 4YPQA 1RKGA 2ZNOA 1T79A 3W0CA 1T7FA 3IXPA 4RE8A 3VT8A 1Z5XU 1OVLA 4TUZA 3VT6A 4MG7B 4JYIA 3UP0A 2Q6JA 3TKCA 2AXAA 3V9VA 1GWRA 2I0GA 4JAZA 3VSOA 3B65A 2G5OA 3GD2A 3UUDB 3VJHA 4ZO1B 1LV2A 3DZUD 4UDCA 3A3ZX 4M8EA 3ADTA 4G2IA 3CS6A 5DXPA 3R8IA 3IPSA 4QJRA 4RMCA 2HFPA 2EWPA 1T76A 3IMYA 1QKUA 3VT5A 5AZTA 2Q7LA 1XP9A 2HVCA 3P8XA 2PIPL 3A9EB 3L0EA 3PEQA 3NSQA 4ZN7A 2V0VA 5IZ0A 4IU7A 3V9TA 1ZAFA 4APUA 2GWXA 5DXEA 3X1HA 1XP6A 4K7AA 2HB7A 3HODA 4DOSA 4E2JA 3SZ1A 1PQ9A 1R5KA 4IQRA 2VV4B 1KV6A 4N8RA 3SP9A 3AZ2A 1R1KA 4XUMA 5HJSA 3K6PA 3IXPD 2B50A 3KYTA 3VHVA 1XZXX 1I7GA 1M2ZA 4ZNVA 1P8DA 5DVSA 2YLPA 3W5QA 4OHAA 2IHQA 3HLVA 5DXMA 5LGAA 5L7GA 4LTWA 1NYXA 4OGHA 4K6IA 5DZIA 4OZTU 5L7HA 4OKXA 3GWXA 4G1YA 1TXIA 3TX7B 3JZCA 5KCWA 3OSIA 1NQ7A 5G42A 5AAVA 1NRLA 2VV0A 2ZK6A 3FXVA 5KR9A 3RUUA 3FALA 1T65A 1MZNA 2A3IA 2HWRA 4S0SA 1T7RA 2Q8SA 2ZNPA 3JZBA 2P7GA 1EXAA 2QABA 2QSEA 3FC6A 1RKHA 3DY6A 4RUJA 2QA6A 2ZL9A 4PXMA 4RAKA 1EREA 5C4OA 5KRLA 3A2JA 1GS4A 2HWQA 1L2JA 1FD0A 5GICA 1TFCA 2B23A 2ZBSA 4OJ9A 4RZEA 2OAXA 5GT4A 1N46A 3VTDA 3W0IA 4A4WA 1K74A 2HCDA 2VV1A 3W0YA 1T5ZA 4XUHA 2P1VA 4B7WA 1YMTA 2OUZA 4OARA 1M7WA 1ZGYA 2QXMA 3FEIA 5AWJA 3V4AA 1IE9A 2ZMJA 3OMQA 4R6SA 5HYKA 4WPFA 4S0TA 5KROA 2AX8A 1A28A 2XYJA 5E15A 2NPAA 2ZK3A 4JYHA 4E4KA 4J5WA 3ILZA 3B1MA 2REWA 1I7IA 1QKMA 4PRGA 1XDKB 4L98A 2AB2A 5DZHA 1IE8A 3DR1A 3MNEA 5HJPB 4YT1A 5DYBA 3P89A 3B0WA 3ET3A 1NAXA 3MNOA 2GPPA 4QL8A 4IA3A 5G5WA 4MGAA 3WT7A 1X76A 5DXRA 3R8AA 2ATHA 2BJ4A 2VSTA 3HO0A 2PIVA 3B68A 3WTQA 4J5XC 4RMEA 5E7VA 2HBHA 2YLOA 1LBDA 1UHLA 3TY0A 5DUEA 3VT4A 3PLZA 2I4PA 5KRAA 5DY8A 2Q7JA 1K74D 5DXBB 5IAWA 5A86A 1XVPA 2Q5PA 1H9UA 4ONIA 2ZXMA 4EMAA 2POGA 1E3GA 2Z4JA 5KYJA 1T63A 1U3QA 4G20A 4G1ZA 4S15A 5KRFA 4OFRA 3R29A 2ABIA 4NQAB 4ZN9A 3G0WA 3H52A 3FEJA 1U3RA 2H79A 2HASA 1ZEOA 4QE6A 1NDEA 4MG9B 3CS4A 3K22A 3RLLA 2GPUA 3WJ5A 2AX7A 4ZNUA 5DV6A 5F9BA 2OM9A 2JFAB 3GYTA 4BCRA 4XI3A 4OK1A 5G46A 5ACCA 3WFGA 2QA8A 3CDSA 2YJAB 3R5MA 2Q6SA 2ZXZA 3WWRA 3S9SA 4LSJA 3BEJA 3OSAA 2PIQA 5DIDA 2NW4A 3KMRA 1YOKA 4N73A 4YMQA 3X1IA 5L11A 2G44A 3EYBA 2Q3YA 2W8YA 2ZVTA 4PP3A 1Q4XA 2ZMIA 4PP5A 5KYAA 3VHWA 1ZDTA 3V3EA 3W0JA 2YLQA 5GIEA 3UUAA 3N00A 2QPYA 1SR7A 5KCFA 2PIWA 3E00A 3T03A 1YA3A 4OEDA 3KPZA 2Q5GA 3BQDA 3D24A 5JJMB 5DXQA 4DORA 1NAVA 4K4JA 3ZQTA 3WT5A 1YOWA 5B41A 5C4UA 3QT0A 4IW8A 3F7DA 3W0HA 3OOKA 3A40X 2XHSA 3KBAA 1PCGA 3D6DA 3L1BA 3UP3A 2I4ZA 2P1TA 4ZJWA 2GP7A 2YHDA 3OMPA 2AO6A 1ZDUA 5DRMA 4PLDA 1T7TA 2VV2A 1ERRA 3GZ9A 3HVLA 3OS8C 5APHA 5ETHA 2AM9A 5HCVA 4J5XA 4REFA 3K8SA 4MG7A 1MV9A 4IWCA 4OEZA 2OCFA 3DT3A 3FS1A 2R40A 2ZASA 4TV1B 4IA7A 1GWXA 2G0HA 2R6YA 4EM9A 4IA2A 1RDTA 5EITA 3A2HA 2PIOA 3UUDA 1ILHA 4MDDA 2QH6A 3AUNA 2YLYA 3E00D 3M7RA 4MGCA 5DYDA 5E19A 4ZJRA 3LMPA 5KRMA 4CI5A 2IOKA 1N83A 2FAIA 4MGBB 2Q7KA 1BSXA 2AAXA 3L0JA 4HEEX 4E4QA 1YINA 3VTCA 4M8HA 1S9QA 5DKEA 3B0QA 2AA5A 2Q61A 3ET1A 3R8DA 5KRCA 3A9EA 2J7XA 3AUQA 2ZNQA 1XP1A 4QE8A 3ET0A 2AX6A 1G1UA 5DZ1A 5APJA 5AYGA 3ADWA 3CLDA 3CS8A 4R06A 3VN2A 2AYRA 3WJ4A 2VV4A 2Q1VA 3KMZA 2AA6A 5DLRA 1OSVA 5AAUA 1GWQA 4JGVA 5M96A 2OZ7A 3GWSX 1DKFB 5DWGA 3NSPA 3O1EA 1G50A 4RUOX 1KNUA 4PF3A 1T74A 2PJLA 2ZK5A 4OKWA 1RK3A 5DIEA 5K13A 3D90A 4ZO1X 3AN4A 3HC6A 3VI8A 1FCYA 1N4HA 2HARA 1R1KD 3DZYA 5KRHA 1U9EA 3ADVA 1XQCA 2YJDA 3B0RA 2VSRA 4OH5A 4ZNTA 5DXKA 4IVWA 4OEAA 5AWKA 5DI7A 4PLEA 2Q7IA 5DUHA 5E0WA 3AFRA 1ILGA 1FBYA 1FCZA 4ZOMA 5FQPA 1PRGA 3OOFA 3W5PA 2ZLCA 1U3SA 5DX3B 5KCCA 1DB1A 5DKSA 2I4JA 4PWLA 4HLWA 3UU7B 1NQ2A 1ZH7A 2ZFXA 1Y0XX 1EXXA 1YY4A 2FVJA 2GPVA 3E94A 3OS8A 5EC9A 4XLDA 2QGTA 3AURA 3F5CB 2E2RA 3GYUA 3AX8A 3ZRBA 3ZR7A 4NB6A 2Q59B 1YIMA 1X78A 3V49A 2ACLB 5DU5A 3GBKA 3ERDA 3VTBA 4MG6A 3B66A 1XJ7A 3VT9A 3VT3A 1PZLA 3WGPA 3G9EA 3VJTA 3VRUA 4A4VA 1FM9A 2R6WA 4ZNWA 2HC4A 1OT7A 1X7RA 1XDKA 3UVVB 1PQ6A 4OILA 1I38A 2PIUA 3OMMA 5KRJA 4FHHA 2QZOB 5KRKA 4RMDA 1XNNA 5L7EA 1Z95A 5GIDA 2P7AA 2GTKA 3A78A 3W0AA 4DK8A 5EJVA 1E3KA 3OLSA 3RY9A 5IXKA 2NXXA 2F4BA 3Q95A 5KCEA 4ITFA 4DK7A 1XIUA 3PBAA 2QNVA 1M13A 2QA8B 2O9IA 2ZXNA 4KZIA 3VT7A 3BC5A 2QR9A 2ZK4A 3L03A 4P6XA 4UDDA 4QK4A 3ET2A 3VSPA 2PITA 1S0ZA 3V9YA 4ZI1A 4G21A 1XV9B 2P1UA 4ITEA 1Y9RA 4P6WA 4Q13A 5DXBA 1S9PA 3FUGA 3PRGA 4IA1A 1NUOA 1R6GA 5C4TA 4OFUA 2J4AA 4NY9A 2PIXA 3CDPA 5DWEA 2O4RA 1UPVA 4OZTE 1XLSA 2AMBA 3OMOA 1SQNA 4IWFA 4OC7A 2AA2A 4MG8A 1OVLB 1PK5A 4MGDA 4XT9A 3PCUA 5DRJA 2NV7A 2LBDA 1XQ3A 1FM9D 5FQRA 4MG9A 4RWVA 4DQMA 1SJ0A 3DCTA 2Q6RA 4N1YA 5APKA 4XTAA 4S14A 4J26A 1X7JA 2JFAA 2QMVA 3L0LA 5DKBA 2GPOA 5DXGA 1UOMA 5AZVA 3D57A 4FN9A 3AZ3A 1Y0SA 5E14A 1G2NA 1YUCA 1T73A 2H77A 2HAMA 3OZ0A 2ZLAA 5B5BA 1UPWA 1S19A 3A2IA 2IOGA 3OGTA 4OIVA 2POBA 2Q5SA 3OMKA 5DUGA 3OS9A 3WMHA 4X1GA 3P0UA 3OSWA 2QXSA 4Q0AC 4POHA 2NXXE 2ZK2A 3FURA 3UUCA 4FGYA 3PO9A 1S0XA 2VV3A 4IV4A 4OZRE 3GN8A 3SP6A 4J5WC 4OKBA 4PPPA 4RUPA 5JJMA 5CJ6A 4IV2A 5DL4A 4IUIA 2PIRA 5JI0D 2GIUA 3WT6A 3RLJA 2OVHA 2QGWA 5G44A 5KD9A 4UDAA 3CQVA 2QTUA 4LBDA 4WVDA 3CTBA 1YYEA 3ADUA 3WFFA 5DVCA 3ZRAA 1PDUA 1XLSE 4NIEA 3HC5A 5AAVB 4ZNSA 2GL8A 3OLFA 4RZGA 3D5FA 5DV8A 3FALB 3DCUA 2JF9A 5EGVA 4TUZB 3U9QA 5KCUA 2OVMA 3FC6B 3KDTA 2J14A 4OKTA 3K23A 4TV1A 1ZUCA 2B1ZA 4MG5A 1ZKYA 5DWJA 1R20A 5DSHA 1HG4A 1YJEA 2P15A 1RJKA 2VV1B 4REEA 3LBDA 4R2UA 4POJA 2J7YA 5DVVA 4IW6A 2R40D 2PINA 5ICKA 4A2JA 4XHDA 4MGBA 1KKQA 1RDTD 2G0GA 3H0AA 4QM0A 4YNKA 5G3JA 4Q50A 2AMAA 2BAWA 4FHIA 5AK2A 2QE4A 1XPCA 4LNXA 4JL4A 5KRIA 5DKGA 3NOAA 3KMGA 2JJ3A 4PVUA 2FSZA 5AVLA 4OJBA 4WHGA 1XNXA 5DZ0A 2HB8A 3W5RA 1DKFA 2Q60A 1XAPA 3R5NA 1Z5XE 4MGAB 5DP0A 3W5TA 3IPQA 3L3ZA 4WQPA 4PP6A 3VRVA 3ADSA 1FM6A 2BJ4B 3HQ5A 1L2IA 4WHFA 1WM0X 2P7ZA 1XB7A 1K7LA 3E7CA 4XAOA 2V7CA 1UHLB 1R20D 2B1VA 3IPUA 5DIGA 5G43A 3VJIA 1VJBA 3MNPA 1FCXA 2YATA 1XVPB 2ZY0A 5DTVA 3CJWA 3VRTA 3FLIA 5FQSA 3B67A 4OH6A 4X1FA 5JY3A 2AA7A 4J24A 3DZYD 4N5GA 2Q70A 3H0AD 3HZFA 5SYZA 4UDBA 1QKNA 1XOWA 2ZKCA 1OSHA 3AZ1A 1HJ1A 4LNWA 2O4JA 4Y29A 5LWPA 4OZRU 5DK9A 5FQVA 2AX9A 3KFCA 5DX3A 1X7EA 2AWHA 5E0XA 4O8FA 3B0TA 3VJSA 4CI4A 5EHJA 4OJ4A 5HJPA 3UU7A 1YP0A 3VRWA 5H1EA 5KCTA 2Q1HA 4OLMA 5DWIA 2XYWA 3Q95B 3V3QA 2P54A 3TKMA 1A52A 1MVCA 3HM1A 4KZJA 5G45A 3IA6A 3G8OA 3OKIA 3F5CA 4WLBA 4F9MA 1K4WA 2PRGA 3W0GA 5C4SA 4DMAA 5I4VA 2Q59A 5KCDA 4RZFA 2ACLA 4NUFA 3P88A 5DMFA 3L3XA 4IS8A 1FM6D 2XYXA 3O1DA 3OLLA 1SKXA 2YFEA 4L96A 5EI1A 3RUTA 4ZNHA 5AVIA 2PKLA 5HZCA 1PQCA 4KZMA 5DV3A 1G5YA 2PNUA 3R2AA 3UVVA 2P4YA 4MG8B 4MGDB 2ZMHA 4OIUA 1NQ1A 2QZOA 5FQTA 3X31A 2XKWA 1X7BA 3UUAB 3KDUA 1QKTA 2QW4A 4IVYA 3DZUA 3VHUA 4CSJA 1I37A 4DM8A 4RFWA 3ERTA
