4IA1A

Diastereotopic and deuterium effects in gemini
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
299
structure length
239
Chain Sequence
HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVRRLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGHTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPGVQDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diastereotopic and deuterium effects in gemini.
pubmed doi rcsb
molecule keywords Vitamin D3 receptor A
molecule tags Transcription/transcription activator
source organism Danio rerio
total genus 95
structure length 239
sequence length 299
ec nomenclature
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4ia1A00
4UDDA 5DYDA 5EGVA 5M96A 2POGA 1N46A 1NYXA 3ZRAA 5KCEA 4JYGA 4J5XA 4K4JA 3GYUA 5GIDA 2ACLA 5B5BA 2VSTA 5ICKA 2AYRA 4LTWA 3K23A 2AAXA 3CWDA 3UU7B 2QZOB 5KCWA 5AVIA 3UUAB 3W0CA 2AXAA 1PDUA 1I38A 1NHZA 3H52A 1X78A 1FCZA 3L3ZA 2B1ZA 3R8IA 5DWEA 3VT7A 3GD2A 4OZTE 3DZYD 3DT3A 3SP6A 5HJSA 2XYJA 2R40A 5APHA 4PP5A 3HQ5A 1PQCA 4OH6A 2P1TA 1FCXA 3DCUA 1GWQA 4UDBA 2ZL9A 3ET3A 5DXEA 4IA1A 5L11A 3D90A 3RUUA 1YA3A 4G20A 5DXMA 1MV9A 3AN4A 3WTQA 1I37A 3PLZA 5DP0A 3G0WA 1R5KA 2A3IA 4LNXA 2ZK1A 1M2ZA 3B0WA 4X1FA 4XLDA 3KBAA 5KCFA 3UU7A 4YT1A 2ZY0A 2NXXE 3ET2A 1ZAFA 4OK1A 2AB2A 1TXIA 2NV7A 4M8EA 4A4VA 1K4WA 3EYBA 5DV3A 3A2HA 3UP0A 5DMFA 3R8DA 2YLOA 4ZJWA 1MVCA 2GL8A 3A2JA 3HO0A 4IWFA 3CS4A 4OEAA 3LMPA 4Y29A 3TKMA 4S15A 5DLRA 4G2IA 2VV4B 2REWA 1G5YA 4R06A 4WHFA 4XUMA 5G3JA 3W0JA 4ZNTA 5B41A 2YLPA 1Y9RA 3WT5A 1UOMA 2GPOA 4QK4A 2QPYA 2I4JA 3TY0A 4MDDA 4IVWA 4HLWA 4MG6A 5KCDA 2GPUA 2ZVTA 1YINA 5DIGA 2O9IA 5KYJA 4TUZB 3VT5A 2VV0A 4XUHA 2AA6A 4OZRE 2R6YA 3OOFA 4ONIA 1NUOA 1R20A 2B50A 3FURA 5AYGA 3TX7B 1M7WA 3WT6A 4PWLA 4ZO1B 1TFCA 3E7CA 3IMYA 4Q13A 4XHDA 3HM1A 5DMCA 4ZNUA 4OJ4A 2I4PA 3GN8A 3B65A 2HCDA 1XQCA 5K13A 2AMBA 4CSJA 3B68A 3IA6A 3QT0A 1N83A 2VV4A 5APJA 3VTDA 2OZ7A 2FVJA 4EMAA 3L0LA 5DXPA 1PQ6A 1SR7A 3ADWA 4QE6A 2AA7A 2R40D 4MG7A 4TUZA 3KDUA 1T74A 3KFCA 1S9QA 4PLEA 5ETHA 4G1DA 1RKHA 3CDPA 4DM6A 3P89A 5KRKA 1DB1A 3O1DA 1K7LA 2YLYA 1K74A 1GWXA 5FQPA 3S9SA 1PK5A 2I0JA 2QMVA 2ZK2A 2ZXMA 4G21A 4OKXA 4RWVA 4XT9A 1UPVA 1S9PA 2OM9A 5DXGA 1I7GA 5G46A 4MGCA 3OKIA 1R1KA 3VT3A 2ZXZA 5AAVA 2AX9A 5KRFA 2F4BA 1FCYA 1QKNA 3FC6A 2NW4A 1P8DA 5DXRA 1X7BA 3VTCA 1I7IA 3VRTA 2PIOA 1RKGA 3RLJA 5LWPA 5G44A 1X7RA 2BJ4B 2HVCA 1UHLB 4P6XA 1KV6A 5DWGA 5DZ3A 1XQ3A 3L3XA 2YFEA 3AZ1A 4IV2A 4MGBA 3B0TA 4LSJA 4TV1A 3WMHA 3WWRA 5KR9A 3HVLA 1ZEOA 2BAWA 4UDCA 1ZUCA 1NDEA 4IUIA 4HEEX 2IHQA 1Y0XX 2VV1A 1VJBA 4XI3A 2Q59A 3PCUA 2IOKA 5DTVA 3D5FA 1Z95A 3WJ4A 4N73A 1XP1A 3AFRA 3OLLA 5FQVA 3VT4A 3OSWA 2V0VA 1PZLA 3RUTA 1T7TA 1M13A 1KNUA 1XJ7A 2Q6JA 4N1YA 4XTAA 5KRHA 2Q6SA 1DKFB 3A78A 3W0GA 1R20D 1XDKB 3ADVA 3NSPA 2QE4A 2AX7A 1MZNA 2AA2A 2OVMA 4IA3A 1FD0A 3UUDB 4MGAB 2ZK3A 4XAOA 3WFFA 1OVLA 3D6DA 3ERDA 2XYXA 4WVDA 1X76A 3X1HA 2OAXA 1XPCA 3K8SA 3R2AA 4RZEA 3OS9A 1NQ7A 5L7HA 5HJPB 3B1MA 3V4AA 3UVVA 1XNXA 3VTBA 4P6WA 4OEYA 3H0AA 3IPUA 1Q4XA 4OFRA 2YJAB 4RFWA 5FQSA 3OMQA 4MGDB 4OLMA 5KRCA 1EXAA 3CTBA 3HC5A 3VI8A 3OZJA 2Q6RA 3OLFA 2ZKCA 5CJ6A 4DK7A 3DY6A 2G5OA 2ZXNA 3KMZA 4FGYA 4M8HA 1L2IA 2Q5GA 4RAKA 1DKFA 1Z5XE 3A2IA 3F7DA 3RY9A 1Y0SA 2QA8B 1XDKA 2Q5SA 4QM0A 4OC7A 3VT8A 4EM9A 1QKTA 5JI0D 1YOKA 2AA5A 1K74D 4WHGA 4ITEA 2O4RA 4KZJA 4OIUA 5DX3B 5AWKA 4DORA 4N8RA 5DV8A 3AZ2A 4L96A 4OGHA 1EXXA 2Q60A 1R1KD 3BQDA 4RMCA 2Q3YA 2QZOA 4S14A 5E0XA 5G45A 3GZ9A 1NQ1A 3UUAA 3DR1A 5EITA 4CI5A 3G9EA 2PIUA 1XVPB 3M7RA 3OMMA 4RMEA 1U3SA 5GICA 3X36A 2HAMA 2P1VA 1OSHA 1XAPA 2V7CA 5E15A 2ZNNA 5KRIA 2PINA 5EI1A 5E1CA 2Q61A 1SKXA 3V9VA 5HZCA 2J14A 2GWXA 2QTUA 3PEQA 5G43A 3WT7A 2ABIA 3OSAA 3ADXA 5IXKA 5DXBB 3FALB 4G1ZA 3HODA 2GIUA 3OMKA 3ZRBA 3F5CB 4BCRA 1RDTA 3HC6A 4OJ9A 3KMRA 5DKEA 1YIMA 2GP7A 5AAUA 2QW4A 4ZNVA 3ADSA 4NQAB 5DXQA 4ZNSA 3RVFA 3VRWA 2PNUA 1N4HA 3OGTA 3B5RA 4OKWA 3RLLA 2Z4BA 3HZFA 3GYTA 3L1BA 1XVPA 1YJEA 2HWQA 1XNNA 4PRGA 2QNVA 3KDTA 4WLBA 2Q5PA 3IPQA 3VSOA 2Q7LA 3VJHA 3W5RA 4S0SA 5KCTA 4KZMA 3AUQA 5C4UA 2NXXA 2QSEA 3AURA 4IW8A 1GS4A 4DQMA 2ZLCA 4JYIA 2GPPA 4RUPA 3DZYA 2Q7IA 3H0AD 5DXBA 3A9EB 3FALA 1LBDA 2ZBSA 4PP6A 2PIVA 2QH6A 3G8OA 2GTKA 3JZCA 5A86A 1U9EA 2H77A 1U3QA 4PP3A 1FM6A 3V9TA 5DUHA 3B0QA 4FNEA 5DIEA 4J26A 5HCVA 2QABA 3UP3A 3L0EA 2YHDA 4YPQA 3T03A 3Q95B 4J5XC 3VHUA 4KZIA 5I4VA 3FXVA 5E7VA 2ZLAA 2ZK6A 2HC4A 3W0AA 4A4WA 4APUA 2YLQA 3PRGA 1S0ZA 4ITFA 1UPWA 2QGTA 3ET0A 3MNOA 4R2UA 3VT9A 2HFPA 2NPAA 3A3ZX 3B67A 3D57A 1A28A 2FSZA 2Z4JA 3ADTA 3IPSA 3L0JA 4LBDA 4PXMA 4YNKA 3A9EA 2PIRA 5DYBA 3VJSA 2VV3A 2XYWA 4OARA 4X1GA 5DVVA 1HJ1A 3W5PA 3W0IA 2QA6A 4G2HA 1ZKYA 4K6IA 4E4QA 5FQTA 4JL4A 5JJMB 1XP9A 2ZNPA 5AWJA 4OZRU 3JZBA 4FHIA 5KRAA 1NAXA 3OMOA 4L98A 4B7WA 3ZR7A 3AX8A 3V9YA 1RDTD 1T7RA 2I4ZA 3P0UA 5DUEA 2JFAB 3OKHA 4IS8A 3OSIA 3KPZA 1G1UA 3W0HA 1X7JA 2J7XA 3UUCA 2PIPL 2ACLB 4NB6A 3VJTA 3BC5A 3VRVA 3CQVA 1YP0A 1YMTA 2XHSA 3N00A 5F9BA 2ZK4A 4OKTA 3G8IA 5DIDA 1T79A 5DUGA 3NOAA 4OEZA 2J4AA 3KMGA 4K7AA 5HYRA 3AN3A 4PPSA 2BJ4A 3WFGA 1UHLA 1YY4A 3TKCA 3V3EA 5DZHA 2POBA 1YYEA 2ZK0A 3ADUA 1T73A 4OIVA 4NIEA 2Q70A 5DRMA 5LGAA 4FHHA 4RE8A 3DCTA 4Q50A 3VN2A 2Q1VA 5DY8A 2P7GA 4QL8A 5DZ0A 3VHWA 3R5NA 5DVCA 4N5GA 1FM6D 2JFAA 1ILGA 1IE9A 3KWYA 1GWRA 2OVHA 4PF3A 2PKLA 1P93A 1XP6A 1LV2A 3A40X 3ILZA 2G0HA 3WJ5A 2HARA 3BEJA 1FM9A 3OS8C 2AWHA 5L7GA 3V3QA 1S0XA 1XIUA 4JYHA 3E00A 4J24A 2PIWA 2G0GA 2Q8SA 3UUDA 5DWLA 4OEDA 4MGAA 1RJKA 5ACCA 5EC9A 4IA7A 4MG8B 1XLSA 4OJBA 4PVUA 3FEJA 5KYAA 3X31A 3CDSA 5HJPA 2P1UA 5GT4A 2YJDA 2HWRA 4ZN7A 3P8XA 1E3GA 5DXKA 1HG4A 5DSHA 5DZ1A 4WPFA 4O8FA 4MGDA 5DKGA 4YMQA 2QR9A 3R8AA 3V49A 1QKUA 1XZXX 4REFA 1U3RA 2ATHA 2E2RA 3MNEA 4IU7A 4OH5A 4OHAA 3OMPA 5DVSA 1WM0X 2QXMA 2HASA 1KKQA 3D24A 1G50A 2VV2A 5DWJA 1BSXA 5E14A 2PIQA 1NAVA 5EHJA 3MNPA 2OCFA 2JF9A 1ZDUA 5DWIA 3DZUA 3WGPA 2QA8A 3K6PA 4ZO1X 3NSQA 4CI4A 3B3KA 5E0WA 2PRGA 4RZFA 5DK9A 1SQNA 3AZ3A 5DX3A 3CS8A 3KYTA 2AX6A 1ZH7A 2AX8A 2PITA 3K22A 1ZGYA 3B0RA 4MG8A 5DKBA 3OAPA 4REEA 3CLDA 4PPPA 5KRJA 5KRLA 1YUCA 2R6WA 4DMAA 4DM8A 4IA2A 2ZNQA 2P15A 5DRJA 5C4OA 1T7MA 1PQ9A 4OZTU 4DOSA 4S0TA 3E94A 2ZFXA 4R6SA 1L2JA 2PIXA 4DK8A 2HBHA 4RUOX 2QGWA 4ZI1A 5AZVA 4PLDA 1XB7A 5JY3A 1ZDTA 2ZASA 5DZIA 5GIEA 5DU5A 4MG7B 4G1YA 4NY9A 3IXPA 4OILA 2P4YA 4RZGA 2AMAA 2FAIA 3OS8A 3O1EA 2ZMHA 3F5CA 1Z5XU 2AO6A 3LBDA 3OOKA 4J5WC 4JAZA 4IV4A 3CS6A 3ZQTA 2AM9A 3AUNA 4ZN9A 4OFUA 2ZNOA 2W8YA 1X7EA 2VSRA 