1L2JA

Human estrogen receptor beta ligand-binding domain in complex with (r,r)-5,11-cis-diethyl-5,6,11,12-tetrahydrochrysene-2,8-diol
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
241
structure length
232
Chain Sequence
DALSPEQLVLTLLEAEPPHVLISRTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSLVTATQDADSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of a subtype-selective ligand reveals a novel mode of estrogen receptor antagonism.
pubmed rcsb
molecule keywords ESTROGEN RECEPTOR BETA
molecule tags Transcription receptor
source organism Homo sapiens
total genus 80
structure length 232
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 1l2jA00
4OZRE 2J7YA 1LBDA 1MV9A 2AX9A 3CTBA 3IXPD 3R5MA 5DXEA 4MGAA 5C4UA 4E2JA 3DT3A 1XDKA 4LNXA 5E1CA 4ZNUA 1T7FA 3W0YA 2Q7JA 3OZJA 3D5FA 4Q0AC 5F9BA 3WWRA 1L2JA 2PIXA 4OLMA 5DZ1A 1SQNA 1H9UA 5AWJA 1FCYA 5B41A 4YT1A 4G20A 4KZMA 2Q8SA 1K7LA 5L7GA 2NV7A 3AFRA 3FC6A 2P1UA 1SKXA 2ZMHA 5AVLA 1A28A 3OS8C 3KMRA 2AM9A 1R5KA 4J26A 4IU7A 1FCXA 3DY6A 3RLJA 5DKEA 5AAVB 2A3IA 1FM9D 3VTDA 4Q50A 1RDTD 2HARA 4X1FA 3VT8A 4CSJA 4PP3A 3H52A 3VRVA 1ILGA 2ZK6A 4MGBA 2OVHA 3A9EB 1T63A 3AN4A 3L0EA 2B1VA 5JJMB 3MNOA 2VV0A 4HEEX 4PPPA 1M7WA 2Q59A 3KYTA 3UUAB 3FUGA 5LGAA 1T74A 1NAVA 2IOKA 2ZNOA 3R29A 4XAOA 2BAWA 2Q7LA 1EXXA 1GWQA 4A2JA 5DIEA 2Q3YA 1OSHA 2ZLAA 4Q13A 3IMYA 2J14A 3OOFA 4PLEA 1OT7A 2ZK3A 4FN9A 3B3KA 1R20A 3UUDB 3B66A 5FQPA 1FM6A 3CJWA 3OMOA 2B50A 3VT9A 3IPQA 2YJDA 5DZHA 4E4QA 3VTCA 2XHSA 4LTWA 4OK1A 3B0QA 4NY9A 3T03A 5L11A 4QE6A 3KBAA 2XYWA 3KPZA 3PO9A 4EM9A 3HC5A 4ZO1X 5G42A 3DZUA 1BSXA 4OEYA 3VT5A 2Q60A 3IPSA 4NQAB 4J5WA 2JJ3A 1YMTA 2J4AA 3LMPA 4ONIA 4QJRA 3AURA 3W0IA 3DZYA 3NOAA 1OSVA 2AX6A 2NXXA 3A9EA 3L0JA 5EC9A 4ZNTA 5JJMA 2ZKCA 4QM0A 3UP0A 2Z4JA 3E94A 4OIVA 4RZGA 2V0VA 5DV8A 5AWKA 2QTUA 5G45A 3U9QA 5L7EA 2GP7A 2P7ZA 3R2AA 1PQ6A 1R20D 2ZFXA 3D57A 4OJBA 1P93A 3UUAA 3WJ4A 1XLSA 3ET1A 5KRKA 2GPVA 5C4SA 5APHA 2FSZA 4N73A 5KRCA 3WT6A 3OLFA 4ZNHA 1K74A 1PDUA 2R6YA 3PRGA 3PLZA 5DWJA 4OH5A 3UUDA 2AA5A 3E7CA 4J5XA 4PF3A 3DZUD 1VJBA 2QMVA 5KRHA 1I7GA 2ZNPA 3GBKA 4OILA 4YPQA 3WTQA 3DZYD 3HQ5A 4ZNWA 4TV1B 1T79A 5DRMA 5KYAA 5JY3A 3W5PA 4OKXA 3R8DA 4N8RA 1M13A 3VRTA 3E00A 2QH6A 2VSRA 4XUHA 5EITA 5JI0D 5ACCA 3GN8A 2ZXMA 1XP6A 5DXPA 3AX8A 2PIVA 4R06A 4PVUA 4OARA 3P0UA 3VT6A 2OUZA 2AA6A 5FQRA 2QE4A 5DU5A 3CDSA 2ZK2A 5KRFA 2Q7IA 2JF9A 1X7BA 1FBYA 3OAPA 2I4JA 1K74D 5DY8A 4OEAA 1EREA 2Q6SA 2YHDA 3B65A 5