chains in the Genus database with same CATH superfamily
3OAPA 3OZJA 3G8IA 4G2HA 4DM6A 2ZK1A 5DZ3A 2ZNNA 1P93A 3OKHA 4FNEA 4JYGA 4OEYA 3KWYA 1XV9A 4G1DA 5DWLA 1T7MA 3B3KA 1NQ0A 3AN3A 3ADXA 2I0JA 2Z4BA 3X36A 5HYRA 5DMCA 3RVFA 3B5RA 3CWDA 5E1CA 2ZK0A 1NHZA 4PPSA 4YPQA 1RKGA 2ZNOA 1T79A 3W0CA 1T7FA 3IXPA 4RE8A 3VT8A 1Z5XU 1OVLA 4TUZA 3VT6A 4MG7B 4JYIA 3UP0A 2Q6JA 3TKCA 2AXAA 3V9VA 1GWRA 2I0GA 4JAZA 3VSOA 3B65A 2G5OA 3GD2A 3UUDB 3VJHA 4ZO1B 1LV2A 3DZUD 4UDCA 3A3ZX 4M8EA 3ADTA 4G2IA 3CS6A 5DXPA 3R8IA 3IPSA 4QJRA 4RMCA 2HFPA 2EWPA 1T76A 3IMYA 1QKUA 3VT5A 5AZTA 2Q7LA 1XP9A 2HVCA 3P8XA 2PIPL 3A9EB 3L0EA 3PEQA 3NSQA 4ZN7A 2V0VA 5IZ0A 4IU7A 3V9TA 1ZAFA 4APUA 2GWXA 5DXEA 3X1HA 1XP6A 4K7AA 2HB7A 3HODA 4DOSA 4E2JA 3SZ1A 1PQ9A 1R5KA 4IQRA 2VV4B 1KV6A 4N8RA 3SP9A 3AZ2A 1R1KA 4XUMA 5HJSA 3K6PA 3IXPD 2B50A 3KYTA 3VHVA 1XZXX 1I7GA 1M2ZA 4ZNVA 1P8DA 5DVSA 2YLPA 3W5QA 4OHAA 2IHQA 3HLVA 5DXMA 5LGAA 5L7GA 4LTWA 1NYXA 4OGHA 4K6IA 5DZIA 4OZTU 5L7HA 4OKXA 3GWXA 4G1YA 1TXIA 3TX7B 3JZCA 5KCWA 3OSIA 1NQ7A 5G42A 5AAVA 1NRLA 2VV0A 2ZK6A 3FXVA 5KR9A 3RUUA 3FALA 1T65A 1MZNA 2A3IA 2HWRA 4S0SA 1T7RA 2Q8SA 2ZNPA 3JZBA 2P7GA 1EXAA 2QABA 2QSEA 3FC6A 1RKHA 3DY6A 4RUJA 2QA6A 2ZL9A 4PXMA 4RAKA 1EREA 5C4OA 5KRLA 3A2JA 1GS4A 2HWQA 1L2JA 1FD0A 5GICA 1TFCA 2B23A 2ZBSA 4OJ9A 4RZEA 2OAXA 5GT4A 1N46A 3VTDA 3W0IA 4A4WA 1K74A 2HCDA 2VV1A 3W0YA 1T5ZA 4XUHA 2P1VA 4B7WA 1YMTA 2OUZA 4OARA 1M7WA 1ZGYA 2QXMA 3FEIA 5AWJA 3V4AA 1IE9A 2ZMJA 3OMQA 4R6SA 5HYKA 4WPFA 4S0TA 5KROA 2AX8A 1A28A 2XYJA 5E15A 2NPAA 2ZK3A 4JYHA 4E4KA 4J5WA 3ILZA 3B1MA 2REWA 1I7IA 1QKMA 4PRGA 1XDKB 4L98A 2AB2A 5DZHA 1IE8A 3DR1A 3MNEA 5HJPB 4YT1A 5DYBA 3P89A 3B0WA 3ET3A 1NAXA 3MNOA 2GPPA 4QL8A 4IA3A 5G5WA 4MGAA 3WT7A 1X76A 5DXRA 3R8AA 2ATHA 2BJ4A 2VSTA 3HO0A 2PIVA 3B68A 3WTQA 4J5XC 4RMEA 5E7VA 2HBHA 2YLOA 1LBDA 1UHLA 3TY0A 5DUEA 3VT4A 3PLZA 2I4PA 5KRAA 5DY8A 2Q7JA 1K74D 5DXBB 5IAWA 5A86A 1XVPA 2Q5PA 1H9UA 4ONIA 2ZXMA 4EMAA 2POGA 1E3GA 2Z4JA 5KYJA 1T63A 1U3QA 4G20A 4G1ZA 4S15A 5KRFA 4OFRA 3R29A 2ABIA 4NQAB 4ZN9A 3G0WA 3H52A 3FEJA 1U3RA 2H79A 2HASA 1ZEOA 4QE6A 1NDEA 4MG9B 3CS4A 3K22A 3RLLA 2GPUA 3WJ5A 2AX7A 4ZNUA 5DV6A 5F9BA 2OM9A 2JFAB 3GYTA 4BCRA 4XI3A 4OK1A 5G46A 5ACCA 3WFGA 2QA8A 3CDSA 2YJAB 3R5MA 2Q6SA 2ZXZA 3WWRA 3S9SA 4LSJA 3BEJA 3OSAA 2PIQA 5DIDA 2NW4A 3KMRA 1YOKA 4N73A 4YMQA 3X1IA 5L11A 2G44A 3EYBA 2Q3YA 2W8YA 2ZVTA 4PP3A 1Q4XA 2ZMIA 4PP5A 5KYAA 3VHWA 1ZDTA 3V3EA 3W0JA 2YLQA 5GIEA 3UUAA 3N00A 2QPYA 1SR7A 5KCFA 2PIWA 3E00A 3T03A 1YA3A 4OEDA 3KPZA 2Q5GA 3BQDA 3D24A 5JJMB 5DXQA 4DORA 1NAVA 4K4JA 3ZQTA 3WT5A 1YOWA 5B41A 5C4UA 3QT0A 4IW8A 3F7DA 3W0HA 3OOKA 3A40X 2XHSA 3KBAA 1PCGA 3D6DA 3L1BA 3UP3A 2I4ZA 2P1TA 4ZJWA 2GP7A 2YHDA 3OMPA 2AO6A 1ZDUA 5DRMA 4PLDA 1T7TA 2VV2A 1ERRA 3GZ9A 3HVLA 3OS8C 5APHA 5ETHA 2AM9A 5HCVA 4J5XA 4REFA 3K8SA 4MG7A 1MV9A 4IWCA 4OEZA 2OCFA 3DT3A 3FS1A 2R40A 2ZASA 4TV1B 4IA7A 1GWXA 2G0HA 2R6YA 4EM9A 4IA2A 1RDTA 5EITA 3A2HA 2PIOA 3UUDA 1ILHA 4MDDA 2QH6A 3AUNA 2YLYA 3E00D 3M7RA 4MGCA 5DYDA 5E19A 4ZJRA 3LMPA 5KRMA 4CI5A 2IOKA 1N83A 2FAIA 4MGBB 2Q7KA 1BSXA 2AAXA 3L0JA 4HEEX 4E4QA 1YINA 3VTCA 4M8HA 1S9QA 5DKEA 3B0QA 2AA5A 2Q61A 3ET1A 3R8DA 5KRCA 3A9EA 2J7XA 3AUQA 2ZNQA 1XP1A 4QE8A 3ET0A 2AX6A 1G1UA 5DZ1A 5APJA 5AYGA 3ADWA 3CLDA 3CS8A 4R06A 3VN2A 2AYRA 3WJ4A 2VV4A 2Q1VA 3KMZA 2AA6A 5DLRA 1OSVA 5AAUA 1GWQA 4JGVA 5M96A 2OZ7A 3GWSX 1DKFB 5DWGA 3NSPA 3O1EA 1G50A 4RUOX 1KNUA 4PF3A 1T74A 2PJLA 2ZK5A 4OKWA 1RK3A 5DIEA 5K13A 3D90A 4ZO1X 3AN4A 3HC6A 3VI8A 1FCYA 1N4HA 2HARA 1R1KD 3DZYA 5KRHA 1U9EA 3ADVA 1XQCA 2YJDA 3B0RA 2VSRA 4OH5A 4ZNTA 5DXKA 4IVWA 4OEAA 5AWKA 5DI7A 4PLEA 2Q7IA 5DUHA 5E0WA 3AFRA 1ILGA 1FBYA 1FCZA 4ZOMA 5FQPA 1PRGA 3OOFA 3W5PA 2ZLCA 1U3SA 5DX3B 5KCCA 1DB1A 5DKSA 2I4JA 4PWLA 4HLWA 3UU7B 1NQ2A 1ZH7A 2ZFXA 1Y0XX 1EXXA 1YY4A 2FVJA 2GPVA 3E94A 3OS8A 5EC9A 4XLDA 2QGTA 3AURA 3F5CB 2E2RA 3GYUA 3AX8A 3ZRBA 3ZR7A 4NB6A 2Q59B 1YIMA 1X78A 3V49A 2ACLB 5DU5A 3GBKA 3ERDA 3VTBA 4MG6A 3B66A 1XJ7A 3VT9A 3VT3A 1PZLA 3WGPA 3G9EA 3VJTA 3VRUA 4A4VA 1FM9A 2R6WA 4ZNWA 2HC4A 1OT7A 1X7RA 1XDKA 3UVVB 1PQ6A 4OILA 1I38A 2PIUA 3OMMA 5KRJA 4FHHA 2QZOB 5KRKA 4RMDA 1XNNA 5L7EA 1Z95A 5GIDA 2P7AA 2GTKA 3A78A 3W0AA 4DK8A 5EJVA 1E3KA 3OLSA 3RY9A 5IXKA 2NXXA 2F4BA 3Q95A 5KCEA 4ITFA 4DK7A 1XIUA 3PBAA 2QNVA 1M13A 2QA8B 2O9IA 2ZXNA 4KZIA 3VT7A 3BC5A 2QR9A 2ZK4A 3L03A 4P6XA 4UDDA 4QK4A 3ET2A 3VSPA 2PITA 1S0ZA 3V9YA 4ZI1A 4G21A 1XV9B 2P1UA 4ITEA 1Y9RA 4P6WA 4Q13A 5DXBA 1S9PA 3FUGA 3PRGA 4IA1A 1NUOA 1R6GA 5C4TA 4OFUA 2J4AA 4NY9A 2PIXA 3CDPA 5DWEA 2O4RA 1UPVA 4OZTE 1XLSA 2AMBA 3OMOA 1SQNA 4IWFA 4OC7A 2AA2A 4MG8A 1OVLB 1PK5A 4MGDA 4XT9A 3PCUA 5DRJA 2NV7A 2LBDA 1XQ3A 1FM9D 5FQRA 4MG9A 4RWVA 4DQMA 1SJ0A 3DCTA 2Q6RA 4N1YA 5APKA 4XTAA 4S14A 4J26A 1X7JA 2JFAA 2QMVA 3L0LA 5DKBA 2GPOA 5DXGA 1UOMA 5AZVA 3D57A 4FN9A 3AZ3A 1Y0SA 5E14A 1G2NA 1YUCA 1T73A 2H77A 2HAMA 3OZ0A 2ZLAA 5B5BA 1UPWA 1S19A 3A2IA 2IOGA 3OGTA 4OIVA 2POBA 2Q5SA 3OMKA 5DUGA 3OS9A 3WMHA 4X1GA 3P0UA 3OSWA 2QXSA 4Q0AC 4POHA 2NXXE 2ZK2A 3FURA 3UUCA 4FGYA 3PO9A 1S0XA 2VV3A 4IV4A 4OZRE 3GN8A 3SP6A 4J5WC 4OKBA 4PPPA 4RUPA 5JJMA 5CJ6A 4IV2A 5DL4A 4IUIA 2PIRA 5JI0D 2GIUA 3WT6A 3RLJA 2OVHA 2QGWA 5G44A 5KD9A 4UDAA 3CQVA 2QTUA 4LBDA 4WVDA 3CTBA 1YYEA 3ADUA 3WFFA 5DVCA 3ZRAA 1PDUA 1XLSE 4NIEA 3HC5A 5AAVB 4ZNSA 2GL8A 3OLFA 4RZGA 3D5FA 5DV8A 3FALB 3DCUA 2JF9A 5EGVA 4TUZB 3U9QA 5KCUA 2OVMA 3FC6B 3KDTA 2J14A 4OKTA 3K23A 4TV1A 1ZUCA 2B1ZA 4MG5A 1ZKYA 5DWJA 1R20A 5DSHA 1HG4A 1YJEA 2P15A 1RJKA 2VV1B 4REEA 3LBDA 4R2UA 4POJA 2J7YA 5DVVA 4IW6A 2R40D 2PINA 5ICKA 4A2JA 4XHDA 4MGBA 1KKQA 1RDTD 2G0GA 3H0AA 4QM0A 4YNKA 5G3JA 4Q50A 2AMAA 2BAWA 4FHIA 5AK2A 2QE4A 1XPCA 4LNXA 4JL4A 5KRIA 5DKGA 3NOAA 3KMGA 2JJ3A 4PVUA 2FSZA 5AVLA 4OJBA 4WHGA 1XNXA 5DZ0A 2HB8A 3W5RA 1DKFA 2Q60A 1XAPA 3R5NA 1Z5XE 4MGAB 5DP0A 3W5TA 3IPQA 3L3ZA 4WQPA 4PP6A 3VRVA 3ADSA 1FM6A 2BJ4B 3HQ5A 1L2IA 4WHFA 1WM0X 2P7ZA 1XB7A 1K7LA 3E7CA 4XAOA 2V7CA 1UHLB 1R20D 2B1VA 3IPUA 5DIGA 5G43A 3VJIA 1VJBA 3MNPA 1FCXA 2YATA 1XVPB 2ZY0A 5DTVA 3CJWA 3VRTA 3FLIA 5FQSA 3B67A 4OH6A 4X1FA 5JY3A 2AA7A 4J24A 3DZYD 4N5GA 2Q70A 3H0AD 3HZFA 5SYZA 4UDBA 1QKNA 1XOWA 2ZKCA 1OSHA 3AZ1A 1HJ1A 4LNWA 2O4JA 4Y29A 5LWPA 4OZRU 5DK9A 5FQVA 2AX9A 3KFCA 5DX3A 1X7EA 2AWHA 5E0XA 4O8FA 3B0TA 3VJSA 4CI4A 5EHJA 4OJ4A 5HJPA 3UU7A 1YP0A 3VRWA 5H1EA 5KCTA 2Q1HA 4OLMA 5DWIA 2XYWA 3Q95B 3V3QA 2P54A 3TKMA 1A52A 1MVCA 3HM1A 4KZJA 5G45A 3IA6A 3G8OA 3OKIA 3F5CA 4WLBA 4F9MA 1K4WA 2PRGA 3W0GA 5C4SA 4DMAA 5I4VA 2Q59A 5KCDA 4RZFA 2ACLA 4NUFA 3P88A 5DMFA 3L3XA 4IS8A 1FM6D 2XYXA 3O1DA 3OLLA 1SKXA 2YFEA 4L96A 5EI1A 3RUTA 4ZNHA 5AVIA 2PKLA 5HZCA 1PQCA 4KZMA 5DV3A 1G5YA 2PNUA 3R2AA 3UVVA 2P4YA 4MG8B 4MGDB 2ZMHA 4OIUA 1NQ1A 2QZOA 5FQTA 3X31A 2XKWA 1X7BA 3UUAB 3KDUA 1QKTA 2QW4A 4IVYA 3DZUA 3VHUA 4CSJA 1I37A 4DM8A 4RFWA 3ERTA