3W5QA 2P7AA 3OLSA 4IWCA 4RUJA 3W0YA 2HB8A 2Q1HA 4Q0AC 1T76A 3OZ0A 5DKSA 5C4TA 1FM9D 2LBDA 4UDAA 5EJVA 1E3KA 3SP9A 4E2JA 3E00D 5C4SA 5AAVB 1R6GA 2EWPA 5G42A 2J7YA 3FC6B 2O4JA 3VRUA 4F9MA 1T63A 3X1IA 1NQ2A 2ZMIA 5KRMA 3CJWA 3B66A 3L03A 1PCGA 2ZK5A 2Q7KA 3R5MA 2ZMJA 4QJRA 3VHVA 5IAWA 5KD9A 5KCUA 5L7EA 1YOWA 4QE8A 3ET1A 3FS1A 1T5ZA 3SZ1A 4MGBB 1XOWA 2H79A 4TV1B 5H1EA 3FLIA 3GWXA 4MG9B 4NUFA 3ERTA 5AZTA 3VJIA 2VV1B 3U9QA 4RMDA 3PBAA 1T7FA 4FN9A 2Q59B 4OKBA 5AK2A 4POJA 1A52A 5G5WA 3GBKA 2Q7JA 1XV9B 5FQRA 1FBYA 1NRLA 4IW6A 1OT7A 3FUGA 5SYZA 3VSPA 2P7ZA 1OSVA 2OUZA 3DZUD 5AVLA 2P54A 1S19A 1IE8A 1RK3A 5DV6A 4MG5A 3GWSX 3R29A 3Q95A 5KROA 2XKWA 2I0GA 2QXSA 2GPVA 4IQRA 5KCCA 4WQPA 1OVLB 1QKMA 4IVYA 2JJ3A 3PO9A 1EREA 1PRGA 1ERRA 4ZNWA 2HB7A 3UVVB 4E4KA 5IZ0A 4MG9A 1SJ0A 5HYKA 2B1VA 4J5WA 1G2NA 5DL4A 3FEIA 5E19A 3W5TA 2G44A 1T65A 4ZNHA 2YATA 3P88A 4ZOMA 1XV9A 5JJMA 5APKA 1ILHA 2PJLA 4JGVA 1NQ0A 4LNWA 3VT6A 4A2JA 4ZJRA 1H9UA 2IOGA 2B23A 4POHA 5DI7A 1XLSE 3IXPD 3HLVA
chains in the Genus database with same CATH superfamily
4UDDA 5DYDA 5EGVA 5M96A 2POGA 1N46A 1NYXA 3ZRAA 5KCEA 4JYGA 4J5XA 4K4JA 3GYUA 5GIDA 2ACLA 5B5BA 2VSTA 5ICKA 2AYRA 4LTWA 3K23A 2AAXA 3CWDA 3UU7B 2QZOB 5KCWA 5AVIA 3UUAB 3W0CA 2AXAA 1PDUA 1I38A 1NHZA 3H52A 1X78A 1FCZA 3L3ZA 2B1ZA 3R8IA 5DWEA 3VT7A 3GD2A 4OZTE 3DZYD 3DT3A 3SP6A 5HJSA 2XYJA 2R40A 5APHA 4PP5A 3HQ5A 1PQCA 4OH6A 2P1TA 1FCXA 3DCUA 1GWQA 4UDBA 2ZL9A 3ET3A 5DXEA 4IA1A 5L11A 3D90A 3RUUA 1YA3A 4G20A 5DXMA 1MV9A 3AN4A 3WTQA 1I37A 3PLZA 5DP0A 3G0WA 1R5KA 2A3IA 4LNXA 2ZK1A 1M2ZA 3B0WA 4X1FA 4XLDA 3KBAA 5KCFA 3UU7A 4YT1A 2ZY0A 2NXXE 3ET2A 1ZAFA 4OK1A 2AB2A 1TXIA 2NV7A 4M8EA 4A4VA 1K4WA 3EYBA 5DV3A 3A2HA 3UP0A 5DMFA 3R8DA 2YLOA 4ZJWA 1MVCA 2GL8A 3A2JA 3HO0A 4IWFA 3CS4A 4OEAA 3LMPA 4Y29A 3TKMA 4S15A 5DLRA 4G2IA 2VV4B 2REWA 1G5YA 4R06A 4WHFA 4XUMA 5G3JA 3W0JA 4ZNTA 5B41A 2YLPA 1Y9RA 3WT5A 1UOMA 2GPOA 4QK4A 2QPYA 2I4JA 3TY0A 4MDDA 4IVWA 4HLWA 4MG6A 5KCDA 2GPUA 2ZVTA 1YINA 5DIGA 2O9IA 5KYJA 4TUZB 3VT5A 2VV0A 4XUHA 2AA6A 4OZRE 2R6YA 3OOFA 4ONIA 1NUOA 1R20A 2B50A 3FURA 5AYGA 3TX7B 1M7WA 3WT6A 4PWLA 4ZO1B 1TFCA 3E7CA 3IMYA 4Q13A 4XHDA 3HM1A 5DMCA 4ZNUA 4OJ4A 2I4PA 3GN8A 3B65A 2HCDA 1XQCA 5K13A 2AMBA 4CSJA 3B68A 3IA6A 3QT0A 1N83A 2VV4A 5APJA 3VTDA 2OZ7A 2FVJA 4EMAA 3L0LA 5DXPA 1PQ6A 1SR7A 3ADWA 4QE6A 2AA7A 2R40D 4MG7A 4TUZA 3KDUA 1T74A 3KFCA 1S9QA 4PLEA 5ETHA 4G1DA 1RKHA 3CDPA 4DM6A 3P89A 5KRKA 1DB1A 3O1DA 1K7LA 2YLYA 1K74A 1GWXA 5FQPA 3S9SA 1PK5A 2I0JA 2QMVA 2ZK2A 2ZXMA 4G21A 4OKXA 4RWVA 4XT9A 1UPVA 1S9PA 2OM9A 5DXGA 1I7GA 5G46A 4MGCA 3OKIA 1R1KA 3VT3A 2ZXZA 5AAVA 2AX9A 5KRFA 2F4BA 1FCYA 1QKNA 3FC6A 2NW4A 1P8DA 5DXRA 1X7BA 3VTCA 1I7IA 3VRTA 2PIOA 1RKGA 3RLJA 5LWPA 5G44A 1X7RA 2BJ4B 2HVCA 1UHLB 4P6XA 1KV6A 5DWGA 5DZ3A 1XQ3A 3L3XA 2YFEA 3AZ1A 4IV2A 4MGBA 3B0TA 4LSJA 4TV1A 3WMHA 3WWRA 5KR9A 3HVLA 1ZEOA 2BAWA 4UDCA 1ZUCA 1NDEA 4IUIA 4HEEX 2IHQA 1Y0XX 2VV1A 1VJBA 4XI3A 2Q59A 3PCUA 2IOKA 5DTVA 3D5FA 1Z95A 3WJ4A 4N73A 1XP1A 3AFRA 3OLLA 5FQVA 3VT4A 3OSWA 2V0VA 1PZLA 3RUTA 1T7TA 1M13A 1KNUA 1XJ7A 2Q6JA 4N1YA 4XTAA 5KRHA 2Q6SA 1DKFB 3A78A 3W0GA 1R20D 1XDKB 3ADVA 3NSPA 2QE4A 2AX7A 1MZNA 2AA2A 2OVMA 4IA3A 1FD0A 3UUDB 4MGAB 2ZK3A 4XAOA 3WFFA 1OVLA 3D6DA 3ERDA 2XYXA 4WVDA 1X76A 3X1HA 2OAXA 1XPCA 3K8SA 3R2AA 4RZEA 3OS9A 1NQ7A 5L7HA 5HJPB 3B1MA 3V4AA 3UVVA 1XNXA 3VTBA 4P6WA 4OEYA 3H0AA 3IPUA 1Q4XA 4OFRA 2YJAB 4RFWA 5FQSA 3OMQA 4MGDB 4OLMA 5KRCA 1EXAA 3CTBA 3HC5A 3VI8A 3OZJA 2Q6RA 3OLFA 2ZKCA 5CJ6A 4DK7A 3DY6A 2G5OA 2ZXNA 3KMZA 4FGYA 4M8HA 1L2IA 2Q5GA 4RAKA 1DKFA 1Z5XE 3A2IA 3F7DA 3RY9A 1Y0SA 2QA8B 1XDKA 2Q5SA 4QM0A 4OC7A 3VT8A 4EM9A 1QKTA 5JI0D 1YOKA 2AA5A 1K74D 4WHGA 4ITEA 2O4RA 4KZJA 4OIUA 5DX3B 5AWKA 4DORA 4N8RA 5DV8A 3AZ2A 4L96A 4OGHA 1EXXA 2Q60A 1R1KD 3BQDA 4RMCA 2Q3YA 2QZOA 4S14A 5E0XA 5G45A 3GZ9A 1NQ1A 3UUAA 3DR1A 5EITA 4CI5A 3G9EA 2PIUA 1XVPB 3M7RA 3OMMA 4RMEA 1U3SA 5GICA 3X36A 2HAMA 2P1VA 1OSHA 1XAPA 2V7CA 5E15A 2ZNNA 5KRIA 2PINA 5EI1A 5E1CA 2Q61A 1SKXA 3V9VA 5HZCA 2J14A 2GWXA 2QTUA 3PEQA 5G43A 3WT7A 2ABIA 3OSAA 3ADXA 5IXKA 5DXBB 3FALB 4G1ZA 3HODA 2GIUA 3OMKA 3ZRBA 3F5CB 4BCRA 1RDTA 3HC6A 4OJ9A 3KMRA 5DKEA 1YIMA 2GP7A 5AAUA 2QW4A 4ZNVA 3ADSA 4NQAB 5DXQA 4ZNSA 3RVFA 3VRWA 2PNUA 1N4HA 3OGTA 3B5RA 4OKWA 3RLLA 2Z4BA 3HZFA 3GYTA 3L1BA 1XVPA 1YJEA 2HWQA 1XNNA 4PRGA 2QNVA 3KDTA 4WLBA 2Q5PA 3IPQA 3VSOA 2Q7LA 3VJHA 3W5RA 4S0SA 5KCTA 4KZMA 3AUQA 5C4UA 2NXXA 2QSEA 3AURA 4IW8A 1GS4A 4DQMA 2ZLCA 4JYIA 2GPPA 4RUPA 3DZYA 2Q7IA 3H0AD 5DXBA 3A9EB 3FALA 1LBDA 2ZBSA 4PP6A 2PIVA 2QH6A 3G8OA 2GTKA 3JZCA 5A86A 1U9EA 2H77A 1U3QA 4PP3A 1FM6A 3V9TA 5DUHA 3B0QA 4FNEA 5DIEA 4J26A 5HCVA 2QABA 3UP3A 3L0EA 2YHDA 4YPQA 3T03A 3Q95B 4J5XC 3VHUA 4KZIA 5I4VA 3FXVA 5E7VA 2ZLAA 2ZK6A 2HC4A 3W0AA 4A4WA 4APUA 2YLQA 3PRGA 1S0ZA 4ITFA 1UPWA 2QGTA 3ET0A 3MNOA 4R2UA 3VT9A 2HFPA 2NPAA 3A3ZX 3B67A 3D57A 1A28A 2FSZA 2Z4JA 3ADTA 3IPSA 3L0JA 4LBDA 4PXMA 4YNKA 3A9EA 2PIRA 5DYBA 3VJSA 2VV3A 2XYWA 4OARA 4X1GA 5DVVA 1HJ1A 3W5PA 3W0IA 2QA6A 4G2HA 1ZKYA 4K6IA 4E4QA 5FQTA 4JL4A 5JJMB 1XP9A 2ZNPA 5AWJA 4OZRU 3JZBA 4FHIA 5KRAA 1NAXA 3OMOA 4L98A 4B7WA 3ZR7A 3AX8A 3V9YA 1RDTD 1T7RA 2I4ZA 3P0UA 5DUEA 2JFAB 3OKHA 4IS8A 3OSIA 3KPZA 1G1UA 3W0HA 1X7JA 2J7XA 3UUCA 2PIPL 2ACLB 4NB6A 3VJTA 3BC5A 3VRVA 3CQVA 1YP0A 1YMTA 2XHSA 3N00A 5F9BA 2ZK4A 4OKTA 3G8IA 5DIDA 1T79A 5DUGA 3NOAA 4OEZA 2J4AA 3KMGA 4K7AA 5HYRA 3AN3A 4PPSA 2BJ4A 3WFGA 1UHLA 1YY4A 3TKCA 3V3EA 5DZHA 2POBA 1YYEA 2ZK0A 3ADUA 1T73A 4OIVA 4NIEA 2Q70A 5DRMA 5LGAA 4FHHA 4RE8A 3DCTA 4Q50A 3VN2A 2Q1VA 5DY8A 2P7GA 4QL8A 5DZ0A 3VHWA 3R5NA 5DVCA 4N5GA 1FM6D 2JFAA 1ILGA 1IE9A 3KWYA 1GWRA 2OVHA 4PF3A 2PKLA 1P93A 1XP6A 1LV2A 3A40X 3ILZA 2G0HA 3WJ5A 2HARA 3BEJA 1FM9A 3OS8C 2AWHA 5L7GA 3V3QA 1S0XA 1XIUA 4JYHA 3E00A 4J24A 2PIWA 2G0GA 2Q8SA 3UUDA 5DWLA 4OEDA 4MGAA 1RJKA 5ACCA 5EC9A 4IA7A 4MG8B 1XLSA 4OJBA 4PVUA 3FEJA 5KYAA 3X31A 3CDSA 5HJPA 2P1UA 5GT4A 2YJDA 2HWRA 4ZN7A 3P8XA 1E3GA 5DXKA 1HG4A 5DSHA 5DZ1A 4WPFA 4O8FA 4MGDA 5DKGA 4YMQA 2QR9A 3R8AA 3V49A 1QKUA 1XZXX 4REFA 1U3RA 2ATHA 2E2RA 3MNEA 4IU7A 4OH5A 4OHAA 3OMPA 5DVSA 1WM0X 2QXMA 2HASA 1KKQA 3D24A 1G50A 2VV2A 5DWJA 1BSXA 5E14A 2PIQA 1NAVA 5EHJA 3MNPA 2OCFA 2JF9A 1ZDUA 5DWIA 3DZUA 3WGPA 2QA8A 3K6PA 4ZO1X 3NSQA 4CI4A 3B3KA 5E0WA 2PRGA 4RZFA 5DK9A 1SQNA 3AZ3A 5DX3A 3CS8A 3KYTA 2AX6A 1ZH7A 2AX8A 2PITA 3K22A 1ZGYA 3B0RA 4MG8A 5DKBA 3OAPA 4REEA 3CLDA 4PPPA 5KRJA 5KRLA 1YUCA 2R6WA 4DMAA 4DM8A 4IA2A 2ZNQA 2P15A 5DRJA 