1X7BA

Crystal structure of estrogen receptor beta complexed with erb-041
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
238
structure length
228
Chain Sequence
LSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMDSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Based Design of Estrogen Receptor-Beta Selective Ligands
pubmed doi rcsb
molecule keywords Estrogen receptor beta
molecule tags Transcription
source organism Homo sapiens
total genus 90
structure length 228
sequence length 238
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 1x7bA00
1Y0XX 2B1ZA 3FEJA 2PIQA 4MG9A 4TV1B 3KYTA 1G50A 4LBDA 3VT7A 2HASA 3OMMA 5DXBA 4WHFA 3VSPA 3R2AA 3OS9A 5DX3B 2QXMA 3VJSA 4JL4A 3OMPA 5DLRA 3RUTA 5FQRA 4J24A 5E19A 4IVYA 3VT3A 1BSXA 5DMCA 3FEIA 2BAWA 5G3JA 4IW6A 3R8AA 1DB1A 2ACLB 4OEDA 4PXMA 5F9BA 4M8HA 2NW4A 4G2IA 3D6DA 1XQCA 5DY8A 3P89A 5APKA 3V3QA 3CQVA 4RUOX 3A2HA 1PCGA 5A86A 4HEEX 3TKMA 2G5OA 2Q61A 2VV3A 1XJ7A 1UOMA 4ZNSA 2FSZA 5DVSA 1Z5XE 3B65A 5DXKA 1UHLB 4PWLA 2YATA 2W8YA 5DYDA 2PNUA 3ADWA 2Z4JA 2Q6SA 1TFCA 1LV2A 1XZXX 5G46A 3G8IA 2ZVTA 3B0QA 2VV0A 2ZNNA 5E7VA 3D24A 1FD0A 2EWPA 2OAXA 4UDDA 5E1CA 2V7CA 5DIGA 2PKLA 4IA2A 3S9SA 1YA3A 5EHJA 1XLSA 3OSIA 4IA3A 1R20D 4A4WA 5KCEA 3OLLA 2BJ4A 4OEZA 2YJAB 2Q7JA 1OSVA 2P7GA 1R20A 5L7GA 3OLSA 2VV4B 3ADVA 3B0TA 2HB7A 3AX8A 3FURA 2QPYA 5GT4A 3RUUA 3A78A 2J7XA 5AYGA 5AAVB 4OH5A 1RK3A 5KYAA 3VTBA 1PQ6A 2ZXMA 3VT6A 4G2HA 2Q1HA 3H52A 3FALA 2Q8SA 2G0GA 2Q59B 1PQ9A 1R6GA 2ZXZA 5G43A 3V3EA 3VHUA 3WFGA 5KROA 5LWPA 5DZ0A 3OAPA 2IOGA 3MNOA 4K4JA 3V9VA 3OKIA 2B23A 4ZNVA 2O9IA 4OEYA 5AWJA 2IHQA 1M7WA 4P6WA 1H9UA 4OC7A 5EJVA 4A2JA 1YYEA 5FQTA 3ERTA 4UDCA 5DZ1A 3DZYD 1T7MA 2P1TA 4OHAA 2ZKCA 2AA7A 3ADTA 1L2JA 3R5MA 4OJ4A 3A2JA 2ZK4A 3DCTA 3G9EA 5AVLA 3WT5A 5DMFA 2ZNOA 3HODA 4WVDA 1S0XA 5E0XA 1K4WA 2R40D 3WWRA 4HLWA 5SYZA 4PP6A 2PIXA 5DWGA 3TY0A 4YPQA 4MGBB 5DI7A 5AZVA 2R40A 2XYJA 4FN9A 1OSHA 2PIUA 3OLFA 2ZMJA 4PF3A 3ADSA 4R06A 2Q5GA 2YLYA 2H77A 2YJDA 1SR7A 2QGWA 4KZJA 1QKTA 3W0CA 3HO0A 3JZCA 3L1BA 2ZMHA 1VJBA 4R2UA 5DX3A 5DKGA 5FQVA 5GIEA 3ET1A 4REFA 3JZBA 1FM6D 4RFWA 1XLSE 5DRMA 3TX7B 1U3RA 2I4ZA 2PRGA 5E15A 5KYJA 3G8OA 1TXIA 1U3SA 4ZN9A 2BJ4B 4A4VA 2ACLA 2HBHA 2Q5PA 4ZN7A 1SQNA 3ET0A 1X7JA 3ZRBA 4EMAA 4OLMA 4LTWA 2AX7A 4NB6A 3ADUA 3WT7A 2FAIA 5DXQA 5APJA 5KCDA 3PRGA 5DIDA 3VHWA 2QXSA 4N5GA 3W0JA 3FALB 4POHA 4XHDA 2VV2A 1NUOA 1PDUA 1P93A 1X78A 2ZLCA 3LBDA 3FLIA 2I4JA 2P15A 5AVIA 2HCDA 1ZDTA 3Q95B 3KBAA 1XB7A 2QTUA 4QJRA 1GWQA 1I7IA 3UU7B 1RJKA 1T7FA 4IUIA 4E4QA 3K22A 4M8EA 3EYBA 5APHA 3V49A 4O8FA 1DKFA 1T65A 3VRTA 3R5NA 3G0WA 4DOSA 5JY3A 5AAUA 4OZTU 5EITA 3GWSX 3AN3A 4YT1A 3O1DA 2AX9A 4ZNHA 2AMBA 5L7EA 2A3IA 4L98A 4XT9A 2PJLA 3FUGA 4MG7B 5HJSA 2VV4A 3A2IA 1R1KD 2PIRA 2HFPA 4OKXA 2NPAA 4R6SA 4JYHA 5DV8A 3CDSA 4MG8B 5C4SA 3SP6A 5AAVA 5DXEA 5DXRA 2AB2A 1R1KA 3HC6A 3OZJA 4IA1A 4S0TA 4ZOMA 4UDBA 4PLEA 3NOAA 1FCZA 2Z4BA 3O1EA 2YLQA 2YHDA 5DWEA 4RE8A 4F9MA 5KRFA 2Q59A 4G1DA 3R29A 1NQ2A 3NSPA 3WTQA 3D57A 5ETHA 4RZGA 5KCWA 1FM9D 4NIEA 2ZK6A 3P0UA 5B41A 3WJ4A 2ZFXA 5DIEA 1FM9A 3OOFA 2GL8A 1XPCA 3B0RA 2OUZA 5KCUA 1XP1A 4PP3A 4QM0A 4LNXA 2ZY0A 2ZBSA 5DZIA 5G45A 1I38A 1HJ1A 1Z95A 1XNXA 1GWRA 3NSQA 4KZMA 3AZ2A 3VJIA 4ZJRA 4MG5A 2P4YA 2AX8A 4ZI1A 5EGVA 4FHHA 4YMQA 4MGAA 1RKGA 4MGBA 5L7HA 3CLDA 4IV2A 1N83A 5HCVA 3UUCA 2HAMA 1NYXA 2PITA 3L0LA 4G20A 5DWLA 2AAXA 3ZQTA 4DM8A 3WMHA 5KR9A 4DORA 1UPVA 1EREA 2QZOA 1S9PA 2HARA 4J5XA 2QMVA 2POGA 1DKFB 1X7BA 3VTCA 4JYGA 1KKQA 1GS4A 3K6PA 1S0ZA 4QE8A 4MGDA 3ILZA 3UVVB 5KCFA 2GPOA 4J5XC 5FQSA 1N4HA 5DV6A 4P6XA 4PVUA 3K23A 5H1EA 1PQCA 3ERDA 3GD2A 1YMTA 4JYIA 4WLBA 2Q6RA 2P54A 3ADXA 3WJ5A 3L03A 3U9QA 5DVCA 2I0JA 3AFRA 3AN4A 2XYXA 4OJBA 3Q95A 4XUMA 4Y29A 2HWRA 3KMZA 4FNEA 3UU7A 1SJ0A 4XTAA 2G0HA 1Q4XA 1XP6A 1G1UA 3BC5A 4REEA 2QABA 4IV4A 4MDDA 4NY9A 1KNUA 3CDPA 4NUFA 3V9TA 1WM0X 3A3ZX 1XIUA 2JFAA 1ERRA 3L0EA 3CS6A 4IWFA 2HVCA 1OT7A 2PIVA 4MGCA 1YIMA 3P88A 3W0HA 3N00A 4OKWA 5DSHA 3W0AA 3DZYA 4OEAA 1XVPA 4DK8A 4MG7A 3DT3A 5DK9A 3GZ9A 1QKNA 5DWJA 3X36A 4RZFA 2VV1A 4CI5A 4MG8A 4LSJA 5KRKA 4S15A 3E00D 1MV9A 4MGAB 4RMDA 3F7DA 4OKBA 5E14A 3WGPA 3E00A 1I7GA 3DCUA 1M13A 5C4TA 5KCCA 3HVLA 3W0GA 4X1FA 1MVCA 1EXAA 2XYWA 3K8SA 4N8RA 3B68A 4OZRU 4ZO1X 2QZOB 4KZIA 4RZEA 4CSJA 4OJ9A 4Q50A 3VN2A 2J14A 1Y9RA 4XI3A 1YOWA 4ZNWA 1NHZA 1PRGA 1NQ0A 3LMPA 4MGDB 4RMEA 3OOKA 4OZRE 5IZ0A 3TKCA 3IPUA 1FM6A 3ET2A 1X7EA 5DU5A 3VTDA 1YOKA 4E2JA 3D90A 3AZ3A 2HC4A 3BQDA 5LGAA 2R6WA 3KWYA 5L11A 2O4RA 3HQ5A 4OIVA 5DKSA 3HC5A 3RLJA 1G2NA 1T74A 2AA2A 1YUCA 2Q7KA 3AUQA 4CI4A 2AO6A 4ZNTA 4NQAB 3L3XA 1OVLB 3OS8A 4OGHA 4RAKA 2QSEA 2AM9A 3KDTA 1SKXA 4TUZA 2ZK5A 5AK2A 1XDKB 2QA6A 3IPSA 3FS1A 3AUNA 5DXMA 3OZ0A 5GICA 3UUDB 4IWCA 3L0JA 4DQMA 4POJA 4XUHA 1IE9A 2JFAB 1IE8A 1T7TA 2AXAA 3UVVA 3FC6B 3SZ1A 2ZMIA 4J5WA 4S14A 1XVPB 5DXPA 1X76A 5DZHA 3VRWA 5KRJA 2PIWA 5KRMA 5HZCA 2OVMA 5DXGA 2GPPA 4MG6A 4OZTE 2VV1B 2G44A 5EI1A 4OARA 2NXXA 1QKUA 2HWQA 2OM9A 1ZKYA 3VHVA 4J5WC 2ZXNA 1R5KA 3WFFA 4JGVA 4JAZA 3T03A 2IOKA 3KDUA 3KMRA 3AURA 4DM6A 2YLOA 2OCFA 1RDTD 3L3ZA 5HYRA 2VSRA 4ZJWA 3F5CB 3VT8A 3GWXA 3VT4A 2Q3YA 1E3KA 4G21A 1S9QA 4Q0AC 3MNPA 4G1YA 5KD9A 1A52A 4ONIA 3HZFA 3WT6A 1PK5A 4DK7A 5KCTA 1M2ZA 2YLPA 4IQRA 1XV9B 4QK4A 3QT0A 4IW8A 4IS8A 1MZNA 2AX6A 2Q7IA 2ZK3A 1NRLA 3IMYA 5KRCA 3CTBA 1N46A 5DUHA 1T76A 2P7ZA 2ZASA 1EXXA 1QKMA 4RMCA 2FVJA 3B67A 5DVVA 3W5PA 2J4AA 2AA6A 3UUAA 2NV7A 5JJMA 3MNEA 3PBAA 1XOWA 3B66A 5EC9A 3X1IA 5KRIA 3VT9A 3E94A 3IPQA 4DMAA 5AZTA 1XNNA 2I4PA 2ZK2A 4WPFA 3UP0A 1GWXA 4TUZB 1S19A 5KRHA 5KRLA 2LBDA 2OVHA 3BEJA 5DV3A 1L2IA 4X1GA 1KV6A 4OKTA 5DRJA 3VT5A 3IXPD 1E3GA 1Z5XU 2ATHA 2P7AA 2GIUA 1X7RA 4K7AA 5HYKA 2JJ3A 3DY6A 2PINA 4J26A 4E4KA 1ZUCA 3IXPA 3R8IA 1XAPA 5I4VA 1FCYA 1NQ1A 4UDAA 2NXXE 3A9EB 2OZ7A 3GYTA 5C4UA 4OK1A 2Q60A 4PPSA 1ZGYA 5DZ3A 3ET3A 1NQ7A 3OMOA 2AMAA 2GP7A 2QH6A 3VRUA 1OVLA 1LBDA 1ZEOA 4OFRA 3HM1A 3VRVA 4PP5A 3B0WA 3SP9A 2Q7LA 2ZL9A 3CJWA 1T7RA 3OMQA 5DP0A 3M7RA 2V0VA 4IU7A 3VSOA 2J7YA 5DWIA 1XDKA 4OIUA 3W0YA 3B1MA 5ACCA 3UUDA 1ILGA 3OGTA 5AWKA 3X1HA 3V9YA 1NAXA 5HJPA 3DR1A 3FC6A 3PEQA 4BCRA 5ICKA 2PIOA 2ABIA 3CS4A 4FHIA 5JJMB 3UUAB 4APUA 5CJ6A 2AA5A 1T73A 1PZLA 1YY4A 5K13A 1RKHA 4MG9B 3W5RA 3V4AA 5JI0D 5DXBB 2O4JA 2ZLAA 4LNWA 3F5CA 4WQPA 1ZH7A 3CWDA 3RLLA 2XHSA 3R8DA 1ILHA 4QE6A 4ZO1B 2B50A 3RVFA 5IXKA 1ZDUA 3PO9A 5DTVA 1Y0SA 5IAWA 2R6YA 5GIDA 3HLVA 1XV9A 3OKHA 4IVWA 3CS8A 2AYRA 4PRGA 1YJEA 5FQPA 3W0IA 2QA8A 2QW4A 4ITEA 1HG4A 3ZRAA 1A28A 2XKWA 2P1UA 1T79A 2AWHA 3RY9A 2VSTA 3IA6A 4G1ZA 5G42A 3ZR7A 2F4BA 5M96A 2ZNPA 3GN8A 4TV1A 3GBKA 4RUJA 1T63A 2Q70A 2ZK0A 4Q13A 2YFEA 3X31A 4EM9A 4S0SA 5DKEA 3FXVA 2HB8A 3B5RA 2GPVA 4PPPA 2B1VA 3B3KA 4XLDA 3OSAA 3DZUD 3OS8C 3OMKA 1YINA 1XQ3A 4B7WA 5B5BA 2JF9A 5DL4A 3VJHA 3DZUA 1XP9A 5C4OA 1U9EA 2Q1VA 3D5FA 2QE4A 5HJPB 5DUGA 1I37A 1NDEA 5KRAA 4OH6A 4FGYA 3W5TA 3GYUA 2Q6JA 3KMGA 3P8XA 4ZNUA 4N1YA 3A9EA 2PIPL 1UHLA 3OSWA 5E0WA 5DYBA 1FCXA 3A40X 1UPWA 2REWA 1YP0A 3UP3A 1T5ZA 2QGTA 4QL8A 2QR9A 5G44A 5DKBA 4RUPA 1NAVA 2GWXA 2Q5SA 1U3QA 3PCUA 1FBYA 3VJTA 2H79A 1RDTA 2I0GA 4PLDA 1K74D 2P1VA 3KFCA 4RWVA 2POBA 4ITFA 4YNKA 4OFUA 5DUEA 4L96A 1K74A 3H0AD 1ZAFA 4WHGA 5G5WA 2GTKA 2ZNQA 2QA8B 2GPUA 2E2RA 3H0AA 1P8DA 3KPZA 4K6IA 4IA7A 4N73A 3W5QA 4OILA 3VI8A 1G5YA 4XAOA 3PLZA 1K7LA 3AZ1A 2ZK1A 2QNVA 3E7CA