chains in the Genus database with same CATH topology
3OAPA 3OZJA 3G8IA 4G2HA 4DM6A 2ZK1A 5DZ3A 2ZNNA 1P93A 3OKHA 4FNEA 4JYGA 4OEYA 3KWYA 1XV9A 4G1DA 5DWLA 1T7MA 3B3KA 1NQ0A 3AN3A 3ADXA 2I0JA 2Z4BA 3X36A 5HYRA 5DMCA 3RVFA 3B5RA 3CWDA 5E1CA 2ZK0A 1NHZA 4PPSA 4YPQA 1RKGA 2ZNOA 1T79A 3W0CA 1T7FA 3IXPA 4RE8A 3VT8A 1Z5XU 1OVLA 4TUZA 3VT6A 4MG7B 4JYIA 3UP0A 2Q6JA 3TKCA 2AXAA 3V9VA 1GWRA 2I0GA 4JAZA 3VSOA 3B65A 2G5OA 3GD2A 3UUDB 3VJHA 4ZO1B 1LV2A 3DZUD 4UDCA 3A3ZX 4M8EA 3ADTA 4G2IA 3CS6A 5DXPA 3R8IA 3IPSA 4QJRA 4RMCA 2HFPA 2EWPA 1T76A 3IMYA 1QKUA 3VT5A 5AZTA 2Q7LA 1XP9A 2HVCA 3P8XA 2PIPL 3A9EB 3L0EA 3PEQA 3NSQA 4ZN7A 2V0VA 5IZ0A 4IU7A 3V9TA 1ZAFA 4APUA 2GWXA 5DXEA 3X1HA 1XP6A 4K7AA 2HB7A 3HODA 4DOSA 4E2JA 3SZ1A 1PQ9A 1R5KA 4IQRA 2VV4B 1KV6A 4N8RA 3SP9A 3AZ2A 1R1KA 4XUMA 5HJSA 3K6PA 3IXPD 2B50A 3KYTA 3VHVA 1XZXX 1I7GA 1M2ZA 4ZNVA 1P8DA 5DVSA 2YLPA 3W5QA 4OHAA 2IHQA 3HLVA 5DXMA 5LGAA 5L7GA 4LTWA 1NYXA 4OGHA 4K6IA 5DZIA 4OZTU 5L7HA 4OKXA 3GWXA 4G1YA 1TXIA 3TX7B 3JZCA 5KCWA 3OSIA 1NQ7A 5G42A 5AAVA 1NRLA 2VV0A 2ZK6A 3FXVA 5KR9A 3RUUA 3FALA 1T65A 1MZNA 2A3IA 2HWRA 4S0SA 1T7RA 2Q8SA 2ZNPA 3JZBA 2P7GA 1EXAA 2QABA 2QSEA 3FC6A 1RKHA 3DY6A 4RUJA 2QA6A 2ZL9A 4PXMA 4RAKA 1EREA 5C4OA 5KRLA 3A2JA 1GS4A 2HWQA 1L2JA 1FD0A 5GICA 1TFCA 2B23A 2ZBSA 4OJ9A 4RZEA 2OAXA 5GT4A 1N46A 3VTDA 3W0IA 4A4WA 1K74A 2HCDA 2VV1A 3W0YA 1T5ZA 4XUHA 2P1VA 4B7WA 1YMTA 2OUZA 4OARA 1M7WA 1ZGYA 2QXMA 3FEIA 5AWJA 3V4AA 1IE9A 2ZMJA 3OMQA 4R6SA 5HYKA 4WPFA 4S0TA 5KROA 2AX8A 1A28A 2XYJA 5E15A 2NPAA 2ZK3A 4JYHA 4E4KA 4J5WA 3ILZA 3B1MA 2REWA 1I7IA 1QKMA 4PRGA 1XDKB 4L98A 2AB2A 5DZHA 1IE8A 3DR1A 3MNEA 5HJPB 4YT1A 5DYBA 3P89A 3B0WA 3ET3A 1NAXA 3MNOA 2GPPA 4QL8A 4IA3A 5G5WA 4MGAA 3WT7A 1X76A 5DXRA 3R8AA 2ATHA 2BJ4A 2VSTA 3HO0A 2PIVA 3B68A 3WTQA 4J5XC 4RMEA 5E7VA 2HBHA 2YLOA 1LBDA 1UHLA 3TY0A 5DUEA 3VT4A 3PLZA 2I4PA 5KRAA 5DY8A 2Q7JA 1K74D 5DXBB 5IAWA 5A86A 1XVPA 2Q5PA 1H9UA 4ONIA 2ZXMA 4EMAA 2POGA 1E3GA 2Z4JA 5KYJA 1T63A 1U3QA 4G20A 4G1ZA 4S15A 5KRFA 4OFRA 3R29A 2ABIA 4NQAB 4ZN9A 3G0WA 3H52A 3FEJA 1U3RA 2H79A 2HASA 1ZEOA 4QE6A 1NDEA 4MG9B 3CS4A 3K22A 3RLLA 2GPUA 3WJ5A 2AX7A 4ZNUA 5DV6A 5F9BA 2OM9A 2JFAB 3GYTA 4BCRA 4XI3A 4OK1A 5G46A 5ACCA 3WFGA 2QA8A 3CDSA 2YJAB 3R5MA 2Q6SA 2ZXZA 3WWRA 3S9SA 4LSJA 3BEJA 3OSAA 2PIQA 5DIDA 2NW4A 3KMRA 1YOKA 4N73A 4YMQA 3X1IA 5L11A 2G44A 3EYBA 2Q3YA 2W8YA 2ZVTA 4PP3A 1Q4XA 2ZMIA 4PP5A 5KYAA 3VHWA 1ZDTA 3V3EA 3W0JA 2YLQA 5GIEA 3UUAA 3N00A 2QPYA 1SR7A 5KCFA 2PIWA 3E00A 3T03A 1YA3A 4OEDA 3KPZA 2Q5GA 3BQDA 3D24A 5JJMB 5DXQA 4DORA 1NAVA 4K4JA 3ZQTA 3WT5A 1YOWA 5B41A 5C4UA 3QT0A 4IW8A 3F7DA 3W0HA 3OOKA 3A40X 2XHSA 3KBAA 1PCGA 3D6DA 3L1BA 3UP3A 2I4ZA 2P1TA 4ZJWA 2GP7A 2YHDA 3OMPA 2AO6A 1ZDUA 5DRMA 4PLDA 1T7TA 2VV2A 1ERRA 3GZ9A 3HVLA 3OS8C 5APHA 5ETHA 2AM9A 5HCVA 4J5XA 4REFA 3K8SA 4MG7A 1MV9A 4IWCA 4OEZA 2OCFA 3DT3A 3FS1A 2R40A 2ZASA 4TV1B 4IA7A 1GWXA 2G0HA 2R6YA 4EM9A 4IA2A 1RDTA 5EITA 3A2HA 2PIOA 3UUDA 1ILHA 4MDDA 2QH6A 3AUNA 2YLYA 3E00D 3M7RA 4MGCA 5DYDA 5E19A 4ZJRA 3LMPA 5KRMA 4CI5A 2IOKA 1N83A 2FAIA 4MGBB 2Q7KA 1BSXA 2AAXA 3L0JA 4HEEX 4E4QA 1YINA 3VTCA 4M8HA 1S9QA 5DKEA 3B0QA 2AA5A 2Q61A 3ET1A 3R8DA 5KRCA 3A9EA 2J7XA 3AUQA 2ZNQA 1XP1A 4QE8A 3ET0A 2AX6A 1G1UA 5DZ1A 5APJA 5AYGA 3ADWA 3CLDA 3CS8A 4R06A 3VN2A 2AYRA 3WJ4A 2VV4A 2Q1VA 3KMZA 2AA6A 5DLRA 1OSVA 5AAUA 1GWQA 4JGVA 5M96A 2OZ7A 3GWSX 1DKFB 5DWGA 3NSPA 3O1EA 1G50A 4RUOX 1KNUA 4PF3A 1T74A 2PJLA 2ZK5A 4OKWA 1RK3A 5DIEA 5K13A 3D90A 4ZO1X 3AN4A 3HC6A 3VI8A 1FCYA 1N4HA 2HARA 1R1KD 3DZYA 5KRHA 1U9EA 3ADVA 1XQCA 2YJDA 3B0RA 2VSRA 4OH5A 4ZNTA 5DXKA 4IVWA 4OEAA 5AWKA 5DI7A 4PLEA 2Q7IA 5DUHA 5E0WA 3AFRA 1ILGA 1FBYA 1FCZA 4ZOMA 5FQPA 1PRGA 3OOFA 3W5PA 2ZLCA 1U3SA 5DX3B 5KCCA 1DB1A 5DKSA 2I4JA 4PWLA 4HLWA 3UU7B 1NQ2A 1ZH7A 2ZFXA 1Y0XX 1EXXA 1YY4A 2FVJA 2GPVA 3E94A 3OS8A 5EC9A 4XLDA 2QGTA 3AURA 3F5CB 2E2RA 3GYUA 3AX8A 3ZRBA 3ZR7A 4NB6A 2Q59B 1YIMA 1X78A 3V49A 2ACLB 5DU5A 3GBKA 3ERDA 3VTBA 4MG6A 3B66A 1XJ7A 3VT9A 3VT3A 1PZLA 3WGPA 3G9EA 3VJTA 3VRUA 4A4VA 1FM9A 2R6WA 4ZNWA 2HC4A 1OT7A 1X7RA 1XDKA 3UVVB 1PQ6A 4OILA 1I38A 2PIUA 3OMMA 5KRJA 4FHHA 2QZOB 5KRKA 4RMDA 1XNNA 5L7EA 1Z95A 5GIDA 2P7AA 2GTKA 3A78A 3W0AA 4DK8A 5EJVA 1E3KA 3OLSA 3RY9A 5IXKA 2NXXA 2F4BA 3Q95A 5KCEA 4ITFA 4DK7A 1XIUA 3PBAA 2QNVA 1M13A 2QA8B 2O9IA 2ZXNA 4KZIA 3VT7A 3BC5A 2QR9A 2ZK4A 3L03A 4P6XA 4UDDA 4QK4A 3ET2A 3VSPA 2PITA 1S0ZA 3V9YA 4ZI1A 4G21A 1XV9B 2P1UA 4ITEA 1Y9RA 4P6WA 4Q13A 5DXBA 1S9PA 3FUGA 3PRGA 4IA1A 1NUOA 1R6GA 5C4TA 4OFUA 2J4AA 4NY9A 2PIXA 3CDPA 5DWEA 2O4RA 1UPVA 4OZTE 1XLSA 2AMBA 3OMOA 1SQNA 4IWFA 4OC7A 2AA2A 4MG8A 1OVLB 1PK5A 4MGDA 4XT9A 3PCUA 5DRJA 2NV7A 2LBDA 1XQ3A 1FM9D 5FQRA 4MG9A 4RWVA 4DQMA 1SJ0A 3DCTA 2Q6RA 4N1YA 5APKA 4XTAA 4S14A 4J26A 1X7JA 2JFAA 2QMVA 3L0LA 5DKBA 2GPOA 5DXGA 1UOMA 5AZVA 3D57A 4FN9A 3AZ3A 1Y0SA 5E14A 1G2NA 1YUCA 1T73A 2H77A 2HAMA 3OZ0A 2ZLAA 5B5BA 1UPWA 1S19A 3A2IA 2IOGA 3OGTA 4OIVA 2POBA 2Q5SA 3OMKA 5DUGA 3OS9A 3WMHA 4X1GA 3P0UA 3OSWA 2QXSA 4Q0AC 4POHA 2NXXE 2ZK2A 3FURA 3UUCA 4FGYA 3PO9A 1S0XA 2VV3A 4IV4A 4OZRE 3GN8A 3SP6A 4J5WC 4OKBA 4PPPA 4RUPA 5JJMA 5CJ6A 4IV2A 5DL4A 4IUIA 2PIRA 5JI0D 2GIUA 3WT6A 3RLJA 2OVHA 2QGWA 5G44A 5KD9A 4UDAA 3CQVA 2QTUA 4LBDA 4WVDA 3CTBA 1YYEA 3ADUA 3WFFA 5DVCA 3ZRAA 1PDUA 1XLSE 4NIEA 3HC5A 5AAVB 4ZNSA 2GL8A 3OLFA 4RZGA 3D5FA 5DV8A 3FALB 3DCUA 2JF9A 5EGVA 4TUZB 3U9QA 5KCUA 2OVMA 3FC6B 3KDTA 2J14A 4OKTA 3K23A 4TV1A 1ZUCA 2B1ZA 4MG5A 1ZKYA 5DWJA 1R20A 5DSHA 1HG4A 1YJEA 2P15A 1RJKA 2VV1B 4REEA 3LBDA 4R2UA 4POJA 2J7YA 5DVVA 4IW6A 2R40D 2PINA 5ICKA 4A2JA 4XHDA 4MGBA 1KKQA 1RDTD 2G0GA 3H0AA 4QM0A 4YNKA 5G3JA 4Q50A 2AMAA 2BAWA 4FHIA 5AK2A 2QE4A 1XPCA 4LNXA 4JL4A 5KRIA 