5C4OA 1T7MA 1PQ9A 4OZTU 4DOSA 4S0TA 3E94A 2ZFXA 4R6SA 1L2JA 2PIXA 4DK8A 2HBHA 4RUOX 2QGWA 4ZI1A 5AZVA 4PLDA 1XB7A 5JY3A 1ZDTA 2ZASA 5DZIA 5GIEA 5DU5A 4MG7B 4G1YA 4NY9A 3IXPA 4OILA 2P4YA 4RZGA 2AMAA 2FAIA 3OS8A 3O1EA 2ZMHA 3F5CA 1Z5XU 2AO6A 3LBDA 3OOKA 4J5WC 4JAZA 4IV4A 3CS6A 3ZQTA 2AM9A 3AUNA 4ZN9A 4OFUA 2ZNOA 2W8YA 1X7EA 2VSRA 3W5QA 2P7AA 3OLSA 4IWCA 4RUJA 3W0YA 2HB8A 2Q1HA 4Q0AC 1T76A 3OZ0A 5DKSA 5C4TA 1FM9D 2LBDA 4UDAA 5EJVA 1E3KA 3SP9A 4E2JA 3E00D 5C4SA 5AAVB 1R6GA 2EWPA 5G42A 2J7YA 3FC6B 2O4JA 3VRUA 4F9MA 1T63A 3X1IA 1NQ2A 2ZMIA 5KRMA 3CJWA 3B66A 3L03A 1PCGA 2ZK5A 2Q7KA 3R5MA 2ZMJA 4QJRA 3VHVA 5IAWA 5KD9A 5KCUA 5L7EA 1YOWA 4QE8A 3ET1A 3FS1A 1T5ZA 3SZ1A 4MGBB 1XOWA 2H79A 4TV1B 5H1EA 3FLIA 3GWXA 4MG9B 4NUFA 3ERTA 5AZTA 3VJIA 2VV1B 3U9QA 4RMDA 3PBAA 1T7FA 4FN9A 2Q59B 4OKBA 5AK2A 4POJA 1A52A 5G5WA 3GBKA 2Q7JA 1XV9B 5FQRA 1FBYA 1NRLA 4IW6A 1OT7A 3FUGA 5SYZA 3VSPA 2P7ZA 1OSVA 2OUZA 3DZUD 5AVLA 2P54A 1S19A 1IE8A 1RK3A 5DV6A 4MG5A 3GWSX 3R29A 3Q95A 5KROA 2XKWA 2I0GA 2QXSA 2GPVA 4IQRA 5KCCA 4WQPA 1OVLB 1QKMA 4IVYA 2JJ3A 3PO9A 1EREA 1PRGA 1ERRA 4ZNWA 2HB7A 3UVVB 4E4KA 5IZ0A 4MG9A 1SJ0A 5HYKA 2B1VA 4J5WA 1G2NA 5DL4A 3FEIA 5E19A 3W5TA 2G44A 1T65A 4ZNHA 2YATA 3P88A 4ZOMA 1XV9A 5JJMA 5APKA 1ILHA 2PJLA 4JGVA 1NQ0A 4LNWA 3VT6A 4A2JA 4ZJRA 1H9UA 2IOGA 2B23A 4POHA 5DI7A 1XLSE 3IXPD 3HLVA
chains in the Genus database with same CATH topology
4UDDA 5DYDA 5EGVA 5M96A 2POGA 1N46A 1NYXA 3ZRAA 5KCEA 4JYGA 4J5XA 4K4JA 3GYUA 5GIDA 2ACLA 5B5BA 2VSTA 5ICKA 2AYRA 4LTWA 3K23A 2AAXA 3CWDA 3UU7B 2QZOB 5KCWA 5AVIA 3UUAB 3W0CA 2AXAA 1PDUA 1I38A 1NHZA 3H52A 1X78A 1FCZA 3L3ZA 2B1ZA 3R8IA 5DWEA 3VT7A 3GD2A 4OZTE 3DZYD 3DT3A 3SP6A 5HJSA 2XYJA 2R40A 5APHA 4PP5A 3HQ5A 1PQCA 4OH6A 2P1TA 1FCXA 3DCUA 1GWQA 4UDBA 2ZL9A 3ET3A 5DXEA 4IA1A 5L11A 3D90A 3RUUA 1YA3A 4G20A 5DXMA 1MV9A 3AN4A 3WTQA 1I37A 3PLZA 5DP0A 3G0WA 1R5KA 2A3IA 4LNXA 2ZK1A 1M2ZA 3B0WA 4X1FA 4XLDA 3KBAA 5KCFA 3UU7A 4YT1A 2ZY0A 2NXXE 3ET2A 1ZAFA 4OK1A 2AB2A 1TXIA 2NV7A 4M8EA 4A4VA 1K4WA 3EYBA 5DV3A 3A2HA 3UP0A 5DMFA 3R8DA 2YLOA 4ZJWA 1MVCA 2GL8A 3A2JA 3HO0A 4IWFA 3CS4A 4OEAA 3LMPA 4Y29A 3TKMA 4S15A 5DLRA 4G2IA 2VV4B 2REWA 1G5YA 4R06A 4WHFA 4XUMA 5G3JA 3W0JA 4ZNTA 5B41A 2YLPA 1Y9RA 3WT5A 1UOMA 2GPOA 4QK4A 2QPYA 2I4JA 3TY0A 4MDDA 4IVWA 4HLWA 4MG6A 5KCDA 2GPUA 2ZVTA 1YINA 5DIGA 2O9IA 5KYJA 4TUZB 3VT5A 2VV0A 4XUHA 2AA6A 4OZRE 2R6YA 3OOFA 4ONIA 1NUOA 1R20A 2B50A 3FURA 5AYGA 3TX7B 1M7WA 3WT6A 4PWLA 4ZO1B 1TFCA 3E7CA 3IMYA 4Q13A 4XHDA 3HM1A 5DMCA 4ZNUA 4OJ4A 2I4PA 3GN8A 3B65A 2HCDA 1XQCA 5K13A 2AMBA 4CSJA 3B68A 3IA6A 3QT0A 1N83A 2VV4A 5APJA 3VTDA 2OZ7A 2FVJA 4EMAA 3L0LA 5DXPA 1PQ6A 1SR7A 3ADWA 4QE6A 2AA7A 2R40D 4MG7A 4TUZA 3KDUA 1T74A 3KFCA 1S9QA 4PLEA 5ETHA 4G1DA 1RKHA 3CDPA 4DM6A 3P89A 5KRKA 1DB1A 3O1DA 1K7LA 2YLYA 1K74A 1GWXA 5FQPA 3S9SA 1PK5A 2I0JA 2QMVA 2ZK2A 2ZXMA 4G21A 4OKXA 4RWVA 4XT9A 1UPVA 1S9PA 2OM9A 5DXGA 1I7GA 5G46A 4MGCA 3OKIA 1R1KA 3VT3A 2ZXZA 5AAVA 2AX9A 5KRFA 2F4BA 1FCYA 1QKNA 3FC6A 2NW4A 1P8DA 5DXRA 1X7BA 3VTCA 1I7IA 3VRTA 2PIOA 1RKGA 3RLJA 5LWPA 5G44A 1X7RA 2BJ4B 2HVCA 1UHLB 4P6XA 1KV6A 5DWGA 5DZ3A 1XQ3A 3L3XA 2YFEA 3AZ1A 4IV2A 4MGBA 3B0TA 4LSJA 4TV1A 3WMHA 3WWRA 5KR9A 3HVLA 1ZEOA 2BAWA 4UDCA 1ZUCA 1NDEA 4IUIA 4HEEX 2IHQA 1Y0XX 2VV1A 1VJBA 4XI3A 2Q59A 3PCUA 2IOKA 5DTVA 3D5FA 1Z95A 3WJ4A 4N73A 1XP1A 3AFRA 3OLLA 5FQVA 3VT4A 3OSWA 2V0VA 1PZLA 3RUTA 1T7TA 1M13A 1KNUA 1XJ7A 2Q6JA 4N1YA 4XTAA 5KRHA 2Q6SA 1DKFB 3A78A 3W0GA 1R20D 1XDKB 3ADVA 3NSPA 2QE4A 2AX7A 1MZNA 2AA2A 2OVMA 4IA3A 1FD0A 3UUDB 4MGAB 2ZK3A 4XAOA 3WFFA 1OVLA 3D6DA 3ERDA 2XYXA 4WVDA 1X76A 3X1HA 2OAXA 1XPCA 3K8SA 3R2AA 4RZEA 3OS9A 1NQ7A 5L7HA 5HJPB 3B1MA 3V4AA 3UVVA 1XNXA 3VTBA 4P6WA 4OEYA 3H0AA 3IPUA 1Q4XA 4OFRA 2YJAB 4RFWA 5FQSA 3OMQA 4MGDB 4OLMA 5KRCA 1EXAA 3CTBA 3HC5A 3VI8A 3OZJA 2Q6RA 3OLFA 2ZKCA 5CJ6A 4DK7A 3DY6A 2G5OA 2ZXNA 3KMZA 4FGYA 4M8HA 1L2IA 2Q5GA 4RAKA 1DKFA 1Z5XE 3A2IA 3F7DA 3RY9A 1Y0SA 2QA8B 1XDKA 2Q5SA 4QM0A 4OC7A 3VT8A 4EM9A 1QKTA 5JI0D 1YOKA 2AA5A 1K74D 4WHGA 4ITEA 2O4RA 4KZJA 4OIUA 5DX3B 5AWKA 4DORA 4N8RA 5DV8A 3AZ2A 4L96A 4OGHA 1EXXA 2Q60A 1R1KD 3BQDA 4RMCA 2Q3YA 2QZOA 4S14A 5E0XA 5G45A 3GZ9A 1NQ1A 3UUAA 3DR1A 5EITA 4CI5A 3G9EA 2PIUA 1XVPB 3M7RA 3OMMA 4RMEA 1U3SA 5GICA 3X36A 2HAMA 2P1VA 1OSHA 1XAPA 2V7CA 5E15A 2ZNNA 5KRIA 2PINA 5EI1A 5E1CA 2Q61A 1SKXA 3V9VA 5HZCA 2J14A 2GWXA 2QTUA 3PEQA 5G43A 3WT7A 2ABIA 3OSAA 3ADXA 5IXKA 5DXBB 3FALB 4G1ZA 3HODA 2GIUA 3OMKA 3ZRBA 3F5CB 4BCRA 1RDTA 3HC6A 4OJ9A 3KMRA 5DKEA 1YIMA 2GP7A 5AAUA 2QW4A 4ZNVA 3ADSA 4NQAB 5DXQA 4ZNSA 3RVFA 3VRWA 2PNUA 1N4HA 3OGTA 3B5RA 4OKWA 3RLLA 2Z4BA 3HZFA 3GYTA 3L1BA 1XVPA 1YJEA 2HWQA 1XNNA 4PRGA 2QNVA 3KDTA 4WLBA 2Q5PA 3IPQA 3VSOA 2Q7LA 3VJHA 3W5RA 4S0SA 5KCTA 4KZMA 3AUQA 5C4UA 2NXXA 2QSEA 3AURA 4IW8A 1GS4A 4DQMA 2ZLCA 4JYIA 2GPPA 4RUPA 3DZYA 2Q7IA 3H0AD 5DXBA 3A9EB 3FALA 1LBDA 2ZBSA 4PP6A 2PIVA 2QH6A 3G8OA 2GTKA 3JZCA 5A86A 1U9EA 2H77A 1U3QA 4PP3A 1FM6A 3V9TA 5DUHA 3B0QA 4FNEA 5DIEA 4J26A 5HCVA 2QABA 3UP3A 3L0EA 2YHDA 4YPQA 3T03A 3Q95B 4J5XC 3VHUA 4KZIA 5I4VA 3FXVA 5E7VA 2ZLAA 2ZK6A 2HC4A 3W0AA 4A4WA 4APUA 2YLQA 3PRGA 1S0ZA 4ITFA 1UPWA 2QGTA 3ET0A 3MNOA 4R2UA 3VT9A 2HFPA 2NPAA 3A3ZX 3B67A 3D57A 1A28A 2FSZA 2Z4JA 3ADTA 3IPSA 3L0JA 4LBDA 4PXMA 4YNKA 3A9EA 2PIRA 5DYBA 3VJSA 2VV3A 2XYWA 4OARA 4X1GA 5DVVA 1HJ1A 3W5PA 3W0IA 2QA6A 4G2HA 1ZKYA 4K6IA 4E4QA 5FQTA 4JL4A 5JJMB 1XP9A 2ZNPA 5AWJA 4OZRU 3JZBA 4FHIA 5KRAA 1NAXA 3OMOA 4L98A 4B7WA 3ZR7A 3AX8A 3V9YA 1RDTD 1T7RA 2I4ZA 3P0UA 5DUEA 2JFAB 3OKHA 4IS8A 3OSIA 3KPZA 1G1UA 3W0HA 1X7JA 2J7XA 3UUCA 2PIPL 2ACLB 4NB6A 3VJTA 3BC5A 3VRVA 3CQVA 1YP0A 1YMTA 2XHSA 3N00A 5F9BA 2ZK4A 4OKTA 3G8IA 5DIDA 1T79A 5DUGA 3NOAA 4OEZA 2J4AA 3KMGA 4K7AA 5HYRA 3AN3A 4PPSA 2BJ4A 3WFGA 1UHLA 1YY4A 3TKCA 3V3EA 5DZHA 2POBA 1YYEA 2ZK0A 3ADUA 1T73A 4OIVA 4NIEA 2Q70A 5DRMA 5LGAA 4FHHA 4RE8A 3DCTA 4Q50A 3VN2A 2Q1VA 5DY8A 2P7GA 4QL8A 5DZ0A 3VHWA 3R5NA 5DVCA 4N5GA 1FM6D 2JFAA 1ILGA 1IE9A 3KWYA 1GWRA 2OVHA 4PF3A 2PKLA 1P93A 1XP6A 1LV2A 3A40X 3ILZA 2G0HA 3WJ5A 2HARA 3BEJA 1FM9A 3OS8C 2AWHA 5L7GA 3V3QA 1S0XA 1XIUA 4JYHA 3E00A 4J24A 2PIWA 2G0GA 2Q8SA 3UUDA 5DWLA 4OEDA 4MGAA 1RJKA 5ACCA 5EC9A 4IA7A 4MG8B 1XLSA 4OJBA 4PVUA 3FEJA 5KYAA 3X31A 3CDSA 5HJPA 2P1UA 5GT4A 2YJDA 2HWRA 4ZN7A 3P8XA 1E3GA 5DXKA 1HG4A 5DSHA 5DZ1A 4WPFA 4O8FA 4MGDA 5DKGA 4YMQA 2QR9A 3R8AA 3V49A 1QKUA 1XZXX 4REFA 1U3RA 2ATHA 2E2RA 3MNEA 4IU7A 4OH5A 4OHAA 3OMPA 5DVSA 1WM0X 2QXMA 2HASA 