chains in the Genus database with same CATH superfamily
1Y0XX 2B1ZA 3FEJA 2PIQA 4MG9A 4TV1B 3KYTA 1G50A 4LBDA 3VT7A 2HASA 3OMMA 5DXBA 4WHFA 3VSPA 3R2AA 3OS9A 5DX3B 2QXMA 3VJSA 4JL4A 3OMPA 5DLRA 3RUTA 5FQRA 4J24A 5E19A 4IVYA 3VT3A 1BSXA 5DMCA 3FEIA 2BAWA 5G3JA 4IW6A 3R8AA 1DB1A 2ACLB 4OEDA 4PXMA 5F9BA 4M8HA 2NW4A 4G2IA 3D6DA 1XQCA 5DY8A 3P89A 5APKA 3V3QA 3CQVA 4RUOX 3A2HA 1PCGA 5A86A 4HEEX 3TKMA 2G5OA 2Q61A 2VV3A 1XJ7A 1UOMA 4ZNSA 2FSZA 5DVSA 1Z5XE 3B65A 5DXKA 1UHLB 4PWLA 2YATA 2W8YA 5DYDA 2PNUA 3ADWA 2Z4JA 2Q6SA 1TFCA 1LV2A 1XZXX 5G46A 3G8IA 2ZVTA 3B0QA 2VV0A 2ZNNA 5E7VA 3D24A 1FD0A 2EWPA 2OAXA 4UDDA 5E1CA 2V7CA 5DIGA 2PKLA 4IA2A 3S9SA 1YA3A 5EHJA 1XLSA 3OSIA 4IA3A 1R20D 4A4WA 5KCEA 3OLLA 2BJ4A 4OEZA 2YJAB 2Q7JA 1OSVA 2P7GA 1R20A 5L7GA 3OLSA 2VV4B 3ADVA 3B0TA 2HB7A 3AX8A 3FURA 2QPYA 5GT4A 3RUUA 3A78A 2J7XA 5AYGA 5AAVB 4OH5A 1RK3A 5KYAA 3VTBA 1PQ6A 2ZXMA 3VT6A 4G2HA 2Q1HA 3H52A 3FALA 2Q8SA 2G0GA 2Q59B 1PQ9A 1R6GA 2ZXZA 5G43A 3V3EA 3VHUA 3WFGA 5KROA 5LWPA 5DZ0A 3OAPA 2IOGA 3MNOA 4K4JA 3V9VA 3OKIA 2B23A 4ZNVA 2O9IA 4OEYA 5AWJA 2IHQA 1M7WA 4P6WA 1H9UA 4OC7A 5EJVA 4A2JA 1YYEA 5FQTA 3ERTA 4UDCA 5DZ1A 3DZYD 1T7MA 2P1TA 4OHAA 2ZKCA 2AA7A 3ADTA 1L2JA 3R5MA 4OJ4A 3A2JA 2ZK4A 3DCTA 3G9EA 5AVLA 3WT5A 5DMFA 2ZNOA 3HODA 4WVDA 1S0XA 5E0XA 1K4WA 2R40D 3WWRA 4HLWA 5SYZA 4PP6A 2PIXA 5DWGA 3TY0A 4YPQA 4MGBB 5DI7A 5AZVA 2R40A 2XYJA 4FN9A 1OSHA 2PIUA 3OLFA 2ZMJA 4PF3A 3ADSA 4R06A 2Q5GA 2YLYA 2H77A 2YJDA 1SR7A 2QGWA 4KZJA 1QKTA 3W0CA 3HO0A 3JZCA 3L1BA 2ZMHA 1VJBA 4R2UA 5DX3A 5DKGA 5FQVA 5GIEA 3ET1A 4REFA 3JZBA 1FM6D 4RFWA 1XLSE 5DRMA 3TX7B 1U3RA 2I4ZA 2PRGA 5E15A 5KYJA 3G8OA 1TXIA 1U3SA 4ZN9A 2BJ4B 4A4VA 2ACLA 2HBHA 2Q5PA 4ZN7A 1SQNA 3ET0A 1X7JA 3ZRBA 4EMAA 4OLMA 4LTWA 2AX7A 4NB6A 3ADUA 3WT7A 2FAIA 5DXQA 5APJA 5KCDA 3PRGA 5DIDA 3VHWA 2QXSA 4N5GA 3W0JA 3FALB 4POHA 4XHDA 2VV2A 1NUOA 1PDUA 1P93A 1X78A 2ZLCA 3LBDA 3FLIA 2I4JA 2P15A 5AVIA 2HCDA 1ZDTA 3Q95B 3KBAA 1XB7A 2QTUA 4QJRA 1GWQA 1I7IA 3UU7B 1RJKA 1T7FA 4IUIA 4E4QA 3K22A 4M8EA 3EYBA 5APHA 3V49A 4O8FA 1DKFA 1T65A 3VRTA 3R5NA 3G0WA 4DOSA 5JY3A 5AAUA 4OZTU 5EITA 3GWSX 3AN3A 4YT1A 3O1DA 2AX9A 4ZNHA 2AMBA 5L7EA 2A3IA 4L98A 4XT9A 2PJLA 3FUGA 4MG7B 5HJSA 2VV4A 3A2IA 1R1KD 2PIRA 2HFPA 4OKXA 2NPAA 4R6SA 4JYHA 5DV8A 3CDSA 4MG8B 5C4SA 3SP6A 5AAVA 5DXEA 5DXRA 2AB2A 1R1KA 3HC6A 3OZJA 4IA1A 4S0TA 4ZOMA 4UDBA 4PLEA 3NOAA 1FCZA 2Z4BA 3O1EA 2YLQA 2YHDA 5DWEA 4RE8A 4F9MA 5KRFA 2Q59A 4G1DA 3R29A 1NQ2A 3NSPA 3WTQA 3D57A 5ETHA 4RZGA 5KCWA 1FM9D 4NIEA 2ZK6A 3P0UA 5B41A 3WJ4A 2ZFXA 5DIEA 1FM9A 3OOFA 2GL8A 1XPCA 3B0RA 2OUZA 5KCUA 1XP1A 4PP3A 4QM0A 4LNXA 2ZY0A 2ZBSA 5DZIA 5G45A 1I38A 1HJ1A 1Z95A 1XNXA 1GWRA 3NSQA 4KZMA 3AZ2A 3VJIA 4ZJRA 4MG5A 2P4YA 2AX8A 4ZI1A 5EGVA 4FHHA 4YMQA 4MGAA 1RKGA 4MGBA 5L7HA 3CLDA 4IV2A 1N83A 5HCVA 3UUCA 2HAMA 1NYXA 2PITA 3L0LA 4G20A 5DWLA 2AAXA 3ZQTA 4DM8A 3WMHA 5KR9A 4DORA 1UPVA 1EREA 2QZOA 1S9PA 2HARA 4J5XA 2QMVA 2POGA 1DKFB 1X7BA 3VTCA 4JYGA 1KKQA 1GS4A 3K6PA 1S0ZA 4QE8A 4MGDA 3ILZA 3UVVB 5KCFA 2GPOA 4J5XC 5FQSA 1N4HA 5DV6A 4P6XA 4PVUA 3K23A 5H1EA 1PQCA 3ERDA 3GD2A 1YMTA 4JYIA 4WLBA 2Q6RA 2P54A 3ADXA 3WJ5A 3L03A 3U9QA 5DVCA 2I0JA 3AFRA 3AN4A 2XYXA 4OJBA 3Q95A 4XUMA 4Y29A 2HWRA 3KMZA 4FNEA 3UU7A 1SJ0A 4XTAA 2G0HA 1Q4XA 1XP6A 1G1UA 3BC5A 4REEA 2QABA 4IV4A 4MDDA 4NY9A 1KNUA 3CDPA 4NUFA 3V9TA 1WM0X 3A3ZX 1XIUA 2JFAA 1ERRA 3L0EA 3CS6A 4IWFA 2HVCA 1OT7A 2PIVA 4MGCA 1YIMA 3P88A 3W0HA 3N00A 4OKWA 5DSHA 3W0AA 3DZYA 4OEAA 1XVPA 4DK8A 4MG7A 3DT3A 5DK9A 3GZ9A 1QKNA 5DWJA 3X36A 4RZFA 2VV1A 4CI5A 4MG8A 4LSJA 5KRKA 4S15A 3E00D 1MV9A 4MGAB 4RMDA 3F7DA 4OKBA 5E14A 3WGPA 3E00A 1I7GA 3DCUA 1M13A 5C4TA 5KCCA 3HVLA 3W0GA 4X1FA 1MVCA 1EXAA 2XYWA 3K8SA 4N8RA 3B68A 4OZRU 4ZO1X 2QZOB 4KZIA 4RZEA 4CSJA 4OJ9A 4Q50A 3VN2A 2J14A 1Y9RA 4XI3A 1YOWA 4ZNWA 1NHZA 1PRGA 1NQ0A 3LMPA 4MGDB 4RMEA 3OOKA 4OZRE 5IZ0A 3TKCA 3IPUA 1FM6A 3ET2A 1X7EA 5DU5A 3VTDA 1YOKA 4E2JA 3D90A 3AZ3A 2HC4A 3BQDA 5LGAA 2R6WA 3KWYA 5L11A 2O4RA 3HQ5A 4OIVA 5DKSA 3HC5A 3RLJA 1G2NA 1T74A 2AA2A 1YUCA 2Q7KA 3AUQA 4CI4A 2AO6A 4ZNTA 4NQAB 3L3XA 1OVLB 3OS8A 4OGHA 4RAKA 2QSEA 2AM9A 3KDTA 1SKXA 4TUZA 2ZK5A 5AK2A 1XDKB 2QA6A 3IPSA 3FS1A 3AUNA 5DXMA 3OZ0A 5GICA 3UUDB 4IWCA 3L0JA 4DQMA 4POJA 4XUHA 1IE9A 2JFAB 1IE8A 1T7TA 2AXAA 3UVVA 3FC6B 3SZ1A 2ZMIA 4J5WA 4S14A 1XVPB 5DXPA 1X76A 5DZHA 3VRWA 5KRJA 2PIWA 5KRMA 5HZCA 2OVMA 5DXGA 2GPPA 4MG6A 4OZTE 2VV1B 2G44A 5EI1A 4OARA 2NXXA 1QKUA 2HWQA 2OM9A 1ZKYA 3VHVA 4J5WC 2ZXNA 1R5KA 3WFFA 4JGVA 4JAZA 3T03A 2IOKA 3KDUA 3KMRA 3AURA 4DM6A 2YLOA 2OCFA 1RDTD 3L3ZA 5HYRA 2VSRA 4ZJWA 3F5CB 3VT8A 3GWXA 3VT4A 2Q3YA 1E3KA 4G21A 1S9QA 4Q0AC 3MNPA 4G1YA 5KD9A 1A52A 4ONIA 3HZFA 3WT6A 1PK5A 4DK7A 5KCTA 1M2ZA 2YLPA 4IQRA 1XV9B 4QK4A 3QT0A 4IW8A 4IS8A 1MZNA 2AX6A 2Q7IA 2ZK3A 1NRLA 3IMYA 5KRCA 3CTBA 1N46A 5DUHA 1T76A 2P7ZA 2ZASA 1EXXA 1QKMA 4RMCA 2FVJA 3B67A 5DVVA 3W5PA 2J4AA 2AA6A 3UUAA 2NV7A 5JJMA 3MNEA 3PBAA 1XOWA 3B66A 5EC9A 3X1IA 5KRIA 3VT9A 3E94A 3IPQA 4DMAA 5AZTA 1XNNA 2I4PA 2ZK2A 4WPFA 3UP0A 1GWXA 4TUZB 1S19A 5KRHA 5KRLA 2LBDA 2OVHA 3BEJA 5DV3A 1L2IA 4X1GA 1KV6A 4OKTA 5DRJA 3VT5A 3IXPD 1E3GA 1Z5XU 2ATHA 2P7AA 2GIUA 1X7RA 4K7AA 5HYKA 2JJ3A 3DY6A 2PINA 4J26A 4E4KA 1ZUCA 3IXPA 3R8IA 1XAPA 5I4VA 1FCYA 1NQ1A 4UDAA 2NXXE 3A9EB 2OZ7A 3GYTA 5C4UA 4OK1A 2Q60A 4PPSA 1ZGYA 5DZ3A 3ET3A 1NQ7A 3OMOA 2AMAA 2GP7A 2QH6A 3VRUA 1OVLA 1LBDA 1ZEOA 4OFRA 3HM1A 3VRVA 4PP5A 3B0WA 3SP9A 2Q7LA 2ZL9A 3CJWA 1T7RA 3OMQA 5DP0A 3M7RA 2V0VA 4IU7A 3VSOA 2J7YA 5DWIA 1XDKA 4OIUA 3W0YA 3B1MA 5ACCA 3UUDA 1ILGA 3OGTA 