5DKGA 3NOAA 3KMGA 2JJ3A 4PVUA 2FSZA 5AVLA 4OJBA 4WHGA 1XNXA 5DZ0A 2HB8A 3W5RA 1DKFA 2Q60A 1XAPA 3R5NA 1Z5XE 4MGAB 5DP0A 3W5TA 3IPQA 3L3ZA 4WQPA 4PP6A 3VRVA 3ADSA 1FM6A 2BJ4B 3HQ5A 1L2IA 4WHFA 1WM0X 2P7ZA 1XB7A 1K7LA 3E7CA 4XAOA 2V7CA 1UHLB 1R20D 2B1VA 3IPUA 5DIGA 5G43A 3VJIA 1VJBA 3MNPA 1FCXA 2YATA 1XVPB 2ZY0A 5DTVA 3CJWA 3VRTA 3FLIA 5FQSA 3B67A 4OH6A 4X1FA 5JY3A 2AA7A 4J24A 3DZYD 4N5GA 2Q70A 3H0AD 3HZFA 5SYZA 4UDBA 1QKNA 1XOWA 2ZKCA 1OSHA 3AZ1A 1HJ1A 4LNWA 2O4JA 4Y29A 5LWPA 4OZRU 5DK9A 5FQVA 2AX9A 3KFCA 5DX3A 1X7EA 2AWHA 5E0XA 4O8FA 3B0TA 3VJSA 4CI4A 5EHJA 4OJ4A 5HJPA 3UU7A 1YP0A 3VRWA 5H1EA 5KCTA 2Q1HA 4OLMA 5DWIA 2XYWA 3Q95B 3V3QA 2P54A 3TKMA 1A52A 1MVCA 3HM1A 4KZJA 5G45A 3IA6A 3G8OA 3OKIA 3F5CA 4WLBA 4F9MA 1K4WA 2PRGA 3W0GA 5C4SA 4DMAA 5I4VA 2Q59A 5KCDA 4RZFA 2ACLA 4NUFA 3P88A 5DMFA 3L3XA 4IS8A 1FM6D 2XYXA 3O1DA 3OLLA 1SKXA 2YFEA 4L96A 5EI1A 3RUTA 4ZNHA 5AVIA 2PKLA 5HZCA 1PQCA 4KZMA 5DV3A 1G5YA 2PNUA 3R2AA 3UVVA 2P4YA 4MG8B 4MGDB 2ZMHA 4OIUA 1NQ1A 2QZOA 5FQTA 3X31A 2XKWA 1X7BA 3UUAB 3KDUA 1QKTA 2QW4A 4IVYA 3DZUA 3VHUA 4CSJA 1I37A 4DM8A 4RFWA 3ERTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OAP A;  3OZJ A;  3G8I A;  4G2H A;  4DM6 A;  2ZK1 A;  5DZ3 A;  2ZNN A;  1P93 A;  3OKH A;  4FNE A;  4JYG A;  4OEY A;  3KWY A;  1XV9 A;  4G1D A;  5DWL A;  1T7M A;  3B3K A;  1NQ0 A;  3AN3 A;  3ADX A;  2I0J A;  2Z4B A;  3X36 A;  5HYR A;  5DMC A;  3RVF A;  3B5R A;  3CWD A;  5E1C A;  2ZK0 A;  1NHZ A;  4PPS A;  4YPQ A;  1RKG A;  2ZNO A;  1T79 A;  3W0C A;  1T7F A;  3IXP A;  4RE8 A;  3VT8 A;  1Z5X U;  1OVL A;  4TUZ A;  3VT6 A;  4MG7 B;  4JYI A;  3UP0 A;  2Q6J A;  3TKC A;  2AXA A;  3V9V A;  1GWR A;  2I0G A;  4JAZ A;  3VSO A;  3B65 A;  2G5O A;  3GD2 A;  3UUD B;  3VJH A;  4ZO1 B;  1LV2 A;  3DZU D;  4UDC A;  3A3Z X;  4M8E A;  3ADT A;  4G2I A;  3CS6 A;  5DXP A;  3R8I A;  3IPS A;  4QJR A;  4RMC A;  2HFP A;  2EWP A;  1T76 A;  3IMY A;  1QKU A;  3VT5 A;  5AZT A;  2Q7L A;  1XP9 A;  2HVC A;  3P8X A;  2PIP L;  3A9E B;  3L0E A;  3PEQ A;  3NSQ A;  4ZN7 A;  2V0V A;  5IZ0 A;  4IU7 A;  3V9T A;  1ZAF A;  4APU A;  2GWX A;  5DXE A;  3X1H A;  1XP6 A;  4K7A A;  2HB7 A;  3HOD A;  4DOS A;  4E2J A;  3SZ1 A;  1PQ9 A;  1R5K A;  4IQR A;  2VV4 B;  1KV6 A;  4N8R A;  3SP9 A;  3AZ2 A;  1R1K A;  4XUM A;  5HJS A;  3K6P A;  3IXP D;  2B50 A;  3KYT A;  3VHV A;  1XZX X;  1I7G A;  1M2Z A;  4ZNV A;  1P8D A;  5DVS A;  2YLP A;  3W5Q A;  4OHA A;  2IHQ A;  3HLV A;  5DXM A;  5LGA A;  5L7G A;  4LTW A;  1NYX A;  4OGH A;  4K6I A;  5DZI A;  4OZT U;  5L7H A;  4OKX A;  3GWX A;  4G1Y A;  1TXI A;  3TX7 B;  3JZC A;  5KCW A;  3OSI A;  1NQ7 A;  5G42 A;  5AAV A;  1NRL A;  2VV0 A;  2ZK6 A;  3FXV A;  5KR9 A;  3RUU A;  3FAL A;  1T65 A;  1MZN A;  2A3I A;  2HWR A;  4S0S A;  1T7R A;  2Q8S A;  2ZNP A;  3JZB A;  2P7G A;  1EXA A;  2QAB A;  2QSE A;  3FC6 A;  1RKH A;  3DY6 A;  4RUJ A;  2QA6 A;  2ZL9 A;  4PXM A;  4RAK A;  1ERE A;  5C4O A;  5KRL A;  3A2J A;  1GS4 A;  2HWQ A;  1L2J A;  1FD0 A;  5GIC A;  1TFC A;  2B23 A;  2ZBS A;  4OJ9 A;  4RZE A;  2OAX A;  5GT4 A;  1N46 A;  3VTD A;  3W0I A;  4A4W A;  1K74 A;  2HCD A;  2VV1 A;  3W0Y A;  1T5Z A;  4XUH A;  2P1V A;  4B7W A;  1YMT A;  2OUZ A;  4OAR A;  1M7W A;  1ZGY A;  2QXM A;  3FEI A;  5AWJ A;  3V4A A;  1IE9 A;  2ZMJ A;  3OMQ A;  4R6S A;  5HYK A;  4WPF A;  4S0T A;  5KRO A;  2AX8 A;  1A28 A;  2XYJ A;  5E15 A;  2NPA A;  2ZK3 A;  4JYH A;  4E4K A;  4J5W A;  3ILZ A;  3B1M A;  2REW A;  1I7I A;  1QKM A;  4PRG A;  1XDK B;  4L98 A;  2AB2 A;  5DZH A;  1IE8 A;  3DR1 A;  3MNE A;  5HJP B;  4YT1 A;  5DYB A;  3P89 A;  3B0W A;  3ET3 A;  1NAX A;  3MNO A;  2GPP A;  4QL8 A;  4IA3 A;  5G5W A;  4MGA A;  3WT7 A;  1X76 A;  5DXR A;  3R8A A;  2ATH A;  2BJ4 A;  2VST A;  3HO0 A;  2PIV A;  3B68 A;  3WTQ A;  4J5X C;  4RME A;  5E7V A;  2HBH A;  2YLO A;  1LBD A;  1UHL A;  3TY0 A;  5DUE A;  3VT4 A;  3PLZ A;  2I4P A;  5KRA A;  5DY8 A;  2Q7J A;  1K74 D;  5DXB B;  5IAW A;  5A86 A;  1XVP A;  2Q5P A;  1H9U A;  4ONI A;  2ZXM A;  4EMA A;  2POG A;  1E3G A;  2Z4J A;  5KYJ A;  1T63 A;  1U3Q A;  4G20 A;  4G1Z A;  4S15 A;  5KRF A;  4OFR A;  3R29 A;  2ABI A;  4NQA B;  4ZN9 A;  3G0W A;  3H52 A;  3FEJ A;  1U3R A;  2H79 A;  2HAS A;  1ZEO A;  4QE6 A;  1NDE A;  4MG9 B;  3CS4 A;  3K22 A;  3RLL A;  2GPU A;  3WJ5 A;  2AX7 A;  4ZNU A;  5DV6 A;  5F9B A;  2OM9 A;  2JFA B;  3GYT A;  4BCR A;  4XI3 A;  4OK1 A;  5G46 A;  5ACC A;  3WFG A;  2QA8 A;  3CDS A;  2YJA B;  3R5M A;  2Q6S A;  2ZXZ A;  3WWR A;  3S9S A;  4LSJ A;  3BEJ A;  3OSA A;  2PIQ A;  5DID A;  2NW4 A;  3KMR A;  1YOK A;  4N73 A;  4YMQ A;  3X1I A;  5L11 A;  2G44 A;  3EYB A;  2Q3Y A;  2W8Y A;  2ZVT A;  4PP3 A;  1Q4X A;  2ZMI A;  4PP5 A;  5KYA A;  3VHW A;  1ZDT A;  3V3E A;  3W0J A;  2YLQ A;  5GIE A;  3UUA A;  3N00 A;  2QPY A;  1SR7 A;  5KCF A;  2PIW A;  3E00 A;  3T03 A;  1YA3 A;  4OED A;  3KPZ A;  2Q5G A;  3BQD A;  3D24 A;  5JJM B;  5DXQ A;  4DOR A;  1NAV A;  4K4J A;  3ZQT A;  3WT5 A;  1YOW A;  5B41 A;  5C4U A;  3QT0 A;  4IW8 A;  3F7D A;  3W0H A;  3OOK A;  3A40 X;  2XHS A;  3KBA A;  1PCG A;  3D6D A;  3L1B A;  3UP3 A;  2I4Z A;  2P1T A;  4ZJW A;  2GP7 A;  2YHD A;  3OMP A;  2AO6 A;  1ZDU A;  5DRM A;  4PLD A;  1T7T A;  2VV2 A;  1ERR A;  3GZ9 A;  3HVL A;  3OS8 C;  5APH A;  5ETH A;  2AM9 A;  5HCV A;  4J5X A;  4REF A;  3K8S A;  4MG7 A;  1MV9 A;  4IWC A;  4OEZ A;  2OCF A;  3DT3 A;  3FS1 A;  2R40 A;  2ZAS A;  4TV1 B;  4IA7 A;  1GWX A;  2G0H A;  2R6Y A;  4EM9 A;  4IA2 A;  1RDT A;  5EIT A;  3A2H A;  2PIO A;  3UUD A;  1ILH A;  4MDD A;  2QH6 A;  3AUN A;  2YLY A;  3E00 D;  3M7R A;  4MGC A;  5DYD A;  5E19 A;  4ZJR A;  3LMP A;  5KRM A;  4CI5 A;  2IOK A;  1N83 A;  2FAI A;  4MGB B;  2Q7K A;  1BSX A;  2AAX A;  3L0J A;  4HEE X;  4E4Q A;  1YIN A;  3VTC A;  4M8H A;  1S9Q A;  5DKE A;  3B0Q A;  2AA5 A;  2Q61 A;  3ET1 A;  3R8D A;  5KRC A;  3A9E A;  2J7X A;  3AUQ A;  2ZNQ A;  1XP1 A;  4QE8 A;  3ET0 A;  2AX6 A;  1G1U A;  5DZ1 A;  5APJ A;  5AYG A;  3ADW A;  3CLD A;  3CS8 A;  4R06 A;  3VN2 A;  2AYR A;  3WJ4 A;  2VV4 A;  2Q1V A;  3KMZ A;  2AA6 A;  5DLR A;  1OSV A;  5AAU A;  1GWQ A;  4JGV A;  5M96 A;  2OZ7 A;  3GWS X;  1DKF B;  5DWG A;  3NSP A;  3O1E A;  1G50 A;  4RUO X;  1KNU A;  4PF3 A;  1T74 A;  2PJL A;  2ZK5 A;  4OKW A;  1RK3 A;  5DIE A;  5K13 A;  3D90 A;  4ZO1 X;  3AN4 A;  3HC6 A;  3VI8 