1KKQA 3D24A 1G50A 2VV2A 5DWJA 1BSXA 5E14A 2PIQA 1NAVA 5EHJA 3MNPA 2OCFA 2JF9A 1ZDUA 5DWIA 3DZUA 3WGPA 2QA8A 3K6PA 4ZO1X 3NSQA 4CI4A 3B3KA 5E0WA 2PRGA 4RZFA 5DK9A 1SQNA 3AZ3A 5DX3A 3CS8A 3KYTA 2AX6A 1ZH7A 2AX8A 2PITA 3K22A 1ZGYA 3B0RA 4MG8A 5DKBA 3OAPA 4REEA 3CLDA 4PPPA 5KRJA 5KRLA 1YUCA 2R6WA 4DMAA 4DM8A 4IA2A 2ZNQA 2P15A 5DRJA 5C4OA 1T7MA 1PQ9A 4OZTU 4DOSA 4S0TA 3E94A 2ZFXA 4R6SA 1L2JA 2PIXA 4DK8A 2HBHA 4RUOX 2QGWA 4ZI1A 5AZVA 4PLDA 1XB7A 5JY3A 1ZDTA 2ZASA 5DZIA 5GIEA 5DU5A 4MG7B 4G1YA 4NY9A 3IXPA 4OILA 2P4YA 4RZGA 2AMAA 2FAIA 3OS8A 3O1EA 2ZMHA 3F5CA 1Z5XU 2AO6A 3LBDA 3OOKA 4J5WC 4JAZA 4IV4A 3CS6A 3ZQTA 2AM9A 3AUNA 4ZN9A 4OFUA 2ZNOA 2W8YA 1X7EA 2VSRA 3W5QA 2P7AA 3OLSA 4IWCA 4RUJA 3W0YA 2HB8A 2Q1HA 4Q0AC 1T76A 3OZ0A 5DKSA 5C4TA 1FM9D 2LBDA 4UDAA 5EJVA 1E3KA 3SP9A 4E2JA 3E00D 5C4SA 5AAVB 1R6GA 2EWPA 5G42A 2J7YA 3FC6B 2O4JA 3VRUA 4F9MA 1T63A 3X1IA 1NQ2A 2ZMIA 5KRMA 3CJWA 3B66A 3L03A 1PCGA 2ZK5A 2Q7KA 3R5MA 2ZMJA 4QJRA 3VHVA 5IAWA 5KD9A 5KCUA 5L7EA 1YOWA 4QE8A 3ET1A 3FS1A 1T5ZA 3SZ1A 4MGBB 1XOWA 2H79A 4TV1B 5H1EA 3FLIA 3GWXA 4MG9B 4NUFA 3ERTA 5AZTA 3VJIA 2VV1B 3U9QA 4RMDA 3PBAA 1T7FA 4FN9A 2Q59B 4OKBA 5AK2A 4POJA 1A52A 5G5WA 3GBKA 2Q7JA 1XV9B 5FQRA 1FBYA 1NRLA 4IW6A 1OT7A 3FUGA 5SYZA 3VSPA 2P7ZA 1OSVA 2OUZA 3DZUD 5AVLA 2P54A 1S19A 1IE8A 1RK3A 5DV6A 4MG5A 3GWSX 3R29A 3Q95A 5KROA 2XKWA 2I0GA 2QXSA 2GPVA 4IQRA 5KCCA 4WQPA 1OVLB 1QKMA 4IVYA 2JJ3A 3PO9A 1EREA 1PRGA 1ERRA 4ZNWA 2HB7A 3UVVB 4E4KA 5IZ0A 4MG9A 1SJ0A 5HYKA 2B1VA 4J5WA 1G2NA 5DL4A 3FEIA 5E19A 3W5TA 2G44A 1T65A 4ZNHA 2YATA 3P88A 4ZOMA 1XV9A 5JJMA 5APKA 1ILHA 2PJLA 4JGVA 1NQ0A 4LNWA 3VT6A 4A2JA 4ZJRA 1H9UA 2IOGA 2B23A 4POHA 5DI7A 1XLSE 3IXPD 3HLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UDD A;  5DYD A;  5EGV A;  5M96 A;  2POG A;  1N46 A;  1NYX A;  3ZRA A;  5KCE A;  4JYG A;  4J5X A;  4K4J A;  3GYU A;  5GID A;  2ACL A;  5B5B A;  2VST A;  5ICK A;  2AYR A;  4LTW A;  3K23 A;  2AAX A;  3CWD A;  3UU7 B;  2QZO B;  5KCW A;  5AVI A;  3UUA B;  3W0C A;  2AXA A;  1PDU A;  1I38 A;  1NHZ A;  3H52 A;  1X78 A;  1FCZ A;  3L3Z A;  2B1Z A;  3R8I A;  5DWE A;  3VT7 A;  3GD2 A;  4OZT E;  3DZY D;  3DT3 A;  3SP6 A;  5HJS A;  2XYJ A;  2R40 A;  5APH A;  4PP5 A;  3HQ5 A;  1PQC A;  4OH6 A;  2P1T A;  1FCX A;  3DCU A;  1GWQ A;  4UDB A;  2ZL9 A;  3ET3 A;  5DXE A;  4IA1 A;  5L11 A;  3D90 A;  3RUU A;  1YA3 A;  4G20 A;  5DXM A;  1MV9 A;  3AN4 A;  3WTQ A;  1I37 A;  3PLZ A;  5DP0 A;  3G0W A;  1R5K A;  2A3I A;  4LNX A;  2ZK1 A;  1M2Z A;  3B0W A;  4X1F A;  4XLD A;  3KBA A;  5KCF A;  3UU7 A;  4YT1 A;  2ZY0 A;  2NXX E;  3ET2 A;  1ZAF A;  4OK1 A;  2AB2 A;  1TXI A;  2NV7 A;  4M8E A;  4A4V A;  1K4W A;  3EYB A;  5DV3 A;  3A2H A;  3UP0 A;  5DMF A;  3R8D A;  2YLO A;  4ZJW A;  1MVC A;  2GL8 A;  3A2J A;  3HO0 A;  4IWF A;  3CS4 A;  4OEA A;  3LMP A;  4Y29 A;  3TKM A;  4S15 A;  5DLR A;  4G2I A;  2VV4 B;  2REW A;  1G5Y A;  4R06 A;  4WHF A;  4XUM A;  5G3J A;  3W0J A;  4ZNT A;  5B41 A;  2YLP A;  1Y9R A;  3WT5 A;  1UOM A;  2GPO A;  4QK4 A;  2QPY A;  2I4J A;  3TY0 A;  4MDD A;  4IVW A;  4HLW A;  4MG6 A;  5KCD A;  2GPU A;  2ZVT A;  1YIN A;  5DIG A;  2O9I A;  5KYJ A;  4TUZ B;  3VT5 A;  2VV0 A;  4XUH A;  2AA6 A;  4OZR E;  2R6Y A;  3OOF A;  4ONI A;  1NUO A;  1R20 A;  2B50 A;  3FUR A;  5AYG A;  3TX7 B;  1M7W A;  3WT6 A;  4PWL A;  4ZO1 B;  1TFC A;  3E7C A;  3IMY A;  4Q13 A;  4XHD A;  3HM1 A;  5DMC A;  4ZNU A;  4OJ4 A;  2I4P A;  3GN8 A;  3B65 A;  2HCD A;  1XQC A;  5K13 A;  2AMB A;  4CSJ A;  3B68 A;  3IA6 A;  3QT0 A;  1N83 A;  2VV4 A;  5APJ A;  3VTD A;  2OZ7 A;  2FVJ A;  4EMA A;  3L0L A;  5DXP A;  1PQ6 A;  1SR7 A;  3ADW A;  4QE6 A;  2AA7 A;  2R40 D;  4MG7 A;  4TUZ A;  3KDU A;  1T74 A;  3KFC A;  1S9Q A;  4PLE A;  5ETH A;  4G1D A;  1RKH A;  3CDP A;  4DM6 A;  3P89 A;  5KRK A;  1DB1 A;  3O1D A;  1K7L A;  2YLY A;  1K74 A;  1GWX A;  5FQP A;  3S9S A;  1PK5 A;  2I0J A;  2QMV A;  2ZK2 A;  2ZXM A;  4G21 A;  4OKX A;  4RWV A;  4XT9 A;  1UPV A;  1S9P A;  2OM9 A;  5DXG A;  1I7G A;  5G46 A;  4MGC A;  3OKI A;  1R1K A;  3VT3 A;  2ZXZ A;  5AAV A;  2AX9 A;  5KRF A;  2F4B A;  1FCY A;  1QKN A;  3FC6 A;  2NW4 A;  1P8D A;  5DXR A;  1X7B A;  3VTC A;  1I7I A;  3VRT A;  2PIO A;  1RKG A;  3RLJ A;  5LWP A;  5G44 A;  1X7R A;  2BJ4 B;  2HVC A;  1UHL B;  4P6X A;  1KV6 A;  5DWG A;  5DZ3 A;  1XQ3 A;  3L3X A;  2YFE A;  3AZ1 A;  4IV2 A;  4MGB A;  3B0T A;  4LSJ A;  4TV1 A;  3WMH A;  3WWR A;  5KR9 A;  3HVL A;  1ZEO A;  2BAW A;  4UDC A;  1ZUC A;  1NDE A;  4IUI A;  4HEE X;  2IHQ A;  1Y0X X;  2VV1 A;  1VJB A;  4XI3 A;  2Q59 A;  3PCU A;  2IOK A;  5DTV A;  3D5F A;  1Z95 A;  3WJ4 A;  4N73 A;  1XP1 A;  3AFR A;  3OLL A;  5FQV A;  3VT4 A;  3OSW A;  2V0V A;  1PZL A;  3RUT A;  1T7T A;  1M13 A;  1KNU A;  1XJ7 A;  2Q6J A;  4N1Y A;  4XTA A;  5KRH A;  2Q6S A;  1DKF B;  3A78 A;  3W0G A;  1R20 D;  1XDK B;  3ADV A;  3NSP A;  2QE4 A;  2AX7 A;  1MZN A;  2AA2 A;  2OVM A;  4IA3 A;  1FD0 A;  3UUD B;  4MGA B;  2ZK3 A;  4XAO A;  3WFF A;  1OVL A;  3D6D A;  3ERD A;  2XYX A;  4WVD A;  1X76 A;  3X1H A;  2OAX A;  1XPC A;  3K8S A;  3R2A A;  4RZE A;  3OS9 A;  1NQ7 A;  5L7H A;  5HJP B;  3B1M A;  3V4A A;  3UVV A;  1XNX A;  3VTB A;  4P6W A;  4OEY A;  3H0A A;  3IPU A;  1Q4X A;  4OFR A;  2YJA B;  4RFW A;  5FQS A;  3OMQ A;  4MGD B;  4OLM A;  5KRC A;  1EXA A;  3CTB A;  3HC5 A;  3VI8 A;  3OZJ A;  2Q6R A;  3OLF A;  2ZKC A;  5CJ6 A;  4DK7 A;  3DY6 A;  2G5O A;  2ZXN A;  3KMZ A;  4FGY A;  4M8H A;  1L2I A;  2Q5G A;  4RAK A;  1DKF A;  1Z5X E;  3A2I A;  3F7D A;  3RY9 A;  1Y0S A;  2QA8 B;  1XDK A;  2Q5S A;  4QM0 A;  4OC7 A;  3VT8 A;  4EM9 A;  1QKT A;  5JI0 D;  1YOK A;  2AA5 A;  1K74 D;  4WHG A;  4ITE A;  2O4R A;  4KZJ A;  4OIU A;  5DX3 B;  5AWK A;  4DOR A;  4N8R A;  5DV8 A;  3AZ2 A;  4L96 A;  4OGH A;  1EXX A;  2Q60 A;  1R1K D;  3BQD A;  4RMC A;  2Q3Y A;  2QZO A;  4S14 A;  5E0X A;  5G45 A;  3GZ9 A;  1NQ1 A;  3UUA A;  3DR1 A;  5EIT A;  4CI5 A;  3G9E A;  2PIU A;  1XVP B;  3M7R A;  3OMM A;  4RME A;  1U3S A;  5GIC A;  3X36 A;  2HAM A;  2P1V A;  1OSH A;  1XAP A;  2V7C A;  5E15 A;  2ZNN A;  5KRI A;  2PIN A;  5EI1 A;  5E1C A;  2Q61 A;  1SKX A;  3V9V A;  5HZC A;  2J14 A;  2GWX A;  2QTU A;  3PEQ A;  5G43 A;  3WT7 A;  2ABI A;  3OSA A;  3ADX A;  5IXK A;  5DXB B;  3FAL B;  4G1Z A;  3HOD A;  2GIU A;  3OMK A;  3ZRB A;  3F5C B;  4BCR A;  1RDT A;  3HC6 A;  4OJ9 A;  3KMR A;  5DKE A;  1YIM A;  2GP7 A;  5AAU A;  2QW4 A;  4ZNV A;  3ADS