5AWKA 3X1HA 3V9YA 1NAXA 5HJPA 3DR1A 3FC6A 3PEQA 4BCRA 5ICKA 2PIOA 2ABIA 3CS4A 4FHIA 5JJMB 3UUAB 4APUA 5CJ6A 2AA5A 1T73A 1PZLA 1YY4A 5K13A 1RKHA 4MG9B 3W5RA 3V4AA 5JI0D 5DXBB 2O4JA 2ZLAA 4LNWA 3F5CA 4WQPA 1ZH7A 3CWDA 3RLLA 2XHSA 3R8DA 1ILHA 4QE6A 4ZO1B 2B50A 3RVFA 5IXKA 1ZDUA 3PO9A 5DTVA 1Y0SA 5IAWA 2R6YA 5GIDA 3HLVA 1XV9A 3OKHA 4IVWA 3CS8A 2AYRA 4PRGA 1YJEA 5FQPA 3W0IA 2QA8A 2QW4A 4ITEA 1HG4A 3ZRAA 1A28A 2XKWA 2P1UA 1T79A 2AWHA 3RY9A 2VSTA 3IA6A 4G1ZA 5G42A 3ZR7A 2F4BA 5M96A 2ZNPA 3GN8A 4TV1A 3GBKA 4RUJA 1T63A 2Q70A 2ZK0A 4Q13A 2YFEA 3X31A 4EM9A 4S0SA 5DKEA 3FXVA 2HB8A 3B5RA 2GPVA 4PPPA 2B1VA 3B3KA 4XLDA 3OSAA 3DZUD 3OS8C 3OMKA 1YINA 1XQ3A 4B7WA 5B5BA 2JF9A 5DL4A 3VJHA 3DZUA 1XP9A 5C4OA 1U9EA 2Q1VA 3D5FA 2QE4A 5HJPB 5DUGA 1I37A 1NDEA 5KRAA 4OH6A 4FGYA 3W5TA 3GYUA 2Q6JA 3KMGA 3P8XA 4ZNUA 4N1YA 3A9EA 2PIPL 1UHLA 3OSWA 5E0WA 5DYBA 1FCXA 3A40X 1UPWA 2REWA 1YP0A 3UP3A 1T5ZA 2QGTA 4QL8A 2QR9A 5G44A 5DKBA 4RUPA 1NAVA 2GWXA 2Q5SA 1U3QA 3PCUA 1FBYA 3VJTA 2H79A 1RDTA 2I0GA 4PLDA 1K74D 2P1VA 3KFCA 4RWVA 2POBA 4ITFA 4YNKA 4OFUA 5DUEA 4L96A 1K74A 3H0AD 1ZAFA 4WHGA 5G5WA 2GTKA 2ZNQA 2QA8B 2GPUA 2E2RA 3H0AA 1P8DA 3KPZA 4K6IA 4IA7A 4N73A 3W5QA 4OILA 3VI8A 1G5YA 4XAOA 3PLZA 1K7LA 3AZ1A 2ZK1A 2QNVA 3E7CA
chains in the Genus database with same CATH topology
1Y0XX 2B1ZA 3FEJA 2PIQA 4MG9A 4TV1B 3KYTA 1G50A 4LBDA 3VT7A 2HASA 3OMMA 5DXBA 4WHFA 3VSPA 3R2AA 3OS9A 5DX3B 2QXMA 3VJSA 4JL4A 3OMPA 5DLRA 3RUTA 5FQRA 4J24A 5E19A 4IVYA 3VT3A 1BSXA 5DMCA 3FEIA 2BAWA 5G3JA 4IW6A 3R8AA 1DB1A 2ACLB 4OEDA 4PXMA 5F9BA 4M8HA 2NW4A 4G2IA 3D6DA 1XQCA 5DY8A 3P89A 5APKA 3V3QA 3CQVA 4RUOX 3A2HA 1PCGA 5A86A 4HEEX 3TKMA 2G5OA 2Q61A 2VV3A 1XJ7A 1UOMA 4ZNSA 2FSZA 5DVSA 1Z5XE 3B65A 5DXKA 1UHLB 4PWLA 2YATA 2W8YA 5DYDA 2PNUA 3ADWA 2Z4JA 2Q6SA 1TFCA 1LV2A 1XZXX 5G46A 3G8IA 2ZVTA 3B0QA 2VV0A 2ZNNA 5E7VA 3D24A 1FD0A 2EWPA 2OAXA 4UDDA 5E1CA 2V7CA 5DIGA 2PKLA 4IA2A 3S9SA 1YA3A 5EHJA 1XLSA 3OSIA 4IA3A 1R20D 4A4WA 5KCEA 3OLLA 2BJ4A 4OEZA 2YJAB 2Q7JA 1OSVA 2P7GA 1R20A 5L7GA 3OLSA 2VV4B 3ADVA 3B0TA 2HB7A 3AX8A 3FURA 2QPYA 5GT4A 3RUUA 3A78A 2J7XA 5AYGA 5AAVB 4OH5A 1RK3A 5KYAA 3VTBA 1PQ6A 2ZXMA 3VT6A 4G2HA 2Q1HA 3H52A 3FALA 2Q8SA 2G0GA 2Q59B 1PQ9A 1R6GA 2ZXZA 5G43A 3V3EA 3VHUA 3WFGA 5KROA 5LWPA 5DZ0A 3OAPA 2IOGA 3MNOA 4K4JA 3V9VA 3OKIA 2B23A 4ZNVA 2O9IA 4OEYA 5AWJA 2IHQA 1M7WA 4P6WA 1H9UA 4OC7A 5EJVA 4A2JA 1YYEA 5FQTA 3ERTA 4UDCA 5DZ1A 3DZYD 1T7MA 2P1TA 4OHAA 2ZKCA 2AA7A 3ADTA 1L2JA 3R5MA 4OJ4A 3A2JA 2ZK4A 3DCTA 3G9EA 5AVLA 3WT5A 5DMFA 2ZNOA 3HODA 4WVDA 1S0XA 5E0XA 1K4WA 2R40D 3WWRA 4HLWA 5SYZA 4PP6A 2PIXA 5DWGA 3TY0A 4YPQA 4MGBB 5DI7A 5AZVA 2R40A 2XYJA 4FN9A 1OSHA 2PIUA 3OLFA 2ZMJA 4PF3A 3ADSA 4R06A 2Q5GA 2YLYA 2H77A 2YJDA 1SR7A 2QGWA 4KZJA 1QKTA 3W0CA 3HO0A 3JZCA 3L1BA 2ZMHA 1VJBA 4R2UA 5DX3A 5DKGA 5FQVA 5GIEA 3ET1A 4REFA 3JZBA 1FM6D 4RFWA 1XLSE 5DRMA 3TX7B 1U3RA 2I4ZA 2PRGA 5E15A 5KYJA 3G8OA 1TXIA 1U3SA 4ZN9A 2BJ4B 4A4VA 2ACLA 2HBHA 2Q5PA 4ZN7A 1SQNA 3ET0A 1X7JA 3ZRBA 4EMAA 4OLMA 4LTWA 2AX7A 4NB6A 3ADUA 3WT7A 2FAIA 5DXQA 5APJA 5KCDA 3PRGA 5DIDA 3VHWA 2QXSA 4N5GA 3W0JA 3FALB 4POHA 4XHDA 2VV2A 1NUOA 1PDUA 1P93A 1X78A 2ZLCA 3LBDA 3FLIA 2I4JA 2P15A 5AVIA 2HCDA 1ZDTA 3Q95B 3KBAA 1XB7A 2QTUA 4QJRA 1GWQA 1I7IA 3UU7B 1RJKA 1T7FA 4IUIA 4E4QA 3K22A 4M8EA 3EYBA 5APHA 3V49A 4O8FA 1DKFA 1T65A 3VRTA 3R5NA 3G0WA 4DOSA 5JY3A 5AAUA 4OZTU 5EITA 3GWSX 3AN3A 4YT1A 3O1DA 2AX9A 4ZNHA 2AMBA 5L7EA 2A3IA 4L98A 4XT9A 2PJLA 3FUGA 4MG7B 5HJSA 2VV4A 3A2IA 1R1KD 2PIRA 2HFPA 4OKXA 2NPAA 4R6SA 4JYHA 5DV8A 3CDSA 4MG8B 5C4SA 3SP6A 5AAVA 5DXEA 5DXRA 2AB2A 1R1KA 3HC6A 3OZJA 4IA1A 4S0TA 4ZOMA 4UDBA 4PLEA 3NOAA 1FCZA 2Z4BA 3O1EA 2YLQA 2YHDA 5DWEA 4RE8A 4F9MA 5KRFA 2Q59A 4G1DA 3R29A 1NQ2A 3NSPA 3WTQA 3D57A 5ETHA 4RZGA 5KCWA 1FM9D 4NIEA 2ZK6A 3P0UA 5B41A 3WJ4A 2ZFXA 5DIEA 1FM9A 3OOFA 2GL8A 1XPCA 3B0RA 2OUZA 5KCUA 1XP1A 4PP3A 4QM0A 4LNXA 2ZY0A 2ZBSA 5DZIA 5G45A 1I38A 1HJ1A 1Z95A 1XNXA 1GWRA 3NSQA 4KZMA 3AZ2A 3VJIA 4ZJRA 4MG5A 2P4YA 2AX8A 4ZI1A 5EGVA 4FHHA 4YMQA 4MGAA 1RKGA 4MGBA 5L7HA 3CLDA 4IV2A 1N83A 5HCVA 3UUCA 2HAMA 1NYXA 2PITA 3L0LA 4G20A 5DWLA 2AAXA 3ZQTA 4DM8A 3WMHA 5KR9A 4DORA 1UPVA 1EREA 2QZOA 1S9PA 2HARA 4J5XA 2QMVA 2POGA 1DKFB 1X7BA 3VTCA 4JYGA 1KKQA 1GS4A 3K6PA 1S0ZA 4QE8A 4MGDA 3ILZA 3UVVB 5KCFA 2GPOA 4J5XC 5FQSA 1N4HA 5DV6A 4P6XA 4PVUA 3K23A 5H1EA 1PQCA 3ERDA 3GD2A 1YMTA 4JYIA 4WLBA 2Q6RA 2P54A 3ADXA 3WJ5A 3L03A 3U9QA 5DVCA 2I0JA 3AFRA 3AN4A 2XYXA 4OJBA 3Q95A 4XUMA 4Y29A 2HWRA 3KMZA 4FNEA 3UU7A 1SJ0A 4XTAA 2G0HA 1Q4XA 1XP6A 1G1UA 3BC5A 4REEA 2QABA 4IV4A 4MDDA 4NY9A 1KNUA 3CDPA 4NUFA 3V9TA 1WM0X 3A3ZX 1XIUA 2JFAA 1ERRA 3L0EA 3CS6A 4IWFA 2HVCA 1OT7A 2PIVA 4MGCA 1YIMA 3P88A 3W0HA 3N00A 4OKWA 5DSHA 3W0AA 3DZYA 4OEAA 1XVPA 4DK8A 4MG7A 3DT3A 5DK9A 3GZ9A 1QKNA 5DWJA 3X36A 4RZFA 2VV1A 4CI5A 4MG8A 4LSJA 5KRKA 4S15A 3E00D 1MV9A 4MGAB 4RMDA 3F7DA 4OKBA 5E14A 3WGPA 3E00A 1I7GA 3DCUA 1M13A 5C4TA 5KCCA 3HVLA 3W0GA 4X1FA 1MVCA 1EXAA 2XYWA 3K8SA 4N8RA 3B68A 4OZRU 4ZO1X 2QZOB 4KZIA 4RZEA 4CSJA 4OJ9A 4Q50A 3VN2A 2J14A 1Y9RA 4XI3A 1YOWA 4ZNWA 1NHZA 1PRGA 1NQ0A 3LMPA 4MGDB 4RMEA 3OOKA 4OZRE 5IZ0A 3TKCA 3IPUA 1FM6A 3ET2A 1X7EA 5DU5A 3VTDA 1YOKA 4E2JA 3D90A 3AZ3A 2HC4A 3BQDA 5LGAA 2R6WA 3KWYA 5L11A 2O4RA 3HQ5A 4OIVA 5DKSA 3HC5A 3RLJA 1G2NA 1T74A 2AA2A 1YUCA 2Q7KA 3AUQA 4CI4A 2AO6A 4ZNTA 4NQAB 3L3XA 1OVLB 3OS8A 4OGHA 4RAKA 2QSEA 2AM9A 3KDTA 1SKXA 4TUZA 2ZK5A 5AK2A 1XDKB 2QA6A 3IPSA 3FS1A 3AUNA 5DXMA 3OZ0A 5GICA 3UUDB 4IWCA 3L0JA 4DQMA 4POJA 4XUHA 1IE9A 2JFAB 1IE8A 1T7TA 2AXAA 3UVVA 3FC6B 3SZ1A 2ZMIA 4J5WA 4S14A 1XVPB 5DXPA 1X76A 5DZHA 3VRWA 5KRJA 2PIWA 5KRMA 5HZCA 2OVMA 5DXGA 2GPPA 4MG6A 4OZTE 2VV1B 2G44A 5EI1A 4OARA 2NXXA 1QKUA 2HWQA 2OM9A 1ZKYA 3VHVA 4J5WC 2ZXNA 1R5KA 3WFFA 4JGVA 4JAZA 3T03A 2IOKA 3KDUA 3KMRA 3AURA 4DM6A 2YLOA 2OCFA 1RDTD 3L3ZA 5HYRA 2VSRA 4ZJWA 3F5CB 3VT8A 3GWXA 3VT4A 2Q3YA 1E3KA 4G21A 1S9QA 4Q0AC 3MNPA 4G1YA 5KD9A 1A52A 4ONIA 3HZFA 3WT6A 1PK5A 4DK7A 5KCTA 1M2ZA 2YLPA 4IQRA 1XV9B 4QK4A 3QT0A 4IW8A 4IS8A 1MZNA 2AX6A 2Q7IA 2ZK3A 1NRLA 3IMYA 5KRCA 3CTBA 1N46A 5DUHA 1T76A 2P7ZA 2ZASA 1EXXA 1QKMA 4RMCA 2FVJA 3B67A 5DVVA 3W5PA 2J4AA 2AA6A 3UUAA 2NV7A 5JJMA 3MNEA 3PBAA 1XOWA 3B66A 5EC9A 3X1IA 5KRIA 3VT9A 3E94A 3IPQA 4DMAA 5AZTA 1XNNA 2I4PA 2ZK2A 4WPFA 3UP0A 1GWXA 4TUZB 1S19A 5KRHA 5KRLA 2LBDA 2OVHA 3BEJA 5DV3A 1L2IA 4X1GA 1KV6A 4OKTA 5DRJA 3VT5A 3IXPD 1E3GA 1Z5XU 2ATHA 2P7AA 2GIUA 1X7RA 4K7AA 5HYKA 2JJ3A 3DY6A 