A;  1FCY A;  1N4H A;  2HAR A;  1R1K D;  3DZY A;  5KRH A;  1U9E A;  3ADV A;  1XQC A;  2YJD A;  3B0R A;  2VSR A;  4OH5 A;  4ZNT A;  5DXK A;  4IVW A;  4OEA A;  5AWK A;  5DI7 A;  4PLE A;  2Q7I A;  5DUH A;  5E0W A;  3AFR A;  1ILG A;  1FBY A;  1FCZ A;  4ZOM A;  5FQP A;  1PRG A;  3OOF A;  3W5P A;  2ZLC A;  1U3S A;  5DX3 B;  5KCC A;  1DB1 A;  5DKS A;  2I4J A;  4PWL A;  4HLW A;  3UU7 B;  1NQ2 A;  1ZH7 A;  2ZFX A;  1Y0X X;  1EXX A;  1YY4 A;  2FVJ A;  2GPV A;  3E94 A;  3OS8 A;  5EC9 A;  4XLD A;  2QGT A;  3AUR A;  3F5C B;  2E2R A;  3GYU A;  3AX8 A;  3ZRB A;  3ZR7 A;  4NB6 A;  2Q59 B;  1YIM A;  1X78 A;  3V49 A;  2ACL B;  5DU5 A;  3GBK A;  3ERD A;  3VTB A;  4MG6 A;  3B66 A;  1XJ7 A;  3VT9 A;  3VT3 A;  1PZL A;  3WGP A;  3G9E A;  3VJT A;  3VRU A;  4A4V A;  1FM9 A;  2R6W A;  4ZNW A;  2HC4 A;  1OT7 A;  1X7R A;  1XDK A;  3UVV B;  1PQ6 A;  4OIL A;  1I38 A;  2PIU A;  3OMM A;  5KRJ A;  4FHH A;  2QZO B;  5KRK A;  4RMD A;  1XNN A;  5L7E A;  1Z95 A;  5GID A;  2P7A A;  2GTK A;  3A78 A;  3W0A A;  4DK8 A;  5EJV A;  1E3K A;  3OLS A;  3RY9 A;  5IXK A;  2NXX A;  2F4B A;  3Q95 A;  5KCE A;  4ITF A;  4DK7 A;  1XIU A;  3PBA A;  2QNV A;  1M13 A;  2QA8 B;  2O9I A;  2ZXN A;  4KZI A;  3VT7 A;  3BC5 A;  2QR9 A;  2ZK4 A;  3L03 A;  4P6X A;  4UDD A;  4QK4 A;  3ET2 A;  3VSP A;  2PIT A;  1S0Z A;  3V9Y A;  4ZI1 A;  4G21 A;  1XV9 B;  2P1U A;  4ITE A;  1Y9R A;  4P6W A;  4Q13 A;  5DXB A;  1S9P A;  3FUG A;  3PRG A;  4IA1 A;  1NUO A;  1R6G A;  5C4T A;  4OFU A;  2J4A A;  4NY9 A;  2PIX A;  3CDP A;  5DWE A;  2O4R A;  1UPV A;  4OZT E;  1XLS A;  2AMB A;  3OMO A;  1SQN A;  4IWF A;  4OC7 A;  2AA2 A;  4MG8 A;  1OVL B;  1PK5 A;  4MGD A;  4XT9 A;  3PCU A;  5DRJ A;  2NV7 A;  2LBD A;  1XQ3 A;  1FM9 D;  5FQR A;  4MG9 A;  4RWV A;  4DQM A;  1SJ0 A;  3DCT A;  2Q6R A;  4N1Y A;  5APK A;  4XTA A;  4S14 A;  4J26 A;  1X7J A;  2JFA A;  2QMV A;  3L0L A;  5DKB A;  2GPO A;  5DXG A;  1UOM A;  5AZV A;  3D57 A;  4FN9 A;  3AZ3 A;  1Y0S A;  5E14 A;  1G2N A;  1YUC A;  1T73 A;  2H77 A;  2HAM A;  3OZ0 A;  2ZLA A;  5B5B A;  1UPW A;  1S19 A;  3A2I A;  2IOG A;  3OGT A;  4OIV A;  2POB A;  2Q5S A;  3OMK A;  5DUG A;  3OS9 A;  3WMH A;  4X1G A;  3P0U A;  3OSW A;  2QXS A;  4Q0A C;  4POH A;  2NXX E;  2ZK2 A;  3FUR A;  3UUC A;  4FGY A;  3PO9 A;  1S0X A;  2VV3 A;  4IV4 A;  4OZR E;  3GN8 A;  3SP6 A;  4J5W C;  4OKB A;  4PPP A;  4RUP A;  5JJM A;  5CJ6 A;  4IV2 A;  5DL4 A;  4IUI A;  2PIR A;  5JI0 D;  2GIU A;  3WT6 A;  3RLJ A;  2OVH A;  2QGW A;  5G44 A;  5KD9 A;  4UDA A;  3CQV A;  2QTU A;  4LBD A;  4WVD A;  3CTB A;  1YYE A;  3ADU A;  3WFF A;  5DVC A;  3ZRA A;  1PDU A;  1XLS E;  4NIE A;  3HC5 A;  5AAV B;  4ZNS A;  2GL8 A;  3OLF A;  4RZG A;  3D5F A;  5DV8 A;  3FAL B;  3DCU A;  2JF9 A;  5EGV A;  4TUZ B;  3U9Q A;  5KCU A;  2OVM A;  3FC6 B;  3KDT A;  2J14 A;  4OKT A;  3K23 A;  4TV1 A;  1ZUC A;  2B1Z A;  4MG5 A;  1ZKY A;  5DWJ A;  1R20 A;  5DSH A;  1HG4 A;  1YJE A;  2P15 A;  1RJK A;  2VV1 B;  4REE A;  3LBD A;  4R2U A;  4POJ A;  2J7Y A;  5DVV A;  4IW6 A;  2R40 D;  2PIN A;  5ICK A;  4A2J A;  4XHD A;  4MGB A;  1KKQ A;  1RDT D;  2G0G A;  3H0A A;  4QM0 A;  4YNK A;  5G3J A;  4Q50 A;  2AMA A;  2BAW A;  4FHI A;  5AK2 A;  2QE4 A;  1XPC A;  4LNX A;  4JL4 A;  5KRI A;  5DKG A;  3NOA A;  3KMG A;  2JJ3 A;  4PVU A;  2FSZ A;  5AVL A;  4OJB A;  4WHG A;  1XNX A;  5DZ0 A;  2HB8 A;  3W5R A;  1DKF A;  2Q60 A;  1XAP A;  3R5N A;  1Z5X E;  4MGA B;  5DP0 A;  3W5T A;  3IPQ A;  3L3Z A;  4WQP A;  4PP6 A;  3VRV A;  3ADS A;  1FM6 A;  2BJ4 B;  3HQ5 A;  1L2I A;  4WHF A;  1WM0 X;  2P7Z A;  1XB7 A;  1K7L A;  3E7C A;  4XAO A;  2V7C A;  1UHL B;  1R20 D;  2B1V A;  3IPU A;  5DIG A;  5G43 A;  3VJI A;  1VJB A;  3MNP A;  1FCX A;  2YAT A;  1XVP B;  2ZY0 A;  5DTV A;  3CJW A;  3VRT A;  3FLI A;  5FQS A;  3B67 A;  4OH6 A;  4X1F A;  5JY3 A;  2AA7 A;  4J24 A;  3DZY D;  4N5G A;  2Q70 A;  3H0A D;  3HZF A;  5SYZ A;  4UDB A;  1QKN A;  1XOW A;  2ZKC A;  1OSH A;  3AZ1 A;  1HJ1 A;  4LNW A;  2O4J A;  4Y29 A;  5LWP A;  4OZR U;  5DK9 A;  5FQV A;  2AX9 A;  3KFC A;  5DX3 A;  1X7E A;  2AWH A;  5E0X A;  4O8F A;  3B0T A;  3VJS A;  4CI4 A;  5EHJ A;  4OJ4 A;  5HJP A;  3UU7 A;  1YP0 A;  3VRW A;  5H1E A;  5KCT A;  2Q1H A;  4OLM A;  5DWI A;  2XYW A;  3Q95 B;  3V3Q A;  2P54 A;  3TKM A;  1A52 A;  1MVC A;  3HM1 A;  4KZJ A;  5G45 A;  3IA6 A;  3G8O A;  3OKI A;  3F5C A;  4WLB A;  4F9M A;  1K4W A;  2PRG A;  3W0G A;  5C4S A;  4DMA A;  5I4V A;  2Q59 A;  5KCD A;  4RZF A;  2ACL A;  4NUF A;  3P88 A;  5DMF A;  3L3X A;  4IS8 A;  1FM6 D;  2XYX A;  3O1D A;  3OLL A;  1SKX A;  2YFE A;  4L96 A;  5EI1 A;  3RUT A;  4ZNH A;  5AVI A;  2PKL A;  5HZC A;  1PQC A;  4KZM A;  5DV3 A;  1G5Y A;  2PNU A;  3R2A A;  3UVV A;  2P4Y A;  4MG8 B;  4MGD B;  2ZMH A;  4OIU A;  1NQ1 A;  2QZO A;  5FQT A;  3X31 A;  2XKW A;  1X7B A;  3UUA B;  3KDU A;  1QKT A;  2QW4 A;  4IVY A;  3DZU A;  3VHU A;  4CSJ A;  1I37 A;  4DM8 A;  4RFW A;  3ERT A; 
#chains in the Genus database with same CATH topology
 3OAP A;  3OZJ A;  3G8I A;  4G2H A;  4DM6 A;  2ZK1 A;  5DZ3 A;  2ZNN A;  1P93 A;  3OKH A;  4FNE A;  4JYG A;  4OEY A;  3KWY A;  1XV9 A;  4G1D A;  5DWL A;  1T7M A;  3B3K A;  1NQ0 A;  3AN3 A;  3ADX A;  2I0J A;  2Z4B A;  3X36 A;  5HYR A;  5DMC A;  3RVF A;  3B5R A;  3CWD A;  5E1C A;  2ZK0 A;  1NHZ A;  4PPS A;  4YPQ A;  1RKG A;  2ZNO A;  1T79 A;  3W0C A;  1T7F A;  3IXP A;  4RE8 A;  3VT8 A;  1Z5X U;  1OVL A;  4TUZ A;  3VT6 A;  4MG7 B;  4JYI A;  3UP0 A;  2Q6J A;  3TKC A;  2AXA A;  3V9V A;  1GWR A;  2I0G A;  4JAZ A;  3VSO A;  3B65 A;  2G5O A;  3GD2 A;  3UUD B;  3VJH A;  4ZO1 B;  1LV2 A;  3DZU D;  4UDC A;  3A3Z X;  4M8E A;  3ADT A;  4G2I A;  3CS6 A;  5DXP A;  3R8I A;  3IPS A;  4QJR A;  4RMC A;  2HFP A;  2EWP A;  1T76 A;  3IMY A;  1QKU A;  3VT5 A;  5AZT A;  2Q7L A;  1XP9 A;  2HVC A;  3P8X A;  2PIP L;  3A9E B;  3L0E A;  3PEQ A;  3NSQ A;  4ZN7 A;  2V0V A;  5IZ0 A;  4IU7 A;  3V9T A;  1ZAF A;  4APU A;  2GWX A;  5DXE A;  3X1H A;  1XP6 A;  4K7A A;  2HB7 A;  3HOD A;  4DOS A;  4E2J A;  3SZ1 A;  1PQ9 A;  1R5K A;  4IQR A;  2VV4 B;  1KV6 A;  4N8R A;  3SP9 A;  3AZ2 A;  1R1K A;  4XUM A;  5HJS A;  3K6P A;  3IXP D;  2B50 A;  3KYT A;  3VHV A;  1XZX X;  1I7G A;  1M2Z A;  4ZNV A;  1P8D A;  5DVS A;  2YLP A;  3W5Q A;  4OHA A;  2IHQ A;  3HLV A;  5DXM A;  5LGA A;  5L7G A;  4LTW