A;  4NQA B;  5DXQ A;  4ZNS A;  3RVF A;  3VRW A;  2PNU A;  1N4H A;  3OGT A;  3B5R A;  4OKW A;  3RLL A;  2Z4B A;  3HZF A;  3GYT A;  3L1B A;  1XVP A;  1YJE A;  2HWQ A;  1XNN A;  4PRG A;  2QNV A;  3KDT A;  4WLB A;  2Q5P A;  3IPQ A;  3VSO A;  2Q7L A;  3VJH A;  3W5R A;  4S0S A;  5KCT A;  4KZM A;  3AUQ A;  5C4U A;  2NXX A;  2QSE A;  3AUR A;  4IW8 A;  1GS4 A;  4DQM A;  2ZLC A;  4JYI A;  2GPP A;  4RUP A;  3DZY A;  2Q7I A;  3H0A D;  5DXB A;  3A9E B;  3FAL A;  1LBD A;  2ZBS A;  4PP6 A;  2PIV A;  2QH6 A;  3G8O A;  2GTK A;  3JZC A;  5A86 A;  1U9E A;  2H77 A;  1U3Q A;  4PP3 A;  1FM6 A;  3V9T A;  5DUH A;  3B0Q A;  4FNE A;  5DIE A;  4J26 A;  5HCV A;  2QAB A;  3UP3 A;  3L0E A;  2YHD A;  4YPQ A;  3T03 A;  3Q95 B;  4J5X C;  3VHU A;  4KZI A;  5I4V A;  3FXV A;  5E7V A;  2ZLA A;  2ZK6 A;  2HC4 A;  3W0A A;  4A4W A;  4APU A;  2YLQ A;  3PRG A;  1S0Z A;  4ITF A;  1UPW A;  2QGT A;  3ET0 A;  3MNO A;  4R2U A;  3VT9 A;  2HFP A;  2NPA A;  3A3Z X;  3B67 A;  3D57 A;  1A28 A;  2FSZ A;  2Z4J A;  3ADT A;  3IPS A;  3L0J A;  4LBD A;  4PXM A;  4YNK A;  3A9E A;  2PIR A;  5DYB A;  3VJS A;  2VV3 A;  2XYW A;  4OAR A;  4X1G A;  5DVV A;  1HJ1 A;  3W5P A;  3W0I A;  2QA6 A;  4G2H A;  1ZKY A;  4K6I A;  4E4Q A;  5FQT A;  4JL4 A;  5JJM B;  1XP9 A;  2ZNP A;  5AWJ A;  4OZR U;  3JZB A;  4FHI A;  5KRA A;  1NAX A;  3OMO A;  4L98 A;  4B7W A;  3ZR7 A;  3AX8 A;  3V9Y A;  1RDT D;  1T7R A;  2I4Z A;  3P0U A;  5DUE A;  2JFA B;  3OKH A;  4IS8 A;  3OSI A;  3KPZ A;  1G1U A;  3W0H A;  1X7J A;  2J7X A;  3UUC A;  2PIP L;  2ACL B;  4NB6 A;  3VJT A;  3BC5 A;  3VRV A;  3CQV A;  1YP0 A;  1YMT A;  2XHS A;  3N00 A;  5F9B A;  2ZK4 A;  4OKT A;  3G8I A;  5DID A;  1T79 A;  5DUG A;  3NOA A;  4OEZ A;  2J4A A;  3KMG A;  4K7A A;  5HYR A;  3AN3 A;  4PPS A;  2BJ4 A;  3WFG A;  1UHL A;  1YY4 A;  3TKC A;  3V3E A;  5DZH A;  2POB A;  1YYE A;  2ZK0 A;  3ADU A;  1T73 A;  4OIV A;  4NIE A;  2Q70 A;  5DRM A;  5LGA A;  4FHH A;  4RE8 A;  3DCT A;  4Q50 A;  3VN2 A;  2Q1V A;  5DY8 A;  2P7G A;  4QL8 A;  5DZ0 A;  3VHW A;  3R5N A;  5DVC A;  4N5G A;  1FM6 D;  2JFA A;  1ILG A;  1IE9 A;  3KWY A;  1GWR A;  2OVH A;  4PF3 A;  2PKL A;  1P93 A;  1XP6 A;  1LV2 A;  3A40 X;  3ILZ A;  2G0H A;  3WJ5 A;  2HAR A;  3BEJ A;  1FM9 A;  3OS8 C;  2AWH A;  5L7G A;  3V3Q A;  1S0X A;  1XIU A;  4JYH A;  3E00 A;  4J24 A;  2PIW A;  2G0G A;  2Q8S A;  3UUD A;  5DWL A;  4OED A;  4MGA A;  1RJK A;  5ACC A;  5EC9 A;  4IA7 A;  4MG8 B;  1XLS A;  4OJB A;  4PVU A;  3FEJ A;  5KYA A;  3X31 A;  3CDS A;  5HJP A;  2P1U A;  5GT4 A;  2YJD A;  2HWR A;  4ZN7 A;  3P8X A;  1E3G A;  5DXK A;  1HG4 A;  5DSH A;  5DZ1 A;  4WPF A;  4O8F A;  4MGD A;  5DKG A;  4YMQ A;  2QR9 A;  3R8A A;  3V49 A;  1QKU A;  1XZX X;  4REF A;  1U3R A;  2ATH A;  2E2R A;  3MNE A;  4IU7 A;  4OH5 A;  4OHA A;  3OMP A;  5DVS A;  1WM0 X;  2QXM A;  2HAS A;  1KKQ A;  3D24 A;  1G50 A;  2VV2 A;  5DWJ A;  1BSX A;  5E14 A;  2PIQ A;  1NAV A;  5EHJ A;  3MNP A;  2OCF A;  2JF9 A;  1ZDU A;  5DWI A;  3DZU A;  3WGP A;  2QA8 A;  3K6P A;  4ZO1 X;  3NSQ A;  4CI4 A;  3B3K A;  5E0W A;  2PRG A;  4RZF A;  5DK9 A;  1SQN A;  3AZ3 A;  5DX3 A;  3CS8 A;  3KYT A;  2AX6 A;  1ZH7 A;  2AX8 A;  2PIT A;  3K22 A;  1ZGY A;  3B0R A;  4MG8 A;  5DKB A;  3OAP A;  4REE A;  3CLD A;  4PPP A;  5KRJ A;  5KRL A;  1YUC A;  2R6W A;  4DMA A;  4DM8 A;  4IA2 A;  2ZNQ A;  2P15 A;  5DRJ A;  5C4O A;  1T7M A;  1PQ9 A;  4OZT U;  4DOS A;  4S0T A;  3E94 A;  2ZFX A;  4R6S A;  1L2J A;  2PIX A;  4DK8 A;  2HBH A;  4RUO X;  2QGW A;  4ZI1 A;  5AZV A;  4PLD A;  1XB7 A;  5JY3 A;  1ZDT A;  2ZAS A;  5DZI A;  5GIE A;  5DU5 A;  4MG7 B;  4G1Y A;  4NY9 A;  3IXP A;  4OIL A;  2P4Y A;  4RZG A;  2AMA A;  2FAI A;  3OS8 A;  3O1E A;  2ZMH A;  3F5C A;  1Z5X U;  2AO6 A;  3LBD A;  3OOK A;  4J5W C;  4JAZ A;  4IV4 A;  3CS6 A;  3ZQT A;  2AM9 A;  3AUN A;  4ZN9 A;  4OFU A;  2ZNO A;  2W8Y A;  1X7E A;  2VSR A;  3W5Q A;  2P7A A;  3OLS A;  4IWC A;  4RUJ A;  3W0Y A;  2HB8 A;  2Q1H A;  4Q0A C;  1T76 A;  3OZ0 A;  5DKS A;  5C4T A;  1FM9 D;  2LBD A;  4UDA A;  5EJV A;  1E3K A;  3SP9 A;  4E2J A;  3E00 D;  5C4S A;  5AAV B;  1R6G A;  2EWP A;  5G42 A;  2J7Y A;  3FC6 B;  2O4J A;  3VRU A;  4F9M A;  1T63 A;  3X1I A;  1NQ2 A;  2ZMI A;  5KRM A;  3CJW A;  3B66 A;  3L03 A;  1PCG A;  2ZK5 A;  2Q7K A;  3R5M A;  2ZMJ A;  4QJR A;  3VHV A;  5IAW A;  5KD9 A;  5KCU A;  5L7E A;  1YOW A;  4QE8 A;  3ET1 A;  3FS1 A;  1T5Z A;  3SZ1 A;  4MGB B;  1XOW A;  2H79 A;  4TV1 B;  5H1E A;  3FLI A;  3GWX A;  4MG9 B;  4NUF A;  3ERT A;  5AZT A;  3VJI A;  2VV1 B;  3U9Q A;  4RMD A;  3PBA A;  1T7F A;  4FN9 A;  2Q59 B;  4OKB A;  5AK2 A;  4POJ A;  1A52 A;  5G5W A;  3GBK A;  2Q7J A;  1XV9 B;  5FQR A;  1FBY A;  1NRL A;  4IW6 A;  1OT7 A;  3FUG A;  5SYZ A;  3VSP A;  2P7Z A;  1OSV A;  2OUZ A;  3DZU D;  5AVL A;  2P54 A;  1S19 A;  1IE8 A;  1RK3 A;  5DV6 A;  4MG5 A;  3GWS X;  3R29 A;  3Q95 A;  5KRO A;  2XKW A;  2I0G A;  2QXS A;  2GPV A;  4IQR A;  5KCC A;  4WQP A;  1OVL B;  1QKM A;  4IVY A;  2JJ3 A;  3PO9 A;  1ERE A;  1PRG A;  1ERR A;  4ZNW A;  2HB7 A;  3UVV B;  4E4K A;  5IZ0 A;  4MG9 A;  1SJ0 A;  5HYK A;  2B1V A;  4J5W A;  1G2N A;  5DL4 A;  3FEI A;  5E19 A;  3W5T A;  2G44 A;  1T65 A;  4ZNH A;  2YAT A;  3P88 A;  4ZOM A;  1XV9 A;  5JJM A;  5APK A;  1ILH A;  2PJL A;  4JGV A;  1NQ0 A;  4LNW A;  3VT6 A;  4A2J A;  4ZJR A;  1H9U A;  2IOG A;  2B23 A;  4POH A;  5DI7 A;  1XLS E;  3IXP D;  3HLV A; 
#chains in the Genus database with same CATH topology
 4UDD A;  5DYD A;  5EGV A;  5M96 A;  2POG A;  1N46 A;  1NYX A;  3ZRA A;  5KCE A;  4JYG A;  4J5X A;  4K4J A;  3GYU A;  5GID A;  2ACL A;  5B5B A;  2VST A;  5ICK A;  2AYR A;  4LTW A;  3K23 A;  2AAX A;  3CWD A;  3UU7 B;  2QZO B;  5KCW A;  5AVI A;  3UUA B;  3W0C A;  2AXA A;  1PDU A;  1I38 A;  1NHZ A;  3H52 A;  1X78 A;  1FCZ A;  3L3Z A;  2B1Z A;  3R8I A;  5DWE A;  3VT7 A;  3GD2 A;  4OZT E;  3DZY D;  3DT3 A;  3SP6 A;  5HJS A;  2XYJ A;  2R40 A;  5APH A;  4PP5 A;  3HQ5 A;  1PQC A;  4OH6 A;  2P1T A;  1FCX A;  3DCU A;  1GWQ A;  4UDB A;  2ZL9 A;  3ET3 A;  5DXE A;  4IA1 A;  5L11 A;  3D90 A;  3RUU A;  1YA3 A;  4G20 A;  5DXM A;  1MV9 A;  3AN4 A;  3WTQ A;  1I37 A;  3PLZ A;  5DP0 A;  3G0W A;  1R5K A;  2A3I A;  4LNX A;  2ZK1 A;  1M2Z A;  3B0W A;  4X1F A;  4XLD A;  3KBA A;  5KCF A;  3UU7 A;  4YT1 A;  2ZY0 A;  2NXX E;  3ET2 A;  1ZAF A;  4OK1 A;  2AB2 A;  1TXI A;  2NV7 A;  4M8E A;  4A4V A;  1K4W A;  3EYB A;  5DV3 A;  3A2H A;  3UP0 A;  5DMF