2PINA 4J26A 4E4KA 1ZUCA 3IXPA 3R8IA 1XAPA 5I4VA 1FCYA 1NQ1A 4UDAA 2NXXE 3A9EB 2OZ7A 3GYTA 5C4UA 4OK1A 2Q60A 4PPSA 1ZGYA 5DZ3A 3ET3A 1NQ7A 3OMOA 2AMAA 2GP7A 2QH6A 3VRUA 1OVLA 1LBDA 1ZEOA 4OFRA 3HM1A 3VRVA 4PP5A 3B0WA 3SP9A 2Q7LA 2ZL9A 3CJWA 1T7RA 3OMQA 5DP0A 3M7RA 2V0VA 4IU7A 3VSOA 2J7YA 5DWIA 1XDKA 4OIUA 3W0YA 3B1MA 5ACCA 3UUDA 1ILGA 3OGTA 5AWKA 3X1HA 3V9YA 1NAXA 5HJPA 3DR1A 3FC6A 3PEQA 4BCRA 5ICKA 2PIOA 2ABIA 3CS4A 4FHIA 5JJMB 3UUAB 4APUA 5CJ6A 2AA5A 1T73A 1PZLA 1YY4A 5K13A 1RKHA 4MG9B 3W5RA 3V4AA 5JI0D 5DXBB 2O4JA 2ZLAA 4LNWA 3F5CA 4WQPA 1ZH7A 3CWDA 3RLLA 2XHSA 3R8DA 1ILHA 4QE6A 4ZO1B 2B50A 3RVFA 5IXKA 1ZDUA 3PO9A 5DTVA 1Y0SA 5IAWA 2R6YA 5GIDA 3HLVA 1XV9A 3OKHA 4IVWA 3CS8A 2AYRA 4PRGA 1YJEA 5FQPA 3W0IA 2QA8A 2QW4A 4ITEA 1HG4A 3ZRAA 1A28A 2XKWA 2P1UA 1T79A 2AWHA 3RY9A 2VSTA 3IA6A 4G1ZA 5G42A 3ZR7A 2F4BA 5M96A 2ZNPA 3GN8A 4TV1A 3GBKA 4RUJA 1T63A 2Q70A 2ZK0A 4Q13A 2YFEA 3X31A 4EM9A 4S0SA 5DKEA 3FXVA 2HB8A 3B5RA 2GPVA 4PPPA 2B1VA 3B3KA 4XLDA 3OSAA 3DZUD 3OS8C 3OMKA 1YINA 1XQ3A 4B7WA 5B5BA 2JF9A 5DL4A 3VJHA 3DZUA 1XP9A 5C4OA 1U9EA 2Q1VA 3D5FA 2QE4A 5HJPB 5DUGA 1I37A 1NDEA 5KRAA 4OH6A 4FGYA 3W5TA 3GYUA 2Q6JA 3KMGA 3P8XA 4ZNUA 4N1YA 3A9EA 2PIPL 1UHLA 3OSWA 5E0WA 5DYBA 1FCXA 3A40X 1UPWA 2REWA 1YP0A 3UP3A 1T5ZA 2QGTA 4QL8A 2QR9A 5G44A 5DKBA 4RUPA 1NAVA 2GWXA 2Q5SA 1U3QA 3PCUA 1FBYA 3VJTA 2H79A 1RDTA 2I0GA 4PLDA 1K74D 2P1VA 3KFCA 4RWVA 2POBA 4ITFA 4YNKA 4OFUA 5DUEA 4L96A 1K74A 3H0AD 1ZAFA 4WHGA 5G5WA 2GTKA 2ZNQA 2QA8B 2GPUA 2E2RA 3H0AA 1P8DA 3KPZA 4K6IA 4IA7A 4N73A 3W5QA 4OILA 3VI8A 1G5YA 4XAOA 3PLZA 1K7LA 3AZ1A 2ZK1A 2QNVA 3E7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0X X;  2B1Z A;  3FEJ A;  2PIQ A;  4MG9 A;  4TV1 B;  3KYT A;  1G50 A;  4LBD A;  3VT7 A;  2HAS A;  3OMM A;  5DXB A;  4WHF A;  3VSP A;  3R2A A;  3OS9 A;  5DX3 B;  2QXM A;  3VJS A;  4JL4 A;  3OMP A;  5DLR A;  3RUT A;  5FQR A;  4J24 A;  5E19 A;  4IVY A;  3VT3 A;  1BSX A;  5DMC A;  3FEI A;  2BAW A;  5G3J A;  4IW6 A;  3R8A A;  1DB1 A;  2ACL B;  4OED A;  4PXM A;  5F9B A;  4M8H A;  2NW4 A;  4G2I A;  3D6D A;  1XQC A;  5DY8 A;  3P89 A;  5APK A;  3V3Q A;  3CQV A;  4RUO X;  3A2H A;  1PCG A;  5A86 A;  4HEE X;  3TKM A;  2G5O A;  2Q61 A;  2VV3 A;  1XJ7 A;  1UOM A;  4ZNS A;  2FSZ A;  5DVS A;  1Z5X E;  3B65 A;  5DXK A;  1UHL B;  4PWL A;  2YAT A;  2W8Y A;  5DYD A;  2PNU A;  3ADW A;  2Z4J A;  2Q6S A;  1TFC A;  1LV2 A;  1XZX X;  5G46 A;  3G8I A;  2ZVT A;  3B0Q A;  2VV0 A;  2ZNN A;  5E7V A;  3D24 A;  1FD0 A;  2EWP A;  2OAX A;  4UDD A;  5E1C A;  2V7C A;  5DIG A;  2PKL A;  4IA2 A;  3S9S A;  1YA3 A;  5EHJ A;  1XLS A;  3OSI A;  4IA3 A;  1R20 D;  4A4W A;  5KCE A;  3OLL A;  2BJ4 A;  4OEZ A;  2YJA B;  2Q7J A;  1OSV A;  2P7G A;  1R20 A;  5L7G A;  3OLS A;  2VV4 B;  3ADV A;  3B0T A;  2HB7 A;  3AX8 A;  3FUR A;  2QPY A;  5GT4 A;  3RUU A;  3A78 A;  2J7X A;  5AYG A;  5AAV B;  4OH5 A;  1RK3 A;  5KYA A;  3VTB A;  1PQ6 A;  2ZXM A;  3VT6 A;  4G2H A;  2Q1H A;  3H52 A;  3FAL A;  2Q8S A;  2G0G A;  2Q59 B;  1PQ9 A;  1R6G A;  2ZXZ A;  5G43 A;  3V3E A;  3VHU A;  3WFG A;  5KRO A;  5LWP A;  5DZ0 A;  3OAP A;  2IOG A;  3MNO A;  4K4J A;  3V9V A;  3OKI A;  2B23 A;  4ZNV A;  2O9I A;  4OEY A;  5AWJ A;  2IHQ A;  1M7W A;  4P6W A;  1H9U A;  4OC7 A;  5EJV A;  4A2J A;  1YYE A;  5FQT A;  3ERT A;  4UDC A;  5DZ1 A;  3DZY D;  1T7M A;  2P1T A;  4OHA A;  2ZKC A;  2AA7 A;  3ADT A;  1L2J A;  3R5M A;  4OJ4 A;  3A2J A;  2ZK4 A;  3DCT A;  3G9E A;  5AVL A;  3WT5 A;  5DMF A;  2ZNO A;  3HOD A;  4WVD A;  1S0X A;  5E0X A;  1K4W A;  2R40 D;  3WWR A;  4HLW A;  5SYZ A;  4PP6 A;  2PIX A;  5DWG A;  3TY0 A;  4YPQ A;  4MGB B;  5DI7 A;  5AZV A;  2R40 A;  2XYJ A;  4FN9 A;  1OSH A;  2PIU A;  3OLF A;  2ZMJ A;  4PF3 A;  3ADS A;  4R06 A;  2Q5G A;  2YLY A;  2H77 A;  2YJD A;  1SR7 A;  2QGW A;  4KZJ A;  1QKT A;  3W0C A;  3HO0 A;  3JZC A;  3L1B A;  2ZMH A;  1VJB A;  4R2U A;  5DX3 A;  5DKG A;  5FQV A;  5GIE A;  3ET1 A;  4REF A;  3JZB A;  1FM6 D;  4RFW A;  1XLS E;  5DRM A;  3TX7 B;  1U3R A;  2I4Z A;  2PRG A;  5E15 A;  5KYJ A;  3G8O A;  1TXI A;  1U3S A;  4ZN9 A;  2BJ4 B;  4A4V A;  2ACL A;  2HBH A;  2Q5P A;  4ZN7 A;  1SQN A;  3ET0 A;  1X7J A;  3ZRB A;  4EMA A;  4OLM A;  4LTW A;  2AX7 A;  4NB6 A;  3ADU A;  3WT7 A;  2FAI A;  5DXQ A;  5APJ A;  5KCD A;  3PRG A;  5DID A;  3VHW A;  2QXS A;  4N5G A;  3W0J A;  3FAL B;  4POH A;  4XHD A;  2VV2 A;  1NUO A;  1PDU A;  1P93 A;  1X78 A;  2ZLC A;  3LBD A;  3FLI A;  2I4J A;  2P15 A;  5AVI A;  2HCD A;  1ZDT A;  3Q95 B;  3KBA A;  1XB7 A;  2QTU A;  4QJR A;  1GWQ A;  1I7I A;  3UU7 B;  1RJK A;  1T7F A;  4IUI A;  4E4Q A;  3K22 A;  4M8E A;  3EYB A;  5APH A;  3V49 A;  4O8F A;  1DKF A;  1T65 A;  3VRT A;  3R5N A;  3G0W A;  4DOS A;  5JY3 A;  5AAU A;  4OZT U;  5EIT A;  3GWS X;  3AN3 A;  4YT1 A;  3O1D A;  2AX9 A;  4ZNH A;  2AMB A;  5L7E A;  2A3I A;  4L98 A;  4XT9 A;  2PJL A;  3FUG A;  4MG7 B;  5HJS A;  2VV4 A;  3A2I A;  1R1K D;  2PIR A;  2HFP A;  4OKX A;  2NPA A;  4R6S A;  4JYH A;  5DV8 A;  3CDS A;  4MG8 B;  5C4S A;  3SP6 A;  5AAV A;  5DXE A;  5DXR A;  2AB2 A;  1R1K A;  3HC6 A;  3OZJ A;  4IA1 A;  4S0T A;  4ZOM A;  4UDB A;  4PLE A;  3NOA A;  1FCZ A;  2Z4B A;  3O1E A;  2YLQ A;  2YHD A;  5DWE A;  4RE8 A;  4F9M A;  5KRF A;  2Q59 A;  4G1D A;  3R29 A;  1NQ2 A;  3NSP A;  3WTQ A;  3D57 A;  5ETH A;  4RZG A;  5KCW A;  1FM9 D;  4NIE A;  2ZK6 A;  3P0U A;  5B41 A;  3WJ4 A;  2ZFX A;  5DIE A;  1FM9 A;  3OOF A;  2GL8 A;  1XPC A;  3B0R A;  2OUZ A;  5KCU A;  1XP1 A;  4PP3 A;  4QM0 A;  4LNX A;  2ZY0 A;  2ZBS A;  5DZI A;  5G45 A;  1I38 A;  1HJ1 A;  1Z95 A;  1XNX A;  1GWR A;  3NSQ A;  4KZM A;  3AZ2 A;  3VJI A;  4ZJR A;  4MG5 A;  2P4Y A;  2AX8 A;  4ZI1 A;  5EGV A;  4FHH A;  4YMQ A;  4MGA A;  1RKG A;  4MGB A;  5L7H A;  3CLD A;  4IV2 A;  1N83 A;  5HCV A;  3UUC A;  2HAM A;  1NYX A;  2PIT A;  3L0L A;  4G20 A;  5DWL A;  2AAX A;  3ZQT A;  4DM8 A;  3WMH A;  5KR9 A;  4DOR A;  1UPV A;  1ERE A;  2QZO A;  1S9P A;  2HAR A;  4J5X A;  2QMV A;  2POG A;  1DKF B;  1X7B A;  3VTC A;  4JYG A;  1KKQ A;  1GS4 A;  3K6P A;  1S0Z A;  4QE8 A;  4MGD A;  3ILZ A;  3UVV B;  5KCF A;  2GPO A;  4J5X C;  5FQS A;  1N4H A;  5DV6 A;  4P6X A;  4PVU A;  3K23 A;  5H1E A;  1PQC A;  3ERD A;  3GD2 A;  1YMT A;  4JYI A;  4WLB A;  2Q6R A;  2P54 A;  3ADX A;  3WJ5 A;  3L03 A;  3U9Q A;  5DVC A;  2I0J A;  3AFR A;  3AN4 A;  2XYX A;  4OJB A;  3Q95 A;  4XUM A;  4Y29 A;  2HWR A;  3KMZ A;  4FNE