A;  1NYX A;  4OGH A;  4K6I A;  5DZI A;  4OZT U;  5L7H A;  4OKX A;  3GWX A;  4G1Y A;  1TXI A;  3TX7 B;  3JZC A;  5KCW A;  3OSI A;  1NQ7 A;  5G42 A;  5AAV A;  1NRL A;  2VV0 A;  2ZK6 A;  3FXV A;  5KR9 A;  3RUU A;  3FAL A;  1T65 A;  1MZN A;  2A3I A;  2HWR A;  4S0S A;  1T7R A;  2Q8S A;  2ZNP A;  3JZB A;  2P7G A;  1EXA A;  2QAB A;  2QSE A;  3FC6 A;  1RKH A;  3DY6 A;  4RUJ A;  2QA6 A;  2ZL9 A;  4PXM A;  4RAK A;  1ERE A;  5C4O A;  5KRL A;  3A2J A;  1GS4 A;  2HWQ A;  1L2J A;  1FD0 A;  5GIC A;  1TFC A;  2B23 A;  2ZBS A;  4OJ9 A;  4RZE A;  2OAX A;  5GT4 A;  1N46 A;  3VTD A;  3W0I A;  4A4W A;  1K74 A;  2HCD A;  2VV1 A;  3W0Y A;  1T5Z A;  4XUH A;  2P1V A;  4B7W A;  1YMT A;  2OUZ A;  4OAR A;  1M7W A;  1ZGY A;  2QXM A;  3FEI A;  5AWJ A;  3V4A A;  1IE9 A;  2ZMJ A;  3OMQ A;  4R6S A;  5HYK A;  4WPF A;  4S0T A;  5KRO A;  2AX8 A;  1A28 A;  2XYJ A;  5E15 A;  2NPA A;  2ZK3 A;  4JYH A;  4E4K A;  4J5W A;  3ILZ A;  3B1M A;  2REW A;  1I7I A;  1QKM A;  4PRG A;  1XDK B;  4L98 A;  2AB2 A;  5DZH A;  1IE8 A;  3DR1 A;  3MNE A;  5HJP B;  4YT1 A;  5DYB A;  3P89 A;  3B0W A;  3ET3 A;  1NAX A;  3MNO A;  2GPP A;  4QL8 A;  4IA3 A;  5G5W A;  4MGA A;  3WT7 A;  1X76 A;  5DXR A;  3R8A A;  2ATH A;  2BJ4 A;  2VST A;  3HO0 A;  2PIV A;  3B68 A;  3WTQ A;  4J5X C;  4RME A;  5E7V A;  2HBH A;  2YLO A;  1LBD A;  1UHL A;  3TY0 A;  5DUE A;  3VT4 A;  3PLZ A;  2I4P A;  5KRA A;  5DY8 A;  2Q7J A;  1K74 D;  5DXB B;  5IAW A;  5A86 A;  1XVP A;  2Q5P A;  1H9U A;  4ONI A;  2ZXM A;  4EMA A;  2POG A;  1E3G A;  2Z4J A;  5KYJ A;  1T63 A;  1U3Q A;  4G20 A;  4G1Z A;  4S15 A;  5KRF A;  4OFR A;  3R29 A;  2ABI A;  4NQA B;  4ZN9 A;  3G0W A;  3H52 A;  3FEJ A;  1U3R A;  2H79 A;  2HAS A;  1ZEO A;  4QE6 A;  1NDE A;  4MG9 B;  3CS4 A;  3K22 A;  3RLL A;  2GPU A;  3WJ5 A;  2AX7 A;  4ZNU A;  5DV6 A;  5F9B A;  2OM9 A;  2JFA B;  3GYT A;  4BCR A;  4XI3 A;  4OK1 A;  5G46 A;  5ACC A;  3WFG A;  2QA8 A;  3CDS A;  2YJA B;  3R5M A;  2Q6S A;  2ZXZ A;  3WWR A;  3S9S A;  4LSJ A;  3BEJ A;  3OSA A;  2PIQ A;  5DID A;  2NW4 A;  3KMR A;  1YOK A;  4N73 A;  4YMQ A;  3X1I A;  5L11 A;  2G44 A;  3EYB A;  2Q3Y A;  2W8Y A;  2ZVT A;  4PP3 A;  1Q4X A;  2ZMI A;  4PP5 A;  5KYA A;  3VHW A;  1ZDT A;  3V3E A;  3W0J A;  2YLQ A;  5GIE A;  3UUA A;  3N00 A;  2QPY A;  1SR7 A;  5KCF A;  2PIW A;  3E00 A;  3T03 A;  1YA3 A;  4OED A;  3KPZ A;  2Q5G A;  3BQD A;  3D24 A;  5JJM B;  5DXQ A;  4DOR A;  1NAV A;  4K4J A;  3ZQT A;  3WT5 A;  1YOW A;  5B41 A;  5C4U A;  3QT0 A;  4IW8 A;  3F7D A;  3W0H A;  3OOK A;  3A40 X;  2XHS A;  3KBA A;  1PCG A;  3D6D A;  3L1B A;  3UP3 A;  2I4Z A;  2P1T A;  4ZJW A;  2GP7 A;  2YHD A;  3OMP A;  2AO6 A;  1ZDU A;  5DRM A;  4PLD A;  1T7T A;  2VV2 A;  1ERR A;  3GZ9 A;  3HVL A;  3OS8 C;  5APH A;  5ETH A;  2AM9 A;  5HCV A;  4J5X A;  4REF A;  3K8S A;  4MG7 A;  1MV9 A;  4IWC A;  4OEZ A;  2OCF A;  3DT3 A;  3FS1 A;  2R40 A;  2ZAS A;  4TV1 B;  4IA7 A;  1GWX A;  2G0H A;  2R6Y A;  4EM9 A;  4IA2 A;  1RDT A;  5EIT A;  3A2H A;  2PIO A;  3UUD A;  1ILH A;  4MDD A;  2QH6 A;  3AUN A;  2YLY A;  3E00 D;  3M7R A;  4MGC A;  5DYD A;  5E19 A;  4ZJR A;  3LMP A;  5KRM A;  4CI5 A;  2IOK A;  1N83 A;  2FAI A;  4MGB B;  2Q7K A;  1BSX A;  2AAX A;  3L0J A;  4HEE X;  4E4Q A;  1YIN A;  3VTC A;  4M8H A;  1S9Q A;  5DKE A;  3B0Q A;  2AA5 A;  2Q61 A;  3ET1 A;  3R8D A;  5KRC A;  3A9E A;  2J7X A;  3AUQ A;  2ZNQ A;  1XP1 A;  4QE8 A;  3ET0 A;  2AX6 A;  1G1U A;  5DZ1 A;  5APJ A;  5AYG A;  3ADW A;  3CLD A;  3CS8 A;  4R06 A;  3VN2 A;  2AYR A;  3WJ4 A;  2VV4 A;  2Q1V A;  3KMZ A;  2AA6 A;  5DLR A;  1OSV A;  5AAU A;  1GWQ A;  4JGV A;  5M96 A;  2OZ7 A;  3GWS X;  1DKF B;  5DWG A;  3NSP A;  3O1E A;  1G50 A;  4RUO X;  1KNU A;  4PF3 A;  1T74 A;  2PJL A;  2ZK5 A;  4OKW A;  1RK3 A;  5DIE A;  5K13 A;  3D90 A;  4ZO1 X;  3AN4 A;  3HC6 A;  3VI8 A;  1FCY A;  1N4H A;  2HAR A;  1R1K D;  3DZY A;  5KRH A;  1U9E A;  3ADV A;  1XQC A;  2YJD A;  3B0R A;  2VSR A;  4OH5 A;  4ZNT A;  5DXK A;  4IVW A;  4OEA A;  5AWK A;  5DI7 A;  4PLE A;  2Q7I A;  5DUH A;  5E0W A;  3AFR A;  1ILG A;  1FBY A;  1FCZ A;  4ZOM A;  5FQP A;  1PRG A;  3OOF A;  3W5P A;  2ZLC A;  1U3S A;  5DX3 B;  5KCC A;  1DB1 A;  5DKS A;  2I4J A;  4PWL A;  4HLW A;  3UU7 B;  1NQ2 A;  1ZH7 A;  2ZFX A;  1Y0X X;  1EXX A;  1YY4 A;  2FVJ A;  2GPV A;  3E94 A;  3OS8 A;  5EC9 A;  4XLD A;  2QGT A;  3AUR A;  3F5C B;  2E2R A;  3GYU A;  3AX8 A;  3ZRB A;  3ZR7 A;  4NB6 A;  2Q59 B;  1YIM A;  1X78 A;  3V49 A;  2ACL B;  5DU5 A;  3GBK A;  3ERD A;  3VTB A;  4MG6 A;  3B66 A;  1XJ7 A;  3VT9 A;  3VT3 A;  1PZL A;  3WGP A;  3G9E A;  3VJT A;  3VRU A;  4A4V A;  1FM9 A;  2R6W A;  4ZNW A;  2HC4 A;  1OT7 A;  1X7R A;  1XDK A;  3UVV B;  1PQ6 A;  4OIL A;  1I38 A;  2PIU A;  3OMM A;  5KRJ A;  4FHH A;  2QZO B;  5KRK A;  4RMD A;  1XNN A;  5L7E A;  1Z95 A;  5GID A;  2P7A A;  2GTK A;  3A78 A;  3W0A A;  4DK8 A;  5EJV A;  1E3K A;  3OLS A;  3RY9 A;  5IXK A;  2NXX A;  2F4B A;  3Q95 A;  5KCE A;  4ITF A;  4DK7 A;  1XIU A;  3PBA A;  2QNV A;  1M13 A;  2QA8 B;  2O9I A;  2ZXN A;  4KZI A;  3VT7 A;  3BC5 A;  2QR9 A;  2ZK4 A;  3L03 A;  4P6X A;  4UDD A;  4QK4 A;  3ET2 A;  3VSP A;  2PIT A;  1S0Z A;  3V9Y A;  4ZI1 A;  4G21 A;  1XV9 B;  2P1U A;  4ITE A;  1Y9R A;  4P6W A;  4Q13 A;  5DXB A;  1S9P A;  3FUG A;  3PRG A;  4IA1 A;  1NUO A;  1R6G A;  5C4T A;  4OFU A;  2J4A A;  4NY9 A;  2PIX A;  3CDP A;  5DWE A;  2O4R A;  1UPV A;  4OZT E;  1XLS A;  2AMB A;  3OMO A;  1SQN A;  4IWF A;  4OC7 A;  2AA2 A;  4MG8 A;  1OVL B;  1PK5 A;  4MGD A;  4XT9 A;  3PCU A;  5DRJ A;  2NV7 A;  2LBD A;  1XQ3 A;  1FM9 D;  5FQR A;  4MG9 A;  4RWV A;  4DQM A;  1SJ0 A;  3DCT A;  2Q6R A;  4N1Y A;  5APK A;  4XTA A;  4S14 A;  4J26 A;  1X7J A;  2JFA A;  2QMV A;  3L0L A;  5DKB A;  2GPO A;  5DXG A;  1UOM A;  5AZV A;  3D57 A;  4FN9 A;  3AZ3 A;  1Y0S A;  5E14 A;  1G2N A;  1YUC A;  1T73 A;  2H77 A;  2HAM A;  3OZ0 A;  2ZLA A;  5B5B A;  1UPW A;  1S19 A;  3A2I A;  2IOG A;  3OGT A;  4OIV A;  2POB A;  2Q5S A;  3OMK A;  5DUG A;  3OS9 A;  3WMH A;  4X1G A;  3P0U A;  3OSW A;  2QXS A;  4Q0A C;  4POH A;  2NXX E;  2ZK2 A;  3FUR A;  3UUC A;  4FGY A;  3PO9 A;  1S0X A;  2VV3 A;  4IV4 A;  4OZR E;  3GN8 A;  3SP6 A;  4J5W C;  4OKB A;  4PPP A;  4RUP A;  5JJM A;  5CJ6 A;  4IV2 A;  5DL4 A;  4IUI A;  2PIR A;  5JI0 D;  2GIU A;  3WT6 A;  3RLJ A;  2OVH A;  2QGW A;  5G44 A;  5KD9 A;  4UDA A;  3CQV A;  2QTU A;  4LBD A;  4WVD A;  3CTB A;  1YYE A;  3ADU A;  3WFF A;  5DVC A;  3ZRA A;  1PDU A;  1XLS E;  4NIE A;  3HC5 A;  5AAV B;  4ZNS A;  2GL8 A;  3OLF A;  4RZG A;  3D5F A;  5DV8 A;  3FAL B;  3DCU A;  2JF9 A;  5EGV A;  4TUZ B;  3U9Q A;  5KCU A;  2OVM A;  3FC6 B;  3KDT A;  2J14 A;  4OKT A;  3K23 A;  4TV1 A;  1ZUC A;  2B1Z A;  4MG5 A;  1ZKY A;  5DWJ A;  1R20 A;  5DSH A;  1HG4 A;  1YJE A;  2P15 A;  1RJK A;  2VV1 B;  4REE A;  3LBD A;  4R2U A;  4POJ A;  2J7Y A;  5DVV A;  4IW6 A;  2R40 D;  2PIN A;  5ICK A;  4A2J A;  4XHD A;  4MGB A;  1KKQ A;  1RDT D;  2G0G A;  3H0A A;  4QM0 A;  4YNK A;  5G3J A;  4Q50 A;  2AMA A;  2BAW A;  4FHI A;  5AK2 A;  2QE4 A;  1XPC A;  4LNX A;  4JL4 A;  5KRI A;  5DKG A;  3NOA A;  3KMG A;  2JJ3 A;  4PVU A;  2FSZ A;  5AVL A;  4OJB A;  4WHG A;  1XNX A;  5DZ0 A;  2HB8 A;  3W5R A;  1DKF A;  2Q60 A;  1XAP A;  3R5N A;  1Z5X E;  4MGA B;  5DP0 A;  3W5T A;  3IPQ A;  3L3Z A;  4WQP A;  4PP6 A;  3VRV A;  3ADS A;  1FM6 A;  2BJ4 B;  3HQ5 A;  1L2I A;  4WHF A;  1WM0 X;  2P7Z A;  1XB7 A;  1K7L A;  3E7C A;  4XAO A;  2V7C A;  1UHL B;  1R20 D;  2B1V A;  3IPU A;  5DIG A;  5G43 A;  3VJI A;  1VJB A;  3MNP A;  1FCX A;  2YAT A;  1XVP B;  2ZY0 A;  5DTV A;  3CJW A;  3VRT A;  3FLI A;  5FQS A;  3B67 A;  4OH6 A;  4X1F A;  5JY3 A;  2AA7 A;  4J24 A;  3DZY D;  4N5G A;  2Q70 A;  3H0A D;  3HZF A;  5SYZ A;  4UDB A;  1QKN A;  1XOW A;  2ZKC A;  1OSH A;  3AZ1 A;  1HJ1 A;  4LNW A;  2O4J A;  4Y29 A;  5LWP A;  4OZR U;  5DK9 A;  5FQV A;  2AX9 A;  3KFC A;  5DX3 A;  1X7E A;  2AWH A;  5E0X A;  4O8F A;  3B0T A;  3VJS A;  4CI4 A;  5EHJ A;  4OJ4 A;  5HJP A;  3UU7 A;  1YP0 A;  3VRW A;  5H1E A;  5KCT A;  2Q1H A;  4OLM A;  5DWI A;  2XYW A;  3Q95 B;  3V3Q A;  2P54 A;  3TKM A;  1A52 A;  1MVC A;  3HM1 A;  4KZJ A;  5G45 A;  3IA6 A;  3G8O A;  3OKI A;  3F5C A;  4WLB A;  4F9M A;  1K4W A;  2PRG A;  3W0G A;  5C4S A;  4DMA A;  5I4V A;  2Q59 A;  5KCD A;  4RZF A;  2ACL A;  4NUF A;  3P88 A;  5DMF A;  3L3X A;  4IS8 A;  1FM6 D;  2XYX A;  3O1D A;  3OLL A;  1SKX A;  2YFE A;  4L96 A;  5EI1 A;  3RUT A;  4ZNH A;  5AVI A;  2PKL A;  5HZC A;  1PQC A;  4KZM A;  5DV3 A;  1G5Y A;  2PNU A;  3R2A A;  3UVV A;  2P4Y A;  4MG8 B;  4MGD B;  2ZMH A;  4OIU A;  1NQ1 A;  2QZO A;  5FQT A;  3X31 A;  2XKW A;  1X7B A;  3UUA B;  3KDU A;  1QKT A;  2QW4 A;  4IVY A;  3DZU A;  3VHU A;  4CSJ A;  1I37 A;  4DM8 A;  4RFW A;  3ERT A; 
#chains in the Genus database with same CATH homology
 3OAP A;  3OZJ A;  3G8I A;  4G2H A;  4DM6 A;  2ZK1 A;  5DZ3 A;  2ZNN A;  1P93 A;  3OKH A;  4FNE A;  4JYG A;  4OEY A;  3KWY A;  1XV9 A;  4G1D A;  5DWL A;  1T7M A;  3B3K A;  1NQ0 A;  3AN3 A;  3ADX A;  2I0J A;  2Z4B A;  3X36 A;  5HYR A;  5DMC A;  3RVF A;  3B5R A;  3CWD A;  5E1C A;  2ZK0 A;  1NHZ A;  4PPS A;  4YPQ A;  1RKG A;  2ZNO A;  1T79 A;  3W0C A;  1T7F A;  3IXP A;  4RE8 A;  3VT8 A;  1Z5X U;  1OVL A;  4TUZ A;  3VT6 A;  4MG7 B;  4JYI A;  3UP0 A;  2Q6J A;  3TKC A;  2AXA A;  3V9V A;  1GWR A;  2I0G A;  4JAZ A;  3VSO A;  3B65 A;  2G5O A;  3GD2 A;  3UUD B;  3VJH A;  4ZO1 B;  1LV2 A;  3DZU D;  4UDC A;  3A3Z X;  4M8E A;  3ADT A;  4G2I A;  3CS6 A;  5DXP A;  3R8I A;  3IPS A;  4QJR A;  4RMC A;  2HFP A;  2EWP A;  1T76 A;  3IMY A;  1QKU A;  3VT5 A;  5AZT A;  2Q7L A;  1XP9 A;  2HVC A;  3P8X A;  2PIP L;  3A9E B;  3L0E A;  3PEQ A;  3NSQ A;  4ZN7 A;  2V0V A;  5IZ0 A;  4IU7 A;  3V9T A;  1ZAF A;  4APU A;  2GWX A;  5DXE A;  3X1H A;  1XP6 A;  4K7A A;  2HB7 A;  3HOD A;  4DOS A;  4E2J A;  3SZ1 A;  1PQ9 A;  1R5K A;  4IQR A;  2VV4 B;  1KV6 A;  4N8R A;  3SP9 A;  3AZ2 A;  1R1K A;  4XUM A;  5HJS A;  3K6P A;  3IXP D;  2B50 A;  3KYT A;  3VHV A;  1XZX X;  1I7G A;  1M2Z A;  4ZNV A;  1P8D A;  5DVS A;  2YLP A;  3W5Q A;  4OHA A;  2IHQ A;  3HLV A;  5DXM A;  5LGA A;  5L7G A;  4LTW A;  1NYX A;  4OGH A;  4K6I A;  5DZI A;  4OZT U;  5L7H A;  4OKX A;  3GWX A;  4G1Y A;  1TXI A;  3TX7 B;  3JZC A;  5KCW A;  3OSI A;  1NQ7 A;  5G42 A;  5AAV A;  1NRL A;  2VV0 A;  2ZK6 A;  3FXV A;  5KR9 A;  3RUU A;  3FAL A;  1T65 A;  1MZN A;  2A3I A;  2HWR A;  4S0S A;  1T7R A;  2Q8S A;  2ZNP A;  3JZB A;  2P7G A;  1EXA A;  2QAB A;  2QSE A;  3FC6 A;  1RKH A;  3DY6 A;  4RUJ A;  2QA6 A;  2ZL9 A;  4PXM A;  4RAK A;  1ERE A;  5C4O A;  5KRL A;  3A2J A;  1GS4 A;  2HWQ A;  1L2J A;  1FD0 A;  5GIC A;  1TFC A;  2B23 A;  2ZBS A;  4OJ9 A;  4RZE A;  2OAX A;  5GT4 A;  1N46 A;  3VTD A;  3W0I A;  4A4W A;  1K74 A;  2HCD A;  2VV1 A;  3W0Y A;  1T5Z A;  4XUH A;  2P1V A;  4B7W A;  1YMT A;  2OUZ A;  4OAR A;  1M7W A;  1ZGY A;  2QXM A;  3FEI A;  5AWJ A;  3V4A A;  1IE9 A;  2ZMJ A;  3OMQ A;  4R6S A;  5HYK A;  4WPF A;  4S0T A;  5KRO A;  2AX8 A;  1A28 A;  2XYJ A;  5E15 A;  2NPA A;  2ZK3 A;  4JYH A;  4E4K A;  4J5W A;  3ILZ A;  3B1M A;  2REW A;  1I7I A;  1QKM A;  4PRG A;  1XDK B;  4L98 A;  2AB2 A;  5DZH A;  1IE8 A;  3DR1 A;  3MNE A;  5HJP B;  4YT1 A;  5DYB A;  3P89 A;  3B0W A;  3ET3 A;  1NAX A;  3MNO A;  2GPP A;  4QL8 A;  4IA3 A;  5G5W A;  4MGA A;  3WT7 A;  1X76 A;  5DXR A;  3R8A A;  2ATH A;  2BJ4 A;  2VST A;  3HO0 A;  2PIV A;  3B68 A;  3WTQ A;  4J5X C;  4RME A;  5E7V A;  2HBH A;  2YLO A;  1LBD A;  1UHL A;  3TY0 A;  5DUE A;  3VT4 A;  3PLZ A;  2I4P A;  5KRA A;  5DY8 A;  2Q7J A;  1K74 D;  5DXB B;  5IAW A;  5A86 A;  1XVP A;  2Q5P A;  1H9U A;  4ONI A;  2ZXM A;  4EMA A;  2POG A;  1E3G A;  2Z4J A;  5KYJ A;  1T63 A;  1U3Q A;  4G20 A;  4G1Z A;  4S15 A;  5KRF A;  4OFR A;  3R29 A;  2ABI A;  4NQA B;  4ZN9 A;  3G0W A;  3H52 A;  3FEJ A;  1U3R A;  2H79 A;  2HAS A;  1ZEO A;  4QE6 A;  1NDE A;  4MG9 B;  3CS4 A;  3K22 A;  3RLL A;  2GPU A;  3WJ5 A;  2AX7 A;  4ZNU A;  5DV6 A;  5F9B A;  2OM9 A;  2JFA B;  3GYT A;  4BCR A;  4XI3 A;  4OK1 A;  5G46 A;  5ACC A;  3WFG A;  2QA8 A;  3CDS A;  2YJA B;  3R5M A;  2Q6S A;  2ZXZ A;  3WWR A;  3S9S A;  4LSJ A;  3BEJ A;  3OSA A;  2PIQ A;  5DID A;  2NW4 A;  3KMR A;  1YOK A;  4N73 A;  4YMQ A;  3X1I A;  5L11 A;  2G44 A;  3EYB A;  2Q3Y A;  2W8Y A;  2ZVT A;  4PP3 A;  1Q4X A;  2ZMI A;  4PP5 A;  5KYA A;  3VHW A;  1ZDT A;  3V3E A;  3W0J A;  2YLQ A;  5GIE A;  3UUA A;  3N00 A;  2QPY A;  1SR7 A;  5KCF A;  2PIW A;  3E00 A;  3T03 A;  1YA3 A;  4OED A;  3KPZ A;  2Q5G A;  3BQD A;  3D24 A;  5JJM B;  5DXQ A;  4DOR A;  1NAV A;  4K4J A;  3ZQT A;  3WT5 A;  1YOW A;  5B41 A;  5C4U A;  3QT0 