A;  3R8D A;  2YLO A;  4ZJW A;  1MVC A;  2GL8 A;  3A2J A;  3HO0 A;  4IWF A;  3CS4 A;  4OEA A;  3LMP A;  4Y29 A;  3TKM A;  4S15 A;  5DLR A;  4G2I A;  2VV4 B;  2REW A;  1G5Y A;  4R06 A;  4WHF A;  4XUM A;  5G3J A;  3W0J A;  4ZNT A;  5B41 A;  2YLP A;  1Y9R A;  3WT5 A;  1UOM A;  2GPO A;  4QK4 A;  2QPY A;  2I4J A;  3TY0 A;  4MDD A;  4IVW A;  4HLW A;  4MG6 A;  5KCD A;  2GPU A;  2ZVT A;  1YIN A;  5DIG A;  2O9I A;  5KYJ A;  4TUZ B;  3VT5 A;  2VV0 A;  4XUH A;  2AA6 A;  4OZR E;  2R6Y A;  3OOF A;  4ONI A;  1NUO A;  1R20 A;  2B50 A;  3FUR A;  5AYG A;  3TX7 B;  1M7W A;  3WT6 A;  4PWL A;  4ZO1 B;  1TFC A;  3E7C A;  3IMY A;  4Q13 A;  4XHD A;  3HM1 A;  5DMC A;  4ZNU A;  4OJ4 A;  2I4P A;  3GN8 A;  3B65 A;  2HCD A;  1XQC A;  5K13 A;  2AMB A;  4CSJ A;  3B68 A;  3IA6 A;  3QT0 A;  1N83 A;  2VV4 A;  5APJ A;  3VTD A;  2OZ7 A;  2FVJ A;  4EMA A;  3L0L A;  5DXP A;  1PQ6 A;  1SR7 A;  3ADW A;  4QE6 A;  2AA7 A;  2R40 D;  4MG7 A;  4TUZ A;  3KDU A;  1T74 A;  3KFC A;  1S9Q A;  4PLE A;  5ETH A;  4G1D A;  1RKH A;  3CDP A;  4DM6 A;  3P89 A;  5KRK A;  1DB1 A;  3O1D A;  1K7L A;  2YLY A;  1K74 A;  1GWX A;  5FQP A;  3S9S A;  1PK5 A;  2I0J A;  2QMV A;  2ZK2 A;  2ZXM A;  4G21 A;  4OKX A;  4RWV A;  4XT9 A;  1UPV A;  1S9P A;  2OM9 A;  5DXG A;  1I7G A;  5G46 A;  4MGC A;  3OKI A;  1R1K A;  3VT3 A;  2ZXZ A;  5AAV A;  2AX9 A;  5KRF A;  2F4B A;  1FCY A;  1QKN A;  3FC6 A;  2NW4 A;  1P8D A;  5DXR A;  1X7B A;  3VTC A;  1I7I A;  3VRT A;  2PIO A;  1RKG A;  3RLJ A;  5LWP A;  5G44 A;  1X7R A;  2BJ4 B;  2HVC A;  1UHL B;  4P6X A;  1KV6 A;  5DWG A;  5DZ3 A;  1XQ3 A;  3L3X A;  2YFE A;  3AZ1 A;  4IV2 A;  4MGB A;  3B0T A;  4LSJ A;  4TV1 A;  3WMH A;  3WWR A;  5KR9 A;  3HVL A;  1ZEO A;  2BAW A;  4UDC A;  1ZUC A;  1NDE A;  4IUI A;  4HEE X;  2IHQ A;  1Y0X X;  2VV1 A;  1VJB A;  4XI3 A;  2Q59 A;  3PCU A;  2IOK A;  5DTV A;  3D5F A;  1Z95 A;  3WJ4 A;  4N73 A;  1XP1 A;  3AFR A;  3OLL A;  5FQV A;  3VT4 A;  3OSW A;  2V0V A;  1PZL A;  3RUT A;  1T7T A;  1M13 A;  1KNU A;  1XJ7 A;  2Q6J A;  4N1Y A;  4XTA A;  5KRH A;  2Q6S A;  1DKF B;  3A78 A;  3W0G A;  1R20 D;  1XDK B;  3ADV A;  3NSP A;  2QE4 A;  2AX7 A;  1MZN A;  2AA2 A;  2OVM A;  4IA3 A;  1FD0 A;  3UUD B;  4MGA B;  2ZK3 A;  4XAO A;  3WFF A;  1OVL A;  3D6D A;  3ERD A;  2XYX A;  4WVD A;  1X76 A;  3X1H A;  2OAX A;  1XPC A;  3K8S A;  3R2A A;  4RZE A;  3OS9 A;  1NQ7 A;  5L7H A;  5HJP B;  3B1M A;  3V4A A;  3UVV A;  1XNX A;  3VTB A;  4P6W A;  4OEY A;  3H0A A;  3IPU A;  1Q4X A;  4OFR A;  2YJA B;  4RFW A;  5FQS A;  3OMQ A;  4MGD B;  4OLM A;  5KRC A;  1EXA A;  3CTB A;  3HC5 A;  3VI8 A;  3OZJ A;  2Q6R A;  3OLF A;  2ZKC A;  5CJ6 A;  4DK7 A;  3DY6 A;  2G5O A;  2ZXN A;  3KMZ A;  4FGY A;  4M8H A;  1L2I A;  2Q5G A;  4RAK A;  1DKF A;  1Z5X E;  3A2I A;  3F7D A;  3RY9 A;  1Y0S A;  2QA8 B;  1XDK A;  2Q5S A;  4QM0 A;  4OC7 A;  3VT8 A;  4EM9 A;  1QKT A;  5JI0 D;  1YOK A;  2AA5 A;  1K74 D;  4WHG A;  4ITE A;  2O4R A;  4KZJ A;  4OIU A;  5DX3 B;  5AWK A;  4DOR A;  4N8R A;  5DV8 A;  3AZ2 A;  4L96 A;  4OGH A;  1EXX A;  2Q60 A;  1R1K D;  3BQD A;  4RMC A;  2Q3Y A;  2QZO A;  4S14 A;  5E0X A;  5G45 A;  3GZ9 A;  1NQ1 A;  3UUA A;  3DR1 A;  5EIT A;  4CI5 A;  3G9E A;  2PIU A;  1XVP B;  3M7R A;  3OMM A;  4RME A;  1U3S A;  5GIC A;  3X36 A;  2HAM A;  2P1V A;  1OSH A;  1XAP A;  2V7C A;  5E15 A;  2ZNN A;  5KRI A;  2PIN A;  5EI1 A;  5E1C A;  2Q61 A;  1SKX A;  3V9V A;  5HZC A;  2J14 A;  2GWX A;  2QTU A;  3PEQ A;  5G43 A;  3WT7 A;  2ABI A;  3OSA A;  3ADX A;  5IXK A;  5DXB B;  3FAL B;  4G1Z A;  3HOD A;  2GIU A;  3OMK A;  3ZRB A;  3F5C B;  4BCR A;  1RDT A;  3HC6 A;  4OJ9 A;  3KMR A;  5DKE A;  1YIM A;  2GP7 A;  5AAU A;  2QW4 A;  4ZNV A;  3ADS A;  4NQA B;  5DXQ A;  4ZNS A;  3RVF A;  3VRW A;  2PNU A;  1N4H A;  3OGT A;  3B5R A;  4OKW A;  3RLL A;  2Z4B A;  3HZF A;  3GYT A;  3L1B A;  1XVP A;  1YJE A;  2HWQ A;  1XNN A;  4PRG A;  2QNV A;  3KDT A;  4WLB A;  2Q5P A;  3IPQ A;  3VSO A;  2Q7L A;  3VJH A;  3W5R A;  4S0S A;  5KCT A;  4KZM A;  3AUQ A;  5C4U A;  2NXX A;  2QSE A;  3AUR A;  4IW8 A;  1GS4 A;  4DQM A;  2ZLC A;  4JYI A;  2GPP A;  4RUP A;  3DZY A;  2Q7I A;  3H0A D;  5DXB A;  3A9E B;  3FAL A;  1LBD A;  2ZBS A;  4PP6 A;  2PIV A;  2QH6 A;  3G8O A;  2GTK A;  3JZC A;  5A86 A;  1U9E A;  2H77 A;  1U3Q A;  4PP3 A;  1FM6 A;  3V9T A;  5DUH A;  3B0Q A;  4FNE A;  5DIE A;  4J26 A;  5HCV A;  2QAB A;  3UP3 A;  3L0E A;  2YHD A;  4YPQ A;  3T03 A;  3Q95 B;  4J5X C;  3VHU A;  4KZI A;  5I4V A;  3FXV A;  5E7V A;  2ZLA A;  2ZK6 A;  2HC4 A;  3W0A A;  4A4W A;  4APU A;  2YLQ A;  3PRG A;  1S0Z A;  4ITF A;  1UPW A;  2QGT A;  3ET0 A;  3MNO A;  4R2U A;  3VT9 A;  2HFP A;  2NPA A;  3A3Z X;  3B67 A;  3D57 A;  1A28 A;  2FSZ A;  2Z4J A;  3ADT A;  3IPS A;  3L0J A;  4LBD A;  4PXM A;  4YNK A;  3A9E A;  2PIR A;  5DYB A;  3VJS A;  2VV3 A;  2XYW A;  4OAR A;  4X1G A;  5DVV A;  1HJ1 A;  3W5P A;  3W0I A;  2QA6 A;  4G2H A;  1ZKY A;  4K6I A;  4E4Q A;  5FQT A;  4JL4 A;  5JJM B;  1XP9 A;  2ZNP A;  5AWJ A;  4OZR U;  3JZB A;  4FHI A;  5KRA A;  1NAX A;  3OMO A;  4L98 A;  4B7W A;  3ZR7 A;  3AX8 A;  3V9Y A;  1RDT D;  1T7R A;  2I4Z A;  3P0U A;  5DUE A;  2JFA B;  3OKH A;  4IS8 A;  3OSI A;  3KPZ A;  1G1U A;  3W0H A;  1X7J A;  2J7X A;  3UUC A;  2PIP L;  2ACL B;  4NB6 A;  3VJT A;  3BC5 A;  3VRV A;  3CQV A;  1YP0 A;  1YMT A;  2XHS A;  3N00 A;  5F9B A;  2ZK4 A;  4OKT A;  3G8I A;  5DID A;  1T79 A;  5DUG A;  3NOA A;  4OEZ A;  2J4A A;  3KMG A;  4K7A A;  5HYR A;  3AN3 A;  4PPS A;  2BJ4 A;  3WFG A;  1UHL A;  1YY4 A;  3TKC A;  3V3E A;  5DZH A;  2POB A;  1YYE A;  2ZK0 A;  3ADU A;  1T73 A;  4OIV A;  4NIE A;  2Q70 A;  5DRM A;  5LGA A;  4FHH A;  4RE8 A;  3DCT A;  4Q50 A;  3VN2 A;  2Q1V A;  5DY8 A;  2P7G A;  4QL8 A;  5DZ0 A;  3VHW A;  3R5N A;  5DVC A;  4N5G A;  1FM6 D;  2JFA A;  1ILG A;  1IE9 A;  3KWY A;  1GWR A;  2OVH A;  4PF3 A;  2PKL A;  1P93 A;  1XP6 A;  1LV2 A;  3A40 X;  3ILZ A;  2G0H A;  3WJ5 A;  2HAR A;  3BEJ A;  1FM9 A;  3OS8 C;  2AWH A;  5L7G A;  3V3Q A;  1S0X A;  1XIU A;  4JYH A;  3E00 A;  4J24 A;  2PIW A;  2G0G A;  2Q8S A;  3UUD A;  5DWL A;  4OED A;  4MGA A;  1RJK A;  5ACC A;  5EC9 A;  4IA7 A;  4MG8 B;  1XLS A;  4OJB A;  4PVU A;  3FEJ A;  5KYA A;  3X31 A;  3CDS A;  5HJP A;  2P1U A;  5GT4 A;  2YJD A;  2HWR A;  4ZN7 A;  3P8X A;  1E3G A;  5DXK A;  1HG4 A;  5DSH A;  5DZ1 A;  4WPF A;  4O8F A;  4MGD A;  5DKG A;  4YMQ A;  2QR9 A;  3R8A A;  3V49 A;  1QKU A;  1XZX X;  