A;  3UU7 A;  1SJ0 A;  4XTA A;  2G0H A;  1Q4X A;  1XP6 A;  1G1U A;  3BC5 A;  4REE A;  2QAB A;  4IV4 A;  4MDD A;  4NY9 A;  1KNU A;  3CDP A;  4NUF A;  3V9T A;  1WM0 X;  3A3Z X;  1XIU A;  2JFA A;  1ERR A;  3L0E A;  3CS6 A;  4IWF A;  2HVC A;  1OT7 A;  2PIV A;  4MGC A;  1YIM A;  3P88 A;  3W0H A;  3N00 A;  4OKW A;  5DSH A;  3W0A A;  3DZY A;  4OEA A;  1XVP A;  4DK8 A;  4MG7 A;  3DT3 A;  5DK9 A;  3GZ9 A;  1QKN A;  5DWJ A;  3X36 A;  4RZF A;  2VV1 A;  4CI5 A;  4MG8 A;  4LSJ A;  5KRK A;  4S15 A;  3E00 D;  1MV9 A;  4MGA B;  4RMD A;  3F7D A;  4OKB A;  5E14 A;  3WGP A;  3E00 A;  1I7G A;  3DCU A;  1M13 A;  5C4T A;  5KCC A;  3HVL A;  3W0G A;  4X1F A;  1MVC A;  1EXA A;  2XYW A;  3K8S A;  4N8R A;  3B68 A;  4OZR U;  4ZO1 X;  2QZO B;  4KZI A;  4RZE A;  4CSJ A;  4OJ9 A;  4Q50 A;  3VN2 A;  2J14 A;  1Y9R A;  4XI3 A;  1YOW A;  4ZNW A;  1NHZ A;  1PRG A;  1NQ0 A;  3LMP A;  4MGD B;  4RME A;  3OOK A;  4OZR E;  5IZ0 A;  3TKC A;  3IPU A;  1FM6 A;  3ET2 A;  1X7E A;  5DU5 A;  3VTD A;  1YOK A;  4E2J A;  3D90 A;  3AZ3 A;  2HC4 A;  3BQD A;  5LGA A;  2R6W A;  3KWY A;  5L11 A;  2O4R A;  3HQ5 A;  4OIV A;  5DKS A;  3HC5 A;  3RLJ A;  1G2N A;  1T74 A;  2AA2 A;  1YUC A;  2Q7K A;  3AUQ A;  4CI4 A;  2AO6 A;  4ZNT A;  4NQA B;  3L3X A;  1OVL B;  3OS8 A;  4OGH A;  4RAK A;  2QSE A;  2AM9 A;  3KDT A;  1SKX A;  4TUZ A;  2ZK5 A;  5AK2 A;  1XDK B;  2QA6 A;  3IPS A;  3FS1 A;  3AUN A;  5DXM A;  3OZ0 A;  5GIC A;  3UUD B;  4IWC A;  3L0J A;  4DQM A;  4POJ A;  4XUH A;  1IE9 A;  2JFA B;  1IE8 A;  1T7T A;  2AXA A;  3UVV A;  3FC6 B;  3SZ1 A;  2ZMI A;  4J5W A;  4S14 A;  1XVP B;  5DXP A;  1X76 A;  5DZH A;  3VRW A;  5KRJ A;  2PIW A;  5KRM A;  5HZC A;  2OVM A;  5DXG A;  2GPP A;  4MG6 A;  4OZT E;  2VV1 B;  2G44 A;  5EI1 A;  4OAR A;  2NXX A;  1QKU A;  2HWQ A;  2OM9 A;  1ZKY A;  3VHV A;  4J5W C;  2ZXN A;  1R5K A;  3WFF A;  4JGV A;  4JAZ A;  3T03 A;  2IOK A;  3KDU A;  3KMR A;  3AUR A;  4DM6 A;  2YLO A;  2OCF A;  1RDT D;  3L3Z A;  5HYR A;  2VSR A;  4ZJW A;  3F5C B;  3VT8 A;  3GWX A;  3VT4 A;  2Q3Y A;  1E3K A;  4G21 A;  1S9Q A;  4Q0A C;  3MNP A;  4G1Y A;  5KD9 A;  1A52 A;  4ONI A;  3HZF A;  3WT6 A;  1PK5 A;  4DK7 A;  5KCT A;  1M2Z A;  2YLP A;  4IQR A;  1XV9 B;  4QK4 A;  3QT0 A;  4IW8 A;  4IS8 A;  1MZN A;  2AX6 A;  2Q7I A;  2ZK3 A;  1NRL A;  3IMY A;  5KRC A;  3CTB A;  1N46 A;  5DUH A;  1T76 A;  2P7Z A;  2ZAS A;  1EXX A;  1QKM A;  4RMC A;  2FVJ A;  3B67 A;  5DVV A;  3W5P A;  2J4A A;  2AA6 A;  3UUA A;  2NV7 A;  5JJM A;  3MNE A;  3PBA A;  1XOW A;  3B66 A;  5EC9 A;  3X1I A;  5KRI A;  3VT9 A;  3E94 A;  3IPQ A;  4DMA A;  5AZT A;  1XNN A;  2I4P A;  2ZK2 A;  4WPF A;  3UP0 A;  1GWX A;  4TUZ B;  1S19 A;  5KRH A;  5KRL A;  2LBD A;  2OVH A;  3BEJ A;  5DV3 A;  1L2I A;  4X1G A;  1KV6 A;  4OKT A;  5DRJ A;  3VT5 A;  3IXP D;  1E3G A;  1Z5X U;  2ATH A;  2P7A A;  2GIU A;  1X7R A;  4K7A A;  5HYK A;  2JJ3 A;  3DY6 A;  2PIN A;  4J26 A;  4E4K A;  1ZUC A;  3IXP A;  3R8I A;  1XAP A;  5I4V A;  1FCY A;  1NQ1 A;  4UDA A;  2NXX E;  3A9E B;  2OZ7 A;  3GYT A;  5C4U A;  4OK1 A;  2Q60 A;  4PPS A;  1ZGY A;  5DZ3 A;  3ET3 A;  1NQ7 A;  3OMO A;  2AMA A;  2GP7 A;  2QH6 A;  3VRU A;  1OVL A;  1LBD A;  1ZEO A;  4OFR A;  3HM1 A;  3VRV A;  4PP5 A;  3B0W A;  3SP9 A;  2Q7L A;  2ZL9 A;  3CJW A;  1T7R A;  3OMQ A;  5DP0 A;  3M7R A;  2V0V A;  4IU7 A;  3VSO A;  2J7Y A;  5DWI A;  1XDK A;  4OIU A;  3W0Y A;  3B1M A;  5ACC A;  3UUD A;  1ILG A;  3OGT A;  5AWK A;  3X1H A;  3V9Y A;  1NAX A;  5HJP A;  3DR1 A;  3FC6 A;  3PEQ A;  4BCR A;  5ICK A;  2PIO A;  2ABI A;  3CS4 A;  4FHI A;  5JJM B;  3UUA B;  4APU A;  5CJ6 A;  2AA5 A;  1T73 A;  1PZL A;  1YY4 A;  5K13 A;  1RKH A;  4MG9 B;  3W5R A;  3V4A A;  5JI0 D;  5DXB B;  2O4J A;  2ZLA A;  4LNW A;  3F5C A;  4WQP A;  1ZH7 A;  3CWD A;  3RLL A;  2XHS A;  3R8D A;  1ILH A;  4QE6 A;  4ZO1 B;  2B50 A;  3RVF A;  5IXK A;  1ZDU A;  3PO9 A;  5DTV A;  1Y0S A;  5IAW A;  2R6Y A;  5GID A;  3HLV A;  1XV9 A;  3OKH A;  4IVW A;  3CS8 A;  2AYR A;  4PRG A;  1YJE A;  5FQP A;  3W0I A;  2QA8 A;  2QW4 A;  4ITE A;  1HG4 A;  3ZRA A;  1A28 A;  2XKW A;  2P1U A;  1T79 A;  2AWH A;  3RY9 A;  2VST A;  3IA6 A;  4G1Z A;  5G42 A;  3ZR7 A;  2F4B A;  5M96 A;  2ZNP A;  3GN8 A;  4TV1 A;  3GBK A;  4RUJ A;  1T63 A;  2Q70 A;  2ZK0 A;  4Q13 A;  2YFE A;  3X31 A;  4EM9 A;  4S0S A;  5DKE A;  3FXV A;  2HB8 A;  3B5R A;  2GPV A;  4PPP A;  2B1V A;  3B3K A;  4XLD A;  3OSA A;  3DZU D;  3OS8 C;  3OMK A;  1YIN A;  1XQ3 A;  4B7W A;  5B5B A;  2JF9 A;  5DL4 A;  3VJH A;  3DZU A;  1XP9 A;  5C4O A;  1U9E A;  2Q1V A;  3D5F A;  2QE4 A;  5HJP B;  5DUG A;  1I37 A;  1NDE A;  5KRA A;  4OH6 A;  4FGY A;  3W5T A;  3GYU A;  2Q6J A;  3KMG A;  3P8X A;  4ZNU A;  4N1Y A;  3A9E A;  2PIP L;  1UHL A;  3OSW A;  5E0W A;  5DYB A;  1FCX A;  3A40 X;  1UPW A;  2REW A;  1YP0 A;  3UP3 A;  1T5Z A;  2QGT A;  4QL8 A;  2QR9 A;  5G44 A;  5DKB A;  4RUP A;  1NAV A;  2GWX A;  2Q5S A;  1U3Q A;  3PCU A;  1FBY A;  3VJT A;  2H79 A;  1RDT A;  2I0G A;  4PLD A;  1K74 D;  2P1V A;  3KFC A;  4RWV A;  2POB A;  4ITF A;  4YNK A;  4OFU A;  5DUE A;  4L96 A;  1K74 A;  3H0A D;  1ZAF A;  4WHG A;  5G5W A;  2GTK A;  2ZNQ A;  2QA8 B;  2GPU A;  2E2R A;  3H0A A;  1P8D A;  3KPZ A;  4K6I A;  4IA7 A;  4N73 A;  3W5Q A;  4OIL A;  3VI8 A;  1G5Y A;  4XAO A;  3PLZ A;  1K7L A;  3AZ1 A;  2ZK1 A;  2QNV A;  3E7C A; 
#chains in the Genus database with same CATH topology
 1Y0X X;  2B1Z A;  3FEJ A;  2PIQ A;  4MG9 A;  4TV1 B;  3KYT A;  1G50 A;  4LBD A;  3VT7 A;  2HAS A;  3OMM A;  5DXB A;  4WHF A;  3VSP A;  3R2A A;  3OS9 A;  5DX3 B;  2QXM A;  3VJS A;  4JL4 A;  3OMP A;  5DLR A;  3RUT A;  5FQR A;  4J24 A;  5E19 A;  4IVY A;  3VT3 A;  1BSX A;  5DMC A;  3FEI A;  2BAW A;  5G3J A;  4IW6 A;  3R8A A;  1DB1 A;  2ACL B;  4OED A;  4PXM A;  5F9B A;  4M8H A;  2NW4 A;  4G2I A;  3D6D A;  1XQC A;  5DY8 A;  3P89 A;  5APK A;  3V3Q A;  3CQV A;  4RUO X;  3A2H A;  1PCG A;  5A86 A;  4HEE X;  3TKM A;  2G5O A;  2Q61 A;  2VV3 A;  1XJ7 A;  1UOM A;  4ZNS A;  2FSZ A;  5DVS A;  1Z5X E;  3B65 A;  5DXK A;  1UHL B;  4PWL A;  2YAT A;  2W8Y A;  5DYD A;  2PNU A;  3ADW A;  2Z4J A;  2Q6S A;  1TFC A;  1LV2 A;  1XZX X;  5G46 A;  3G8I A;  2ZVT A;  3B0Q A;  2VV0 A;  2ZNN A;  5E7V A;  3D24 A;  1FD0 A;  2EWP A;  2OAX A;  4UDD A;  5E1C A;  2V7C A;  5DIG A;  2PKL A;  4IA2 A;  3S9S A;  1YA3 A;  5EHJ A;  1XLS A;  3OSI A;  4IA3 A;  1R20 D;  4A4W A;  5KCE A;  3OLL A;  2BJ4 A;  4OEZ A;  2YJA B;  2Q7J A;  1OSV A;  2P7G A;  1R20 A;  5L7G A;  3OLS A;  2VV4 B;  3ADV A;  3B0T A;  2HB7 A;  3AX8 A;  3FUR A;  2QPY A;  5GT4 A;  3RUU A;  3A78 A;  2J7X A;  5AYG A;  5AAV B;  4OH5 A;  1RK3 A;  5KYA A;  3VTB A;  1PQ6 A;  2ZXM A;  3VT6 A;  4G2H A;  2Q1H A;  3H52 A;  3FAL A;  2Q8S A;  2G0G A;  2Q59 B;  1PQ9 A;  1R6G A;  2ZXZ A;  5G43 A;  3V3E A;  3VHU A;  3WFG A;  5KRO A;  5LWP A;  5DZ0 A;  3OAP A;  2IOG A;  3MNO A;  4K4J A;  3V9V A;  3OKI A;  2B23 A;  4ZNV A;  2O9I A;  4OEY A;  5AWJ A;  2IHQ A;  1M7W A;  4P6W A;  1H9U A;  4OC7 A;  5EJV A;  4A2J A;  1YYE A;  5FQT A;  3ERT A;  4UDC A;  5DZ1 A;  3DZY D;  1T7M A;  2P1T A;  4OHA A;  2ZKC A;  2AA7 A;  3ADT A;  1L2J A;  3R5M A;  4OJ4 A;  3A2J A;  2ZK4 A;  3DCT A;  3G9E A;  5AVL A;  3WT5 A;  5DMF A;  2ZNO A;  3HOD A;  4WVD A;  1S0X A;  5E0X A;  1K4W A;  2R40 D;  3WWR A;  4HLW A;  5SYZ A;  4PP6 A;  2PIX A;  5DWG A;  3TY0 A;  4YPQ A;  4MGB B;  5DI7 A;  5AZV A;  2R40 A;  2XYJ A;  4FN9 A;  1OSH A;  2PIU A;  3OLF A;  2ZMJ A;  4PF3 A;  3ADS A;  4R06 A;  2Q5G A;  2YLY A;  2H77 A;  2YJD A;  1SR7 A;  2QGW A;  4KZJ A;  1QKT A;  3W0C A;  3HO0 A;  3JZC A;  3L1B A;  2ZMH A;  1VJB A;  4R2U A;  5DX3 A;  5DKG A;  5FQV A;  5GIE A;  3ET1 A;  4REF A;  3JZB A;  1FM6 D;  4RFW A;  1XLS E;  5DRM A;  3TX7 B;  1U3R A;  2I4Z A;  2PRG A;  5E15 A;  5KYJ A;  3G8O A;  1TXI A;  1U3S A;  4ZN9 A;  2BJ4 B;  4A4V A;  2ACL A;  2HBH A;  2Q5P A;  4ZN7 A;  1SQN A;  3ET0 A;  1X7J A;  3ZRB A;  4EMA A;  4OLM A;  4LTW A;  2AX7 A;  4NB6 A;  3ADU A;  3WT7 A;  2FAI A;  5DXQ A;  5APJ A;  5KCD A;  3PRG A;  5DID A;  3VHW A;  2QXS A;  4N5G A;  3W0J A;  3FAL B;  4POH A;  4XHD A;  2VV2 A;  1NUO A;  1PDU A;  1P93 A;  1X78 A;  2ZLC A;  3LBD A;  3FLI A;  2I4J A;  2P15 A;  5AVI A;  2HCD A;  1ZDT A;  3Q95 B;  3KBA A;  1XB7 A;  2QTU A;  4QJR A;  1GWQ A;  1I7I A;  3UU7 B;  1RJK A;  1T7F A;  4IUI A;  4E4Q A;  3K22 A;  4M8E A;  3EYB A;  5APH A;  3V49 A;  4O8F A;  1DKF A;  1T65 A;  3VRT A;  3R5N A;  3G0W A;  4DOS A;  5JY3 A;  5AAU A;  4OZT U;  5EIT A;  3GWS X;  3AN3 A;  4YT1 A;  3O1D A;  2AX9 A;  4ZNH A;  2AMB A;  5L7E A;  2A3I A;  4L98 A;  4XT9 A;  2PJL A;  3FUG A;  4MG7 B;  5HJS A;  2VV4 A;  3A2I A;  1R1K D;  2PIR A;  2HFP A;  4OKX A;  2NPA A;  4R6S A;  4JYH A;  5DV8 A;  3CDS A;  4MG8 B;  5C4S A;  3SP6 A;  5AAV A;  5DXE A;  5DXR A;  2AB2 A;  1R1K A;  3HC6 A;  3OZJ A;  4IA1 A;  4S0T A;  4ZOM A;  4UDB A;  4PLE A;  3NOA A;  1FCZ A;  2Z4B A;  3O1E A;  2YLQ A;  2YHD A;  5DWE A;  4RE8 A;  4F9M A;  5KRF A;  2Q59 A;  4G1D A;  3R29 A;  1NQ2 A;  3NSP A;  3WTQ A;  3D57 A;  5ETH A;  4RZG A;  5KCW A;  1FM9 D;  4NIE A;  2ZK6 A;  3P0U A;  5B41 A;  3WJ4 A;  2ZFX A;  5DIE A;  1FM9 A;  3OOF A;  2GL8 A;  1XPC A;  3B0R A;  2OUZ A;  5KCU A;  1XP1 A;  4PP3 A;  4QM0 A;  4LNX A;  2ZY0 A;  2ZBS A;  5DZI A;  5G45 A;  1I38 A;  1HJ1 A;  1Z95 A;  1XNX A;  1GWR A;  3NSQ A;  4KZM A;  3AZ2 A;  3VJI A;  4ZJR A;  4MG5 A;  2P4Y A;  2AX8 A;  4ZI1 A;  5EGV A;  4FHH A;  4YMQ A;  4MGA A;  1RKG A;  4MGB A;  5L7H A;  3CLD A;  4IV2 A;  1N83 A;  5HCV A;  3UUC A;  2HAM A;  1NYX A;  2PIT A;  3L0L A;  4G20 A;  5DWL A;  2AAX A;  3ZQT A;  4DM8 A;  3WMH A;  5KR9 A;  4DOR A;  1UPV A;  1ERE A;  2QZO A;  1S9P A;  2HAR A;  4J5X A;  2QMV A;  2POG A;  1DKF B;  1X7B A;  3VTC A;  4JYG A;  1KKQ A;  1GS4 A;  3K6P A;  1S0Z A;  4QE8 A;  4MGD A;  3ILZ A;  3UVV B;  5KCF A;  2GPO A;  4J5X C;  5FQS A;  1N4H A;  5DV6 A;  4P6X A;  4PVU A;  3K23 A;  5H1E A;  1PQC A;  3ERD A;  3GD2 A;  1YMT A;  4JYI A;  4WLB A;  2Q6R A;  2P54 A;  3ADX A;  3WJ5 A;  3L03 A;  3U9Q A;  5DVC A;  2I0J A;  3AFR A;  3AN4 A;  2XYX A;  4OJB A;  3Q95 A;  4XUM A;  4Y29 A;  2HWR A;  3KMZ A;  4FNE A;  3UU7 A;  1SJ0 A;  4XTA A;  2G0H A;  1Q4X A;  1XP6 A;  1G1U A;  3BC5 A;  4REE A;  2QAB A;  4IV4 A;  4MDD A;  4NY9 A;  1KNU A;  3CDP A;  4NUF A;  3V9T A;  1WM0 X;  3A3Z X;  1XIU A;  2JFA A;  1ERR A;  3L0E A;  3CS6 A;  4IWF A;  2HVC A;  1OT7 A;  2PIV A;  4MGC A;  1YIM A;  3P88 A;  3W0H A;  3N00 A;  4OKW A;  5DSH A;  3W0A A;  3DZY A;  4OEA A;  1XVP A;  4DK8 A;  4MG7 A;  3DT3 A;  5DK9 A;  3GZ9 A;  1QKN A;  5DWJ A;  3X36 A;  4RZF A;  2VV1 A;  4CI5 A;  4MG8 A;  4LSJ A;  5KRK A;  4S15 A;  3E00 D;  1MV9 A;  4MGA B;  4RMD A;  3F7D A;  4OKB A;  5E14 A;  3WGP A;  3E00 A;  1I7G A;  3DCU A;  1M13 A;  5C4T A;  5KCC A;  3HVL A;  3W0G A;  4X1F A;  1MVC A;  1EXA A;  2XYW A;  3K8S A;  4N8R A;  3B68 A;  4OZR U;  4ZO1 X;  2QZO B;  4KZI A;  4RZE A;  4CSJ A;  4OJ9 A;  4Q50 A;  3VN2 A;  2J14 A;  1Y9R A;  4XI3 A;  1YOW A;  4ZNW A;  1NHZ A;  1PRG A;  1NQ0 A;  3LMP A;  4MGD B;  4RME A;  3OOK A;  4OZR E;  5IZ0 A;  3TKC A;  3IPU A;  1FM6 A;  3ET2 A;  1X7E A;  5DU5 A;  3VTD A;  1YOK A;  4E2J A;  3D90 A;  3AZ3 A;  2HC4 A;  3BQD A;  5LGA A;  2R6W A;  3KWY A;  5L11 A;  2O4R A;  3HQ5 A;  4OIV A;  5DKS A;  3HC5 A;  3RLJ A;  1G2N A;  1T74 A;  2AA2 A;  1YUC A;  2Q7K A;  3AUQ A;  4CI4 A;  2AO6 A;  4ZNT A;  4NQA B;  3L3X A;  1OVL B;  3OS8 A;  4OGH A;  4RAK A;  2QSE A;  2AM9 A;  3KDT A;  1SKX A;  4TUZ A;  2ZK5 A;  5AK2 A;  1XDK B;  2QA6 A;  3IPS A;  3FS1 A;  3AUN A;  5DXM A;  3OZ0 A;  5GIC A;  3UUD B;  4IWC A;  3L0J A;  4DQM A;  4POJ A;  4XUH A;  1IE9 A;  2JFA B;  1IE8 A;  1T7T A;  2AXA A;  3UVV A;  3FC6 B;  3SZ1 A;  2ZMI A;  4J5W A;  4S14 A;  1XVP B;  5DXP A;  1X76 A;  5DZH A;  3VRW A;  5KRJ A;  2PIW A;  5KRM A;  5HZC A;  2OVM A;  5DXG A;  2GPP A;  4MG6 A;  4OZT E;  2VV1 B;  2G44 A;  5EI1 A;  4OAR A;  2NXX A;  1QKU A;  2HWQ A;  2OM9 A;  1ZKY A;  3VHV A;  4J5W C;  2ZXN A;  1R5K A;  3WFF A;  4JGV A;  4JAZ A;  3T03 A;  2IOK A;  3KDU A;  3KMR A;  3AUR A;  4DM6 A;  2YLO A;  2OCF A;  1RDT D;  3L3Z A;  5HYR A;  2VSR A;  4ZJW A;  3F5C B;  3VT8 A;  3GWX A;  3VT4 A;  2Q3Y A;  1E3K A;  4G21 A;  1S9Q A;  4Q0A C;  3MNP A;  4G1Y A;  5KD9 A;  1A52 A;  4ONI A;  3HZF A;  3WT6 A;  1PK5 A;  4DK7 A;  5KCT A;  1M2Z A;  2YLP A;  4IQR A;  1XV9 B;  4QK4 A;  3QT0 A;  4IW8 A;  4IS8 A;  1MZN A;  2AX6 A;  2Q7I A;  2ZK3 A;  1NRL A;  3IMY A;  5KRC A;  3CTB A;  1N46 A;  5DUH A;  1T76 A;  2P7Z A;  2ZAS A;  1EXX A;  1QKM A;  4RMC A;  2FVJ A;  3B67 A;  5DVV A;  3W5P A;  2J4A A;  2AA6 A;  3UUA A;  2NV7 A;  5JJM A;  3MNE A;  3PBA A;  1XOW A;  3B66 A;  5EC9 A;  3X1I A;  5KRI A;  3VT9 A;  3E94 A;  3IPQ A;  4DMA A;  5AZT A;  1XNN A;  2I4P A;  2ZK2 A;  4WPF A;  3UP0 A;  1GWX A;  4TUZ B;  1S19 A;  5KRH