A;  4IW8 A;  3F7D A;  3W0H A;  3OOK A;  3A40 X;  2XHS A;  3KBA A;  1PCG A;  3D6D A;  3L1B A;  3UP3 A;  2I4Z A;  2P1T A;  4ZJW A;  2GP7 A;  2YHD A;  3OMP A;  2AO6 A;  1ZDU A;  5DRM A;  4PLD A;  1T7T A;  2VV2 A;  1ERR A;  3GZ9 A;  3HVL A;  3OS8 C;  5APH A;  5ETH A;  2AM9 A;  5HCV A;  4J5X A;  4REF A;  3K8S A;  4MG7 A;  1MV9 A;  4IWC A;  4OEZ A;  2OCF A;  3DT3 A;  3FS1 A;  2R40 A;  2ZAS A;  4TV1 B;  4IA7 A;  1GWX A;  2G0H A;  2R6Y A;  4EM9 A;  4IA2 A;  1RDT A;  5EIT A;  3A2H A;  2PIO A;  3UUD A;  1ILH A;  4MDD A;  2QH6 A;  3AUN A;  2YLY A;  3E00 D;  3M7R A;  4MGC A;  5DYD A;  5E19 A;  4ZJR A;  3LMP A;  5KRM A;  4CI5 A;  2IOK A;  1N83 A;  2FAI A;  4MGB B;  2Q7K A;  1BSX A;  2AAX A;  3L0J A;  4HEE X;  4E4Q A;  1YIN A;  3VTC A;  4M8H A;  1S9Q A;  5DKE A;  3B0Q A;  2AA5 A;  2Q61 A;  3ET1 A;  3R8D A;  5KRC A;  3A9E A;  2J7X A;  3AUQ A;  2ZNQ A;  1XP1 A;  4QE8 A;  3ET0 A;  2AX6 A;  1G1U A;  5DZ1 A;  5APJ A;  5AYG A;  3ADW A;  3CLD A;  3CS8 A;  4R06 A;  3VN2 A;  2AYR A;  3WJ4 A;  2VV4 A;  2Q1V A;  3KMZ A;  2AA6 A;  5DLR A;  1OSV A;  5AAU A;  1GWQ A;  4JGV A;  5M96 A;  2OZ7 A;  3GWS X;  1DKF B;  5DWG A;  3NSP A;  3O1E A;  1G50 A;  4RUO X;  1KNU A;  4PF3 A;  1T74 A;  2PJL A;  2ZK5 A;  4OKW A;  1RK3 A;  5DIE A;  5K13 A;  3D90 A;  4ZO1 X;  3AN4 A;  3HC6 A;  3VI8 A;  1FCY A;  1N4H A;  2HAR A;  1R1K D;  3DZY A;  5KRH A;  1U9E A;  3ADV A;  1XQC A;  2YJD A;  3B0R A;  2VSR A;  4OH5 A;  4ZNT A;  5DXK A;  4IVW A;  4OEA A;  5AWK A;  5DI7 A;  4PLE A;  2Q7I A;  5DUH A;  5E0W A;  3AFR A;  1ILG A;  1FBY A;  1FCZ A;  4ZOM A;  5FQP A;  1PRG A;  3OOF A;  3W5P A;  2ZLC A;  1U3S A;  5DX3 B;  5KCC A;  1DB1 A;  5DKS A;  2I4J A;  4PWL A;  4HLW A;  3UU7 B;  1NQ2 A;  1ZH7 A;  2ZFX A;  1Y0X X;  1EXX A;  1YY4 A;  2FVJ A;  2GPV A;  3E94 A;  3OS8 A;  5EC9 A;  4XLD A;  2QGT A;  3AUR A;  3F5C B;  2E2R A;  3GYU A;  3AX8 A;  3ZRB A;  3ZR7 A;  4NB6 A;  2Q59 B;  1YIM A;  1X78 A;  3V49 A;  2ACL B;  5DU5 A;  3GBK A;  3ERD A;  3VTB A;  4MG6 A;  3B66 A;  1XJ7 A;  3VT9 A;  3VT3 A;  1PZL A;  3WGP A;  3G9E A;  3VJT A;  3VRU A;  4A4V A;  1FM9 A;  2R6W A;  4ZNW A;  2HC4 A;  1OT7 A;  1X7R A;  1XDK A;  3UVV B;  1PQ6 A;  4OIL A;  1I38 A;  2PIU A;  3OMM A;  5KRJ A;  4FHH A;  2QZO B;  5KRK A;  4RMD A;  1XNN A;  5L7E A;  1Z95 A;  5GID A;  2P7A A;  2GTK A;  3A78 A;  3W0A A;  4DK8 A;  5EJV A;  1E3K A;  3OLS A;  3RY9 A;  5IXK A;  2NXX A;  2F4B A;  3Q95 A;  5KCE A;  4ITF A;  4DK7 A;  1XIU A;  3PBA A;  2QNV A;  1M13 A;  2QA8 B;  2O9I A;  2ZXN A;  4KZI A;  3VT7 A;  3BC5 A;  2QR9 A;  2ZK4 A;  3L03 A;  4P6X A;  4UDD A;  4QK4 A;  3ET2 A;  3VSP A;  2PIT A;  1S0Z A;  3V9Y A;  4ZI1 A;  4G21 A;  1XV9 B;  2P1U A;  4ITE A;  1Y9R A;  4P6W A;  4Q13 A;  5DXB A;  1S9P A;  3FUG A;  3PRG A;  4IA1 A;  1NUO A;  1R6G A;  5C4T A;  4OFU A;  2J4A A;  4NY9 A;  2PIX A;  3CDP A;  5DWE A;  2O4R A;  1UPV A;  4OZT E;  1XLS A;  2AMB A;  3OMO A;  1SQN A;  4IWF A;  4OC7 A;  2AA2 A;  4MG8 A;  1OVL B;  1PK5 A;  4MGD A;  4XT9 A;  3PCU A;  5DRJ A;  2NV7 A;  2LBD A;  1XQ3 A;  1FM9 D;  5FQR A;  4MG9 A;  4RWV A;  4DQM A;  1SJ0 A;  3DCT A;  2Q6R A;  4N1Y A;  5APK A;  4XTA A;  4S14 A;  4J26 A;  1X7J A;  2JFA A;  2QMV A;  3L0L A;  5DKB A;  2GPO A;  5DXG A;  1UOM A;  5AZV A;  3D57 A;  4FN9 A;  3AZ3 A;  1Y0S A;  5E14 A;  1G2N A;  1YUC A;  1T73 A;  2H77 A;  2HAM A;  3OZ0 A;  2ZLA A;  5B5B A;  1UPW A;  1S19 A;  3A2I A;  2IOG A;  3OGT A;  4OIV A;  2POB A;  2Q5S A;  3OMK A;  5DUG A;  3OS9 A;  3WMH A;  4X1G A;  3P0U A;  3OSW A;  2QXS A;  4Q0A C;  4POH A;  2NXX E;  2ZK2 A;  3FUR A;  3UUC A;  4FGY A;  3PO9 A;  1S0X A;  2VV3 A;  4IV4 A;  4OZR E;  3GN8 A;  3SP6 A;  4J5W C;  4OKB A;  4PPP A;  4RUP A;  5JJM A;  5CJ6 A;  4IV2 A;  5DL4 A;  4IUI A;  2PIR A;  5JI0 D;  2GIU A;  3WT6 A;  3RLJ A;  2OVH A;  2QGW A;  5G44 A;  5KD9 A;  4UDA A;  3CQV A;  2QTU A;  4LBD A;  4WVD A;  3CTB A;  1YYE A;  3ADU A;  3WFF A;  5DVC A;  3ZRA A;  1PDU A;  1XLS E;  4NIE A;  3HC5 A;  5AAV B;  4ZNS A;  2GL8 A;  3OLF A;  4RZG A;  3D5F A;  5DV8 A;  3FAL B;  3DCU A;  2JF9 A;  5EGV A;  4TUZ B;  3U9Q A;  5KCU A;  2OVM A;  3FC6 B;  3KDT A;  2J14 A;  4OKT A;  3K23 A;  4TV1 A;  1ZUC A;  2B1Z A;  4MG5 A;  1ZKY A;  5DWJ A;  1R20 A;  5DSH A;  1HG4 A;  1YJE A;  2P15 A;  1RJK A;  2VV1 B;  4REE A;  3LBD A;  4R2U A;  4POJ A;  2J7Y A;  5DVV A;  4IW6 A;  2R40 D;  2PIN A;  5ICK A;  4A2J A;  4XHD A;  4MGB A;  1KKQ A;  1RDT D;  2G0G A;  3H0A A;  4QM0 A;  4YNK A;  5G3J A;  4Q50 A;  2AMA A;  2BAW A;  4FHI A;  5AK2 A;  2QE4 A;  1XPC A;  4LNX A;  4JL4 A;  5KRI A;  5DKG A;  3NOA A;  3KMG A;  2JJ3 A;  4PVU A;  2FSZ A;  5AVL A;  4OJB A;  4WHG A;  1XNX A;  5DZ0 A;  2HB8 A;  3W5R A;  1DKF A;  2Q60 A;  1XAP A;  3R5N A;  1Z5X E;  4MGA B;  5DP0 A;  3W5T A;  3IPQ A;  3L3Z A;  4WQP A;  4PP6 A;  3VRV A;  3ADS A;  1FM6 A;  2BJ4 B;  3HQ5 A;  1L2I A;  4WHF A;  1WM0 X;  2P7Z A;  1XB7 A;  1K7L A;  3E7C A;  4XAO A;  2V7C A;  1UHL B;  1R20 D;  2B1V A;  3IPU A;  5DIG A;  5G43 A;  3VJI A;  1VJB A;  3MNP A;  1FCX A;  2YAT A;  1XVP B;  2ZY0 A;  5DTV A;  3CJW A;  3VRT A;  3FLI A;  5FQS A;  3B67 A;  4OH6 A;  4X1F A;  5JY3 A;  2AA7 A;  4J24 A;  3DZY D;  4N5G A;  2Q70 A;  3H0A D;  3HZF A;  5SYZ A;  4UDB A;  1QKN A;  1XOW A;  2ZKC A;  1OSH A;  3AZ1 A;  1HJ1 A;  4LNW A;  2O4J A;  4Y29 A;  5LWP A;  4OZR U;  5DK9 A;  5FQV A;  2AX9 A;  3KFC A;  5DX3 A;  1X7E A;  2AWH A;  5E0X A;  4O8F A;  3B0T A;  3VJS A;  4CI4 A;  5EHJ A;  4OJ4 A;  5HJP A;  3UU7 A;  1YP0 A;  3VRW A;  5H1E A;  5KCT A;  2Q1H A;  4OLM A;  5DWI A;  2XYW A;  3Q95 B;  3V3Q A;  2P54 A;  3TKM A;  1A52 A;  1MVC A;  3HM1 A;  4KZJ A;  5G45 A;  3IA6 A;  3G8O A;  3OKI A;  3F5C A;  4WLB A;  4F9M A;  1K4W A;  2PRG A;  3W0G A;  5C4S A;  4DMA A;  5I4V A;  2Q59 A;  5KCD A;  4RZF A;  2ACL A;  4NUF A;  3P88 A;  5DMF A;  3L3X A;  4IS8 A;  1FM6 D;  2XYX A;  3O1D A;  3OLL A;  1SKX A;  2YFE A;  4L96 A;  5EI1 A;  3RUT A;  4ZNH A;  5AVI A;  2PKL A;  5HZC A;  1PQC A;  4KZM A;  5DV3 A;  1G5Y A;  2PNU A;  3R2A A;  3UVV A;  2P4Y A;  4MG8 B;  4MGD B;  2ZMH A;  4OIU A;  1NQ1 A;  2QZO A;  5FQT A;  3X31 A;  2XKW A;  1X7B A;  3UUA B;  3KDU A;  1QKT A;  2QW4 A;  4IVY A;  3DZU A;  3VHU A;  4CSJ A;  1I37 A;  4DM8 A;  4RFW A;  3ERT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...