4REF A;  1U3R A;  2ATH A;  2E2R A;  3MNE A;  4IU7 A;  4OH5 A;  4OHA A;  3OMP A;  5DVS A;  1WM0 X;  2QXM A;  2HAS A;  1KKQ A;  3D24 A;  1G50 A;  2VV2 A;  5DWJ A;  1BSX A;  5E14 A;  2PIQ A;  1NAV A;  5EHJ A;  3MNP A;  2OCF A;  2JF9 A;  1ZDU A;  5DWI A;  3DZU A;  3WGP A;  2QA8 A;  3K6P A;  4ZO1 X;  3NSQ A;  4CI4 A;  3B3K A;  5E0W A;  2PRG A;  4RZF A;  5DK9 A;  1SQN A;  3AZ3 A;  5DX3 A;  3CS8 A;  3KYT A;  2AX6 A;  1ZH7 A;  2AX8 A;  2PIT A;  3K22 A;  1ZGY A;  3B0R A;  4MG8 A;  5DKB A;  3OAP A;  4REE A;  3CLD A;  4PPP A;  5KRJ A;  5KRL A;  1YUC A;  2R6W A;  4DMA A;  4DM8 A;  4IA2 A;  2ZNQ A;  2P15 A;  5DRJ A;  5C4O A;  1T7M A;  1PQ9 A;  4OZT U;  4DOS A;  4S0T A;  3E94 A;  2ZFX A;  4R6S A;  1L2J A;  2PIX A;  4DK8 A;  2HBH A;  4RUO X;  2QGW A;  4ZI1 A;  5AZV A;  4PLD A;  1XB7 A;  5JY3 A;  1ZDT A;  2ZAS A;  5DZI A;  5GIE A;  5DU5 A;  4MG7 B;  4G1Y A;  4NY9 A;  3IXP A;  4OIL A;  2P4Y A;  4RZG A;  2AMA A;  2FAI A;  3OS8 A;  3O1E A;  2ZMH A;  3F5C A;  1Z5X U;  2AO6 A;  3LBD A;  3OOK A;  4J5W C;  4JAZ A;  4IV4 A;  3CS6 A;  3ZQT A;  2AM9 A;  3AUN A;  4ZN9 A;  4OFU A;  2ZNO A;  2W8Y A;  1X7E A;  2VSR A;  3W5Q A;  2P7A A;  3OLS A;  4IWC A;  4RUJ A;  3W0Y A;  2HB8 A;  2Q1H A;  4Q0A C;  1T76 A;  3OZ0 A;  5DKS A;  5C4T A;  1FM9 D;  2LBD A;  4UDA A;  5EJV A;  1E3K A;  3SP9 A;  4E2J A;  3E00 D;  5C4S A;  5AAV B;  1R6G A;  2EWP A;  5G42 A;  2J7Y A;  3FC6 B;  2O4J A;  3VRU A;  4F9M A;  1T63 A;  3X1I A;  1NQ2 A;  2ZMI A;  5KRM A;  3CJW A;  3B66 A;  3L03 A;  1PCG A;  2ZK5 A;  2Q7K A;  3R5M A;  2ZMJ A;  4QJR A;  3VHV A;  5IAW A;  5KD9 A;  5KCU A;  5L7E A;  1YOW A;  4QE8 A;  3ET1 A;  3FS1 A;  1T5Z A;  3SZ1 A;  4MGB B;  1XOW A;  2H79 A;  4TV1 B;  5H1E A;  3FLI A;  3GWX A;  4MG9 B;  4NUF A;  3ERT A;  5AZT A;  3VJI A;  2VV1 B;  3U9Q A;  4RMD A;  3PBA A;  1T7F A;  4FN9 A;  2Q59 B;  4OKB A;  5AK2 A;  4POJ A;  1A52 A;  5G5W A;  3GBK A;  2Q7J A;  1XV9 B;  5FQR A;  1FBY A;  1NRL A;  4IW6 A;  1OT7 A;  3FUG A;  5SYZ A;  3VSP A;  2P7Z A;  1OSV A;  2OUZ A;  3DZU D;  5AVL A;  2P54 A;  1S19 A;  1IE8 A;  1RK3 A;  5DV6 A;  4MG5 A;  3GWS X;  3R29 A;  3Q95 A;  5KRO A;  2XKW A;  2I0G A;  2QXS A;  2GPV A;  4IQR A;  5KCC A;  4WQP A;  1OVL B;  1QKM A;  4IVY A;  2JJ3 A;  3PO9 A;  1ERE A;  1PRG A;  1ERR A;  4ZNW A;  2HB7 A;  3UVV B;  4E4K A;  5IZ0 A;  4MG9 A;  1SJ0 A;  5HYK A;  2B1V A;  4J5W A;  1G2N A;  5DL4 A;  3FEI A;  5E19 A;  3W5T A;  2G44 A;  1T65 A;  4ZNH A;  2YAT A;  3P88 A;  4ZOM A;  1XV9 A;  5JJM A;  5APK A;  1ILH A;  2PJL A;  4JGV A;  1NQ0 A;  4LNW A;  3VT6 A;  4A2J A;  4ZJR A;  1H9U A;  2IOG A;  2B23 A;  4POH A;  5DI7 A;  1XLS E;  3IXP D;  3HLV A; 
#chains in the Genus database with same CATH homology
 4UDD A;  5DYD A;  5EGV A;  5M96 A;  2POG A;  1N46 A;  1NYX A;  3ZRA A;  5KCE A;  4JYG A;  4J5X A;  4K4J A;  3GYU A;  5GID A;  2ACL A;  5B5B A;  2VST A;  5ICK A;  2AYR A;  4LTW A;  3K23 A;  2AAX A;  3CWD A;  3UU7 B;  2QZO B;  5KCW A;  5AVI A;  3UUA B;  3W0C A;  2AXA A;  1PDU A;  1I38 A;  1NHZ A;  3H52 A;  1X78 A;  1FCZ A;  3L3Z A;  2B1Z A;  3R8I A;  5DWE A;  3VT7 A;  3GD2 A;  4OZT E;  3DZY D;  3DT3 A;  3SP6 A;  5HJS A;  2XYJ A;  2R40 A;  5APH A;  4PP5 A;  3HQ5 A;  1PQC A;  4OH6 A;  2P1T A;  1FCX A;  3DCU A;  1GWQ A;  4UDB A;  2ZL9 A;  3ET3 A;  5DXE A;  4IA1 A;  5L11 A;  3D90 A;  3RUU A;  1YA3 A;  4G20 A;  5DXM A;  1MV9 A;  3AN4 A;  3WTQ A;  1I37 A;  3PLZ A;  5DP0 A;  3G0W A;  1R5K A;  2A3I A;  4LNX A;  2ZK1 A;  1M2Z A;  3B0W A;  4X1F A;  4XLD A;  3KBA A;  5KCF A;  3UU7 A;  4YT1 A;  2ZY0 A;  2NXX E;  3ET2 A;  1ZAF A;  4OK1 A;  2AB2 A;  1TXI A;  2NV7 A;  4M8E A;  4A4V A;  1K4W A;  3EYB A;  5DV3 A;  3A2H A;  3UP0 A;  5DMF A;  3R8D A;  2YLO A;  4ZJW A;  1MVC A;  2GL8 A;  3A2J A;  3HO0 A;  4IWF A;  3CS4 A;  4OEA A;  3LMP A;  4Y29 A;  3TKM A;  4S15 A;  5DLR A;  4G2I A;  2VV4 B;  2REW A;  1G5Y A;  4R06 A;  4WHF A;  4XUM A;  5G3J A;  3W0J A;  4ZNT A;  5B41 A;  2YLP A;  1Y9R A;  3WT5 A;  1UOM A;  2GPO A;  4QK4 A;  2QPY A;  2I4J A;  3TY0 A;  4MDD A;  4IVW A;  4HLW A;  4MG6 A;  5KCD A;  2GPU A;  2ZVT A;  1YIN A;  5DIG A;  2O9I A;  5KYJ A;  4TUZ B;  3VT5 A;  2VV0 A;  4XUH A;  2AA6 A;  4OZR E;  2R6Y A;  3OOF A;  4ONI A;  1NUO A;  1R20 A;  2B50 A;  3FUR A;  5AYG A;  3TX7 B;  1M7W A;  3WT6 A;  4PWL A;  4ZO1 B;  1TFC A;  3E7C A;  3IMY A;  4Q13 A;  4XHD A;  3HM1 A;  5DMC A;  4ZNU A;  4OJ4 A;  2I4P A;  3GN8 A;  3B65 A;  2HCD A;  1XQC A;  5K13 A;  2AMB A;  4CSJ A;  3B68 A;  3IA6 A;  3QT0 A;  1N83 A;  2VV4 A;  5APJ A;  3VTD A;  2OZ7 A;  2FVJ A;  4EMA A;  3L0L A;  5DXP A;  1PQ6 A;  1SR7 A;  3ADW A;  4QE6 A;  2AA7 A;  2R40 D;  4MG7 A;  4TUZ A;  3KDU A;  1T74 A;  3KFC A;  1S9Q A;  4PLE A;  5ETH A;  4G1D A;  1RKH A;  3CDP A;  4DM6 A;  3P89 A;  5KRK A;  1DB1 A;  3O1D A;  1K7L A;  2YLY A;  1K74 A;  1GWX A;  5FQP A;  3S9S A;  1PK5 A;  2I0J A;  2QMV A;  2ZK2 A;  2ZXM A;  4G21 A;  4OKX A;  4RWV A;  4XT9 A;  1UPV A;  1S9P A;  2OM9 A;  5DXG A;  1I7G A;  5G46 A;  4MGC A;  3OKI A;  1R1K A;  3VT3 A;  2ZXZ A;  5AAV A;  2AX9 A;  5KRF A;  2F4B A;  1FCY A;  1QKN A;  3FC6 A;  2NW4 A;  1P8D A;  5DXR A;  1X7B A;  3VTC A;  1I7I A;  3VRT A;  2PIO A;  1RKG A;  3RLJ A;  5LWP A;  5G44 A;  1X7R A;  2BJ4 B;  2HVC A;  1UHL B;  4P6X A;  1KV6 A;  5DWG A;  5DZ3 A;  1XQ3 A;  3L3X A;  2YFE A;  3AZ1 A;  4IV2 A;  4MGB A;  3B0T A;  4LSJ A;  4TV1 A;  3WMH A;  3WWR A;  5KR9 A;  3HVL A;  1ZEO A;  2BAW A;  4UDC A;  1ZUC A;  1NDE A;  4IUI A;  4HEE X;  2IHQ A;  1Y0X X;  2VV1 A;  1VJB A;  4XI3 A;  2Q59 A;  3PCU A;  2IOK A;  5DTV A;  3D5F A;  1Z95 A;  3WJ4 A;  4N73 A;  1XP1 A;  3AFR A;  3OLL A;  5FQV A;  3VT4 A;  3OSW A;  2V0V A;  1PZL A;  3RUT A;  1T7T A;  1M13 A;  1KNU A;  1XJ7 A;  2Q6J A;  4N1Y A;  4XTA A;  5KRH A;  2Q6S A;  1DKF B;  3A78 A;  3W0G A;  1R20 D;  1XDK B;  3ADV A;  3NSP A;  2QE4 A;  2AX7 A;  1MZN A;  2AA2 A;  2OVM A;  4IA3 A;  1FD0 A;  3UUD B;  4MGA B;  2ZK3 A;  4XAO A;  3WFF A;  1OVL A;  3D6D A;  3ERD A;  2XYX A;  4WVD A;  1X76 A;  3X1H A;  2OAX A;  1XPC A;  3K8S A;  3R2A A;  4RZE A;  3OS9 A;  1NQ7 A;  5L7H A;  5HJP B;  3B1M A;  3V4A A;  3UVV A;  1XNX A;  3VTB A;  4P6W A;  4OEY A;  3H0A A;  3IPU A;  1Q4X A;  4OFR A;  2YJA B;  4RFW A;  5FQS A;  3OMQ A;  4MGD B;  4OLM A;  5KRC A;  1EXA A;  3CTB A;  3HC5 A;  3VI8 A;  3OZJ A;  2Q6R A;  3OLF A;  2ZKC A;  5CJ6 A;  4DK7 A;  3DY6 A;  2G5O A;  2ZXN A;  3KMZ A;  4FGY A;  4M8H A;  