A;  5KRL A;  2LBD A;  2OVH A;  3BEJ A;  5DV3 A;  1L2I A;  4X1G A;  1KV6 A;  4OKT A;  5DRJ A;  3VT5 A;  3IXP D;  1E3G A;  1Z5X U;  2ATH A;  2P7A A;  2GIU A;  1X7R A;  4K7A A;  5HYK A;  2JJ3 A;  3DY6 A;  2PIN A;  4J26 A;  4E4K A;  1ZUC A;  3IXP A;  3R8I A;  1XAP A;  5I4V A;  1FCY A;  1NQ1 A;  4UDA A;  2NXX E;  3A9E B;  2OZ7 A;  3GYT A;  5C4U A;  4OK1 A;  2Q60 A;  4PPS A;  1ZGY A;  5DZ3 A;  3ET3 A;  1NQ7 A;  3OMO A;  2AMA A;  2GP7 A;  2QH6 A;  3VRU A;  1OVL A;  1LBD A;  1ZEO A;  4OFR A;  3HM1 A;  3VRV A;  4PP5 A;  3B0W A;  3SP9 A;  2Q7L A;  2ZL9 A;  3CJW A;  1T7R A;  3OMQ A;  5DP0 A;  3M7R A;  2V0V A;  4IU7 A;  3VSO A;  2J7Y A;  5DWI A;  1XDK A;  4OIU A;  3W0Y A;  3B1M A;  5ACC A;  3UUD A;  1ILG A;  3OGT A;  5AWK A;  3X1H A;  3V9Y A;  1NAX A;  5HJP A;  3DR1 A;  3FC6 A;  3PEQ A;  4BCR A;  5ICK A;  2PIO A;  2ABI A;  3CS4 A;  4FHI A;  5JJM B;  3UUA B;  4APU A;  5CJ6 A;  2AA5 A;  1T73 A;  1PZL A;  1YY4 A;  5K13 A;  1RKH A;  4MG9 B;  3W5R A;  3V4A A;  5JI0 D;  5DXB B;  2O4J A;  2ZLA A;  4LNW A;  3F5C A;  4WQP A;  1ZH7 A;  3CWD A;  3RLL A;  2XHS A;  3R8D A;  1ILH A;  4QE6 A;  4ZO1 B;  2B50 A;  3RVF A;  5IXK A;  1ZDU A;  3PO9 A;  5DTV A;  1Y0S A;  5IAW A;  2R6Y A;  5GID A;  3HLV A;  1XV9 A;  3OKH A;  4IVW A;  3CS8 A;  2AYR A;  4PRG A;  1YJE A;  5FQP A;  3W0I A;  2QA8 A;  2QW4 A;  4ITE A;  1HG4 A;  3ZRA A;  1A28 A;  2XKW A;  2P1U A;  1T79 A;  2AWH A;  3RY9 A;  2VST A;  3IA6 A;  4G1Z A;  5G42 A;  3ZR7 A;  2F4B A;  5M96 A;  2ZNP A;  3GN8 A;  4TV1 A;  3GBK A;  4RUJ A;  1T63 A;  2Q70 A;  2ZK0 A;  4Q13 A;  2YFE A;  3X31 A;  4EM9 A;  4S0S A;  5DKE A;  3FXV A;  2HB8 A;  3B5R A;  2GPV A;  4PPP A;  2B1V A;  3B3K A;  4XLD A;  3OSA A;  3DZU D;  3OS8 C;  3OMK A;  1YIN A;  1XQ3 A;  4B7W A;  5B5B A;  2JF9 A;  5DL4 A;  3VJH A;  3DZU A;  1XP9 A;  5C4O A;  1U9E A;  2Q1V A;  3D5F A;  2QE4 A;  5HJP B;  5DUG A;  1I37 A;  1NDE A;  5KRA A;  4OH6 A;  4FGY A;  3W5T A;  3GYU A;  2Q6J A;  3KMG A;  3P8X A;  4ZNU A;  4N1Y A;  3A9E A;  2PIP L;  1UHL A;  3OSW A;  5E0W A;  5DYB A;  1FCX A;  3A40 X;  1UPW A;  2REW A;  1YP0 A;  3UP3 A;  1T5Z A;  2QGT A;  4QL8 A;  2QR9 A;  5G44 A;  5DKB A;  4RUP A;  1NAV A;  2GWX A;  2Q5S A;  1U3Q A;  3PCU A;  1FBY A;  3VJT A;  2H79 A;  1RDT A;  2I0G A;  4PLD A;  1K74 D;  2P1V A;  3KFC A;  4RWV A;  2POB A;  4ITF A;  4YNK A;  4OFU A;  5DUE A;  4L96 A;  1K74 A;  3H0A D;  1ZAF A;  4WHG A;  5G5W A;  2GTK A;  2ZNQ A;  2QA8 B;  2GPU A;  2E2R A;  3H0A A;  1P8D A;  3KPZ A;  4K6I A;  4IA7 A;  4N73 A;  3W5Q A;  4OIL A;  3VI8 A;  1G5Y A;  4XAO A;  3PLZ A;  1K7L A;  3AZ1 A;  2ZK1 A;  2QNV A;  3E7C A; 
#chains in the Genus database with same CATH homology
 1Y0X X;  2B1Z A;  3FEJ A;  2PIQ A;  4MG9 A;  4TV1 B;  3KYT A;  1G50 A;  4LBD A;  3VT7 A;  2HAS A;  3OMM A;  5DXB A;  4WHF A;  3VSP A;  3R2A A;  3OS9 A;  5DX3 B;  2QXM A;  3VJS A;  4JL4 A;  3OMP A;  5DLR A;  3RUT A;  5FQR A;  4J24 A;  5E19 A;  4IVY A;  3VT3 A;  1BSX A;  5DMC A;  3FEI A;  2BAW A;  5G3J A;  4IW6 A;  3R8A A;  1DB1 A;  2ACL B;  4OED A;  4PXM A;  5F9B A;  4M8H A;  2NW4 A;  4G2I A;  3D6D A;  1XQC A;  5DY8 A;  3P89 A;  5APK A;  3V3Q A;  3CQV A;  4RUO X;  3A2H A;  1PCG A;  5A86 A;  4HEE X;  3TKM A;  2G5O A;  2Q61 A;  2VV3 A;  1XJ7 A;  1UOM A;  4ZNS A;  2FSZ A;  5DVS A;  1Z5X E;  3B65 A;  5DXK A;  1UHL B;  4PWL A;  2YAT A;  2W8Y A;  5DYD A;  2PNU A;  3ADW A;  2Z4J A;  2Q6S A;  1TFC A;  1LV2 A;  1XZX X;  5G46 A;  3G8I A;  2ZVT A;  3B0Q A;  2VV0 A;  2ZNN A;  5E7V A;  3D24 A;  1FD0 A;  2EWP A;  2OAX A;  4UDD A;  5E1C A;  2V7C A;  5DIG A;  2PKL A;  4IA2 A;  3S9S A;  1YA3 A;  5EHJ A;  1XLS A;  3OSI A;  4IA3 A;  1R20 D;  4A4W A;  5KCE A;  3OLL A;  2BJ4 A;  4OEZ A;  2YJA B;  2Q7J A;  1OSV A;  2P7G A;  1R20 A;  5L7G A;  3OLS A;  2VV4 B;  3ADV A;  3B0T A;  2HB7 A;  3AX8 A;  3FUR A;  2QPY A;  5GT4 A;  3RUU A;  3A78 A;  2J7X A;  5AYG A;  5AAV B;  4OH5 A;  1RK3 A;  5KYA A;  3VTB A;  1PQ6 A;  2ZXM A;  3VT6 A;  4G2H A;  2Q1H A;  3H52 A;  3FAL A;  2Q8S A;  2G0G A;  2Q59 B;  1PQ9 A;  1R6G A;  2ZXZ A;  5G43 A;  3V3E A;  3VHU A;  3WFG A;  5KRO A;  5LWP A;  5DZ0 A;  3OAP A;  2IOG A;  3MNO A;  4K4J A;  3V9V A;  3OKI A;  2B23 A;  4ZNV A;  2O9I A;  4OEY A;  5AWJ A;  2IHQ A;  1M7W A;  4P6W A;  1H9U A;  4OC7 A;  5EJV A;  4A2J A;  1YYE A;  5FQT A;  3ERT A;  4UDC A;  5DZ1 A;  3DZY D;  1T7M A;  2P1T A;  4OHA A;  2ZKC A;  2AA7 A;  3ADT A;  1L2J A;  3R5M A;  4OJ4 A;  3A2J A;  2ZK4 A;  3DCT A;  3G9E A;  5AVL A;  3WT5 A;  5DMF A;  2ZNO A;  3HOD A;  4WVD A;  1S0X A;  5E0X A;  1K4W A;  2R40 D;  3WWR A;  4HLW A;  5SYZ A;  4PP6 A;  2PIX A;  5DWG A;  3TY0 A;  4YPQ A;  4MGB B;  5DI7 A;  5AZV A;  2R40 A;  2XYJ A;  4FN9 A;  1OSH A;  2PIU A;  3OLF A;  2ZMJ A;  4PF3 A;  3ADS A;  4R06 A;  2Q5G A;  2YLY A;  2H77 A;  2YJD A;  1SR7 A;  2QGW A;  4KZJ A;  1QKT A;  3W0C A;  3HO0 A;  3JZC A;  3L1B A;  2ZMH A;  1VJB A;  4R2U A;  5DX3 A;  5DKG A;  5FQV A;  5GIE A;  3ET1 A;  4REF A;  3JZB A;  1FM6 D;  4RFW A;  1XLS E;  5DRM A;  3TX7 B;  1U3R A;  2I4Z A;  2PRG A;  5E15 A;  5KYJ A;  3G8O A;  1TXI A;  1U3S A;  4ZN9 A;  2BJ4 B;  4A4V A;  2ACL A;  2HBH A;  2Q5P A;  4ZN7 A;  1SQN A;  3ET0 A;  1X7J A;  3ZRB A;  4EMA A;  4OLM A;  4LTW A;  2AX7 A;  4NB6 A;  3ADU A;  3WT7 A;  2FAI A;  5DXQ A;  5APJ A;  5KCD A;  3PRG A;  5DID A;  3VHW A;  2QXS A;  4N5G A;  3W0J A;  3FAL B;  4POH A;  4XHD A;  2VV2 A;  1NUO A;  1PDU A;  1P93 A;  1X78 A;  2ZLC A;  3LBD A;  3FLI A;  2I4J A;  2P15 A;  5AVI A;  2HCD A;  1ZDT A;  3Q95 B;  3KBA A;  1XB7 A;  2QTU A;  4QJR A;  1GWQ A;  1I7I A;  3UU7 B;  1RJK A;  1T7F A;  4IUI A;  4E4Q A;  3K22 A;  4M8E A;  3EYB A;  5APH A;  3V49 A;  4O8F A;  1DKF A;  1T65 A;  3VRT A;  3R5N A;  3G0W A;  4DOS A;  5JY3 A;  5AAU A;  4OZT U;  5EIT A;  3GWS X;  3AN3 A;  4YT1 A;  3O1D A;  2AX9 A;  4ZNH A;  2AMB A;  5L7E A;  2A3I A;  4L98 A;  4XT9 A;  2PJL A;  3FUG A;  4MG7 B;  5HJS A;  2VV4 A;  3A2I A;  1R1K D;  2PIR A;  2HFP A;  4OKX A;  2NPA A;  4R6S A;  4JYH A;  5DV8 A;  3CDS A;  4MG8 B;  5C4S A;  3SP6 A;  5AAV A;  5DXE A;  5DXR A;  2AB2 A;  1R1K A;  3HC6 A;  3OZJ A;  4IA1 A;  4S0T A;  4ZOM A;  4UDB A;  4PLE A;  3NOA A;  1FCZ A;  2Z4B A;  3O1E A;  2YLQ A;  2YHD A;  5DWE A;  4RE8 A;  4F9M A;  5KRF A;  2Q59 A;  4G1D A;  3R29 A;  1NQ2 A;  3NSP A;  3WTQ A;  3D57 A;  5ETH A;  4RZG A;  5KCW A;  1FM9 D;  4NIE A;  2ZK6 A;  3P0U A;  5B41 A;  3WJ4 