1L2I A;  2Q5G A;  4RAK A;  1DKF A;  1Z5X E;  3A2I A;  3F7D A;  3RY9 A;  1Y0S A;  2QA8 B;  1XDK A;  2Q5S A;  4QM0 A;  4OC7 A;  3VT8 A;  4EM9 A;  1QKT A;  5JI0 D;  1YOK A;  2AA5 A;  1K74 D;  4WHG A;  4ITE A;  2O4R A;  4KZJ A;  4OIU A;  5DX3 B;  5AWK A;  4DOR A;  4N8R A;  5DV8 A;  3AZ2 A;  4L96 A;  4OGH A;  1EXX A;  2Q60 A;  1R1K D;  3BQD A;  4RMC A;  2Q3Y A;  2QZO A;  4S14 A;  5E0X A;  5G45 A;  3GZ9 A;  1NQ1 A;  3UUA A;  3DR1 A;  5EIT A;  4CI5 A;  3G9E A;  2PIU A;  1XVP B;  3M7R A;  3OMM A;  4RME A;  1U3S A;  5GIC A;  3X36 A;  2HAM A;  2P1V A;  1OSH A;  1XAP A;  2V7C A;  5E15 A;  2ZNN A;  5KRI A;  2PIN A;  5EI1 A;  5E1C A;  2Q61 A;  1SKX A;  3V9V A;  5HZC A;  2J14 A;  2GWX A;  2QTU A;  3PEQ A;  5G43 A;  3WT7 A;  2ABI A;  3OSA A;  3ADX A;  5IXK A;  5DXB B;  3FAL B;  4G1Z A;  3HOD A;  2GIU A;  3OMK A;  3ZRB A;  3F5C B;  4BCR A;  1RDT A;  3HC6 A;  4OJ9 A;  3KMR A;  5DKE A;  1YIM A;  2GP7 A;  5AAU A;  2QW4 A;  4ZNV A;  3ADS A;  4NQA B;  5DXQ A;  4ZNS A;  3RVF A;  3VRW A;  2PNU A;  1N4H A;  3OGT A;  3B5R A;  4OKW A;  3RLL A;  2Z4B A;  3HZF A;  3GYT A;  3L1B A;  1XVP A;  1YJE A;  2HWQ A;  1XNN A;  4PRG A;  2QNV A;  3KDT A;  4WLB A;  2Q5P A;  3IPQ A;  3VSO A;  2Q7L A;  3VJH A;  3W5R A;  4S0S A;  5KCT A;  4KZM A;  3AUQ A;  5C4U A;  2NXX A;  2QSE A;  3AUR A;  4IW8 A;  1GS4 A;  4DQM A;  2ZLC A;  4JYI A;  2GPP A;  4RUP A;  3DZY A;  2Q7I A;  3H0A D;  5DXB A;  3A9E B;  3FAL A;  1LBD A;  2ZBS A;  4PP6 A;  2PIV A;  2QH6 A;  3G8O A;  2GTK A;  3JZC A;  5A86 A;  1U9E A;  2H77 A;  1U3Q A;  4PP3 A;  1FM6 A;  3V9T A;  5DUH A;  3B0Q A;  4FNE A;  5DIE A;  4J26 A;  5HCV A;  2QAB A;  3UP3 A;  3L0E A;  2YHD A;  4YPQ A;  3T03 A;  3Q95 B;  4J5X C;  3VHU A;  4KZI A;  5I4V A;  3FXV A;  5E7V A;  2ZLA A;  2ZK6 A;  2HC4 A;  3W0A A;  4A4W A;  4APU A;  2YLQ A;  3PRG A;  1S0Z A;  4ITF A;  1UPW A;  2QGT A;  3ET0 A;  3MNO A;  4R2U A;  3VT9 A;  2HFP A;  2NPA A;  3A3Z X;  3B67 A;  3D57 A;  1A28 A;  2FSZ A;  2Z4J A;  3ADT A;  3IPS A;  3L0J A;  4LBD A;  4PXM A;  4YNK A;  3A9E A;  2PIR A;  5DYB A;  3VJS A;  2VV3 A;  2XYW A;  4OAR A;  4X1G A;  5DVV A;  1HJ1 A;  3W5P A;  3W0I A;  2QA6 A;  4G2H A;  1ZKY A;  4K6I A;  4E4Q A;  5FQT A;  4JL4 A;  5JJM B;  1XP9 A;  2ZNP A;  5AWJ A;  4OZR U;  3JZB A;  4FHI A;  5KRA A;  1NAX A;  3OMO A;  4L98 A;  4B7W A;  3ZR7 A;  3AX8 A;  3V9Y A;  1RDT D;  1T7R A;  2I4Z A;  3P0U A;  5DUE A;  2JFA B;  3OKH A;  4IS8 A;  3OSI A;  3KPZ A;  1G1U A;  3W0H A;  1X7J A;  2J7X A;  3UUC A;  2PIP L;  2ACL B;  4NB6 A;  3VJT A;  3BC5 A;  3VRV A;  3CQV A;  1YP0 A;  1YMT A;  2XHS A;  3N00 A;  5F9B A;  2ZK4 A;  4OKT A;  3G8I A;  5DID A;  1T79 A;  5DUG A;  3NOA A;  4OEZ A;  2J4A A;  3KMG A;  4K7A A;  5HYR A;  3AN3 A;  4PPS A;  2BJ4 A;  3WFG A;  1UHL A;  1YY4 A;  3TKC A;  3V3E A;  5DZH A;  2POB A;  1YYE A;  2ZK0 A;  3ADU A;  1T73 A;  4OIV A;  4NIE A;  2Q70 A;  5DRM A;  5LGA A;  4FHH A;  4RE8 A;  3DCT A;  4Q50 A;  3VN2 A;  2Q1V A;  5DY8 A;  2P7G A;  4QL8 A;  5DZ0 A;  3VHW A;  3R5N A;  5DVC A;  4N5G A;  1FM6 D;  2JFA A;  1ILG A;  1IE9 A;  3KWY A;  1GWR A;  2OVH A;  4PF3 A;  2PKL A;  1P93 A;  1XP6 A;  1LV2 A;  3A40 X;  3ILZ A;  2G0H A;  3WJ5 A;  2HAR A;  3BEJ A;  1FM9 A;  3OS8 C;  2AWH A;  5L7G A;  3V3Q A;  1S0X A;  1XIU A;  4JYH A;  3E00 A;  4J24 A;  2PIW A;  2G0G A;  2Q8S A;  3UUD A;  5DWL A;  4OED A;  4MGA A;  1RJK A;  5ACC A;  5EC9 A;  4IA7 A;  4MG8 B;  1XLS A;  4OJB A;  4PVU A;  3FEJ A;  5KYA A;  3X31 A;  3CDS A;  5HJP A;  2P1U A;  5GT4 A;  2YJD A;  2HWR A;  4ZN7 A;  3P8X A;  1E3G A;  5DXK A;  1HG4 A;  5DSH A;  5DZ1 A;  4WPF A;  4O8F A;  4MGD A;  5DKG A;  4YMQ A;  2QR9 A;  3R8A A;  3V49 A;  1QKU A;  1XZX X;  4REF A;  1U3R A;  2ATH A;  2E2R A;  3MNE A;  4IU7 A;  4OH5 A;  4OHA A;  3OMP A;  5DVS A;  1WM0 X;  2QXM A;  2HAS A;  1KKQ A;  3D24 A;  1G50 A;  2VV2 A;  5DWJ A;  1BSX A;  5E14 A;  2PIQ A;  1NAV A;  5EHJ A;  3MNP A;  2OCF A;  2JF9 A;  1ZDU A;  5DWI A;  3DZU A;  3WGP A;  2QA8 A;  3K6P A;  4ZO1 X;  3NSQ A;  4CI4 A;  3B3K A;  5E0W A;  2PRG A;  4RZF A;  5DK9 A;  1SQN A;  3AZ3 A;  5DX3 A;  3CS8 A;  3KYT A;  2AX6 A;  1ZH7 A;  2AX8 A;  2PIT A;  3K22 A;  1ZGY A;  3B0R A;  4MG8 A;  5DKB A;  3OAP A;  4REE A;  3CLD A;  4PPP A;  5KRJ A;  5KRL A;  1YUC A;  2R6W A;  4DMA A;  4DM8 A;  4IA2 A;  2ZNQ A;  2P15 A;  5DRJ A;  5C4O A;  1T7M A;  1PQ9 A;  4OZT U;  4DOS A;  4S0T A;  3E94 A;  2ZFX A;  4R6S A;  1L2J A;  2PIX A;  4DK8 A;  2HBH A;  4RUO X;  2QGW A;  4ZI1 A;  5AZV A;  4PLD A;  1XB7 A;  5JY3 A;  1ZDT A;  2ZAS A;  5DZI A;  5GIE A;  5DU5 A;  4MG7 B;  4G1Y A;  4NY9 A;  3IXP A;  4OIL A;  2P4Y A;  4RZG A;  2AMA A;  2FAI A;  3OS8 A;  3O1E A;  2ZMH A;  3F5C A;  1Z5X U;  2AO6 A;  3LBD A;  3OOK A;  4J5W C;  4JAZ A;  4IV4 A;  3CS6 A;  3ZQT A;  2AM9 A;  3AUN A;  4ZN9 A;  4OFU A;  2ZNO A;  2W8Y A;  1X7E A;  2VSR A;  3W5Q A;  2P7A A;  3OLS A;  4IWC A;  4RUJ A;  3W0Y A;  2HB8 A;  2Q1H A;  4Q0A C;  1T76 A;  3OZ0 A;  5DKS A;  5C4T A;  1FM9 D;  2LBD A;  4UDA A;  5EJV A;  1E3K A;  3SP9 A;  4E2J A;  3E00 D;  5C4S A;  5AAV B;  1R6G A;  2EWP A;  5G42 A;  2J7Y A;  3FC6 B;  2O4J A;  3VRU A;  4F9M A;  1T63 A;  3X1I A;  1NQ2 A;  2ZMI A;  5KRM A;  3CJW A;  3B66 A;  3L03 A;  1PCG A;  2ZK5 A;  2Q7K A;  3R5M A;  2ZMJ A;  4QJR A;  3VHV A;  5IAW A;  5KD9 A;  5KCU A;  5L7E A;  1YOW A;  4QE8 A;  3ET1 A;  3FS1 A;  1T5Z A;  3SZ1 A;  4MGB B;  1XOW A;  2H79 A;  4TV1 B;  5H1E A;  3FLI A;  3GWX A;  4MG9 B;  4NUF A;  3ERT A;  5AZT A;  3VJI A;  2VV1 B;  3U9Q A;  4RMD A;  3PBA A;  1T7F A;  4FN9 A;  2Q59 B;  4OKB A;  5AK2 A;  4POJ A;  1A52 A;  5G5W A;  3GBK A;  2Q7J A;  1XV9 B;  5FQR A;  1FBY A;  1NRL A;  4IW6 A;  1OT7 A;  3FUG A;  5SYZ A;  3VSP A;  2P7Z A;  1OSV A;  2OUZ A;  3DZU D;  5AVL A;  2P54 A;  1S19 A;  1IE8 A;  1RK3 A;  5DV6 A;  4MG5 A;  3GWS X;  3R29 A;  3Q95 A;  5KRO A;  2XKW A;  2I0G A;  2QXS A;  2GPV A;  4IQR A;  5KCC A;  4WQP A;  1OVL B;  1QKM A;  4IVY A;  2JJ3 A;  3PO9 A;  1ERE A;  1PRG A;  1ERR A;  4ZNW A;  2HB7 A;  3UVV B;  4E4K A;  5IZ0 A;  4MG9 A;  1SJ0 A;  5HYK A;  2B1V A;  4J5W A;  1G2N A;  5DL4 A;  3FEI A;  5E19 A;  3W5T A;  2G44 A;  1T65 A;  4ZNH A;  2YAT A;  3P88 A;  4ZOM A;  1XV9 A;  5JJM A;  5APK A;  1ILH A;  2PJL A;  4JGV A;  1NQ0 A;  4LNW A;  3VT6 A;  4A2J A;  4ZJR A;  1H9U A;  2IOG A;  2B23 A;  4POH A;  5DI7 A;  1XLS E;  3IXP D;  3HLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...