A;  2ZFX A;  5DIE A;  1FM9 A;  3OOF A;  2GL8 A;  1XPC A;  3B0R A;  2OUZ A;  5KCU A;  1XP1 A;  4PP3 A;  4QM0 A;  4LNX A;  2ZY0 A;  2ZBS A;  5DZI A;  5G45 A;  1I38 A;  1HJ1 A;  1Z95 A;  1XNX A;  1GWR A;  3NSQ A;  4KZM A;  3AZ2 A;  3VJI A;  4ZJR A;  4MG5 A;  2P4Y A;  2AX8 A;  4ZI1 A;  5EGV A;  4FHH A;  4YMQ A;  4MGA A;  1RKG A;  4MGB A;  5L7H A;  3CLD A;  4IV2 A;  1N83 A;  5HCV A;  3UUC A;  2HAM A;  1NYX A;  2PIT A;  3L0L A;  4G20 A;  5DWL A;  2AAX A;  3ZQT A;  4DM8 A;  3WMH A;  5KR9 A;  4DOR A;  1UPV A;  1ERE A;  2QZO A;  1S9P A;  2HAR A;  4J5X A;  2QMV A;  2POG A;  1DKF B;  1X7B A;  3VTC A;  4JYG A;  1KKQ A;  1GS4 A;  3K6P A;  1S0Z A;  4QE8 A;  4MGD A;  3ILZ A;  3UVV B;  5KCF A;  2GPO A;  4J5X C;  5FQS A;  1N4H A;  5DV6 A;  4P6X A;  4PVU A;  3K23 A;  5H1E A;  1PQC A;  3ERD A;  3GD2 A;  1YMT A;  4JYI A;  4WLB A;  2Q6R A;  2P54 A;  3ADX A;  3WJ5 A;  3L03 A;  3U9Q A;  5DVC A;  2I0J A;  3AFR A;  3AN4 A;  2XYX A;  4OJB A;  3Q95 A;  4XUM A;  4Y29 A;  2HWR A;  3KMZ A;  4FNE A;  3UU7 A;  1SJ0 A;  4XTA A;  2G0H A;  1Q4X A;  1XP6 A;  1G1U A;  3BC5 A;  4REE A;  2QAB A;  4IV4 A;  4MDD A;  4NY9 A;  1KNU A;  3CDP A;  4NUF A;  3V9T A;  1WM0 X;  3A3Z X;  1XIU A;  2JFA A;  1ERR A;  3L0E A;  3CS6 A;  4IWF A;  2HVC A;  1OT7 A;  2PIV A;  4MGC A;  1YIM A;  3P88 A;  3W0H A;  3N00 A;  4OKW A;  5DSH A;  3W0A A;  3DZY A;  4OEA A;  1XVP A;  4DK8 A;  4MG7 A;  3DT3 A;  5DK9 A;  3GZ9 A;  1QKN A;  5DWJ A;  3X36 A;  4RZF A;  2VV1 A;  4CI5 A;  4MG8 A;  4LSJ A;  5KRK A;  4S15 A;  3E00 D;  1MV9 A;  4MGA B;  4RMD A;  3F7D A;  4OKB A;  5E14 A;  3WGP A;  3E00 A;  1I7G A;  3DCU A;  1M13 A;  5C4T A;  5KCC A;  3HVL A;  3W0G A;  4X1F A;  1MVC A;  1EXA A;  2XYW A;  3K8S A;  4N8R A;  3B68 A;  4OZR U;  4ZO1 X;  2QZO B;  4KZI A;  4RZE A;  4CSJ A;  4OJ9 A;  4Q50 A;  3VN2 A;  2J14 A;  1Y9R A;  4XI3 A;  1YOW A;  4ZNW A;  1NHZ A;  1PRG A;  1NQ0 A;  3LMP A;  4MGD B;  4RME A;  3OOK A;  4OZR E;  5IZ0 A;  3TKC A;  3IPU A;  1FM6 A;  3ET2 A;  1X7E A;  5DU5 A;  3VTD A;  1YOK A;  4E2J A;  3D90 A;  3AZ3 A;  2HC4 A;  3BQD A;  5LGA A;  2R6W A;  3KWY A;  5L11 A;  2O4R A;  3HQ5 A;  4OIV A;  5DKS A;  3HC5 A;  3RLJ A;  1G2N A;  1T74 A;  2AA2 A;  1YUC A;  2Q7K A;  3AUQ A;  4CI4 A;  2AO6 A;  4ZNT A;  4NQA B;  3L3X A;  1OVL B;  3OS8 A;  4OGH A;  4RAK A;  2QSE A;  2AM9 A;  3KDT A;  1SKX A;  4TUZ A;  2ZK5 A;  5AK2 A;  1XDK B;  2QA6 A;  3IPS A;  3FS1 A;  3AUN A;  5DXM A;  3OZ0 A;  5GIC A;  3UUD B;  4IWC A;  3L0J A;  4DQM A;  4POJ A;  4XUH A;  1IE9 A;  2JFA B;  1IE8 A;  1T7T A;  2AXA A;  3UVV A;  3FC6 B;  3SZ1 A;  2ZMI A;  4J5W A;  4S14 A;  1XVP B;  5DXP A;  1X76 A;  5DZH A;  3VRW A;  5KRJ A;  2PIW A;  5KRM A;  5HZC A;  2OVM A;  5DXG A;  2GPP A;  4MG6 A;  4OZT E;  2VV1 B;  2G44 A;  5EI1 A;  4OAR A;  2NXX A;  1QKU A;  2HWQ A;  2OM9 A;  1ZKY A;  3VHV A;  4J5W C;  2ZXN A;  1R5K A;  3WFF A;  4JGV A;  4JAZ A;  3T03 A;  2IOK A;  3KDU A;  3KMR A;  3AUR A;  4DM6 A;  2YLO A;  2OCF A;  1RDT D;  3L3Z A;  5HYR A;  2VSR A;  4ZJW A;  3F5C B;  3VT8 A;  3GWX A;  3VT4 A;  2Q3Y A;  1E3K A;  4G21 A;  1S9Q A;  4Q0A C;  3MNP A;  4G1Y A;  5KD9 A;  1A52 A;  4ONI A;  3HZF A;  3WT6 A;  1PK5 A;  4DK7 A;  5KCT A;  1M2Z A;  2YLP A;  4IQR A;  1XV9 B;  4QK4 A;  3QT0 A;  4IW8 A;  4IS8 A;  1MZN A;  2AX6 A;  2Q7I A;  2ZK3 A;  1NRL A;  3IMY A;  5KRC A;  3CTB A;  1N46 A;  5DUH A;  1T76 A;  2P7Z A;  2ZAS A;  1EXX A;  1QKM A;  4RMC A;  2FVJ A;  3B67 A;  5DVV A;  3W5P A;  2J4A A;  2AA6 A;  3UUA A;  2NV7 A;  5JJM A;  3MNE A;  3PBA A;  1XOW A;  3B66 A;  5EC9 A;  3X1I A;  5KRI A;  3VT9 A;  3E94 A;  3IPQ A;  4DMA A;  5AZT A;  1XNN A;  2I4P A;  2ZK2 A;  4WPF A;  3UP0 A;  1GWX A;  4TUZ B;  1S19 A;  5KRH A;  5KRL A;  2LBD A;  2OVH A;  3BEJ A;  5DV3 A;  1L2I A;  4X1G A;  1KV6 A;  4OKT A;  5DRJ A;  3VT5 A;  3IXP D;  1E3G A;  1Z5X U;  2ATH A;  2P7A A;  2GIU A;  1X7R A;  4K7A A;  5HYK A;  2JJ3 A;  3DY6 A;  2PIN A;  4J26 A;  4E4K A;  1ZUC A;  3IXP A;  3R8I A;  1XAP A;  5I4V A;  1FCY A;  1NQ1 A;  4UDA A;  2NXX E;  3A9E B;  2OZ7 A;  3GYT A;  5C4U A;  4OK1 A;  2Q60 A;  4PPS A;  1ZGY A;  5DZ3 A;  3ET3 A;  1NQ7 A;  3OMO A;  2AMA A;  2GP7 A;  2QH6 A;  3VRU A;  1OVL A;  1LBD A;  1ZEO A;  4OFR A;  3HM1 A;  3VRV A;  4PP5 A;  3B0W A;  3SP9 A;  2Q7L A;  2ZL9 A;  3CJW A;  1T7R A;  3OMQ A;  5DP0 A;  3M7R A;  2V0V A;  4IU7 A;  3VSO A;  2J7Y A;  5DWI A;  1XDK A;  4OIU A;  3W0Y A;  3B1M A;  5ACC A;  3UUD A;  1ILG A;  3OGT A;  5AWK A;  3X1H A;  3V9Y A;  1NAX A;  5HJP A;  3DR1 A;  3FC6 A;  3PEQ A;  4BCR A;  5ICK A;  2PIO A;  2ABI A;  3CS4 A;  4FHI A;  5JJM B;  3UUA B;  4APU A;  5CJ6 A;  2AA5 A;  1T73 A;  1PZL A;  1YY4 A;  5K13 A;  1RKH A;  4MG9 B;  3W5R A;  3V4A A;  5JI0 D;  5DXB B;  2O4J A;  2ZLA A;  4LNW A;  3F5C A;  4WQP A;  1ZH7 A;  3CWD A;  3RLL A;  2XHS A;  3R8D A;  1ILH A;  4QE6 A;  4ZO1 B;  2B50 A;  3RVF A;  5IXK A;  1ZDU A;  3PO9 A;  5DTV A;  1Y0S A;  5IAW A;  2R6Y A;  5GID A;  3HLV A;  1XV9 A;  3OKH A;  4IVW A;  3CS8 A;  2AYR A;  4PRG A;  1YJE A;  5FQP A;  3W0I A;  2QA8 A;  2QW4 A;  4ITE A;  1HG4 A;  3ZRA A;  1A28 A;  2XKW A;  2P1U A;  1T79 A;  2AWH A;  3RY9 A;  2VST A;  3IA6 A;  4G1Z A;  5G42 A;  3ZR7 A;  2F4B A;  5M96 A;  2ZNP A;  3GN8 A;  4TV1 A;  3GBK A;  4RUJ A;  1T63 A;  2Q70 A;  2ZK0 A;  4Q13 A;  2YFE A;  3X31 A;  4EM9 A;  4S0S A;  5DKE A;  3FXV A;  2HB8 A;  3B5R A;  2GPV A;  4PPP A;  2B1V A;  3B3K A;  4XLD A;  3OSA A;  3DZU D;  3OS8 C;  3OMK A;  1YIN A;  1XQ3 A;  4B7W A;  5B5B A;  2JF9 A;  5DL4 A;  3VJH A;  3DZU A;  1XP9 A;  5C4O A;  1U9E A;  2Q1V A;  3D5F A;  2QE4 A;  5HJP B;  5DUG A;  1I37 A;  1NDE A;  5KRA A;  4OH6 A;  4FGY A;  3W5T A;  3GYU A;  2Q6J A;  3KMG A;  3P8X A;  4ZNU A;  4N1Y A;  3A9E A;  2PIP L;  1UHL A;  3OSW A;  5E0W A;  5DYB A;  1FCX A;  3A40 X;  1UPW A;  2REW A;  1YP0 A;  3UP3 A;  1T5Z A;  2QGT A;  4QL8 A;  2QR9 A;  5G44 A;  5DKB A;  4RUP A;  1NAV A;  2GWX A;  2Q5S A;  1U3Q A;  3PCU A;  1FBY A;  3VJT A;  2H79 A;  1RDT A;  2I0G A;  4PLD A;  1K74 D;  2P1V A;  3KFC A;  4RWV A;  2POB A;  4ITF A;  4YNK A;  4OFU A;  5DUE A;  4L96 A;  1K74 A;  3H0A D;  1ZAF A;  4WHG A;  5G5W A;  2GTK A;  2ZNQ A;  2QA8 B;  2GPU A;  2E2R A;  3H0A A;  1P8D A;  3KPZ A;  4K6I A;  4IA7 A;  4N73 A;  3W5Q A;  4OIL A;  3VI8 A;  1G5Y A;  4XAO A;  3PLZ A;  1K7L A;  3AZ1 A;  2ZK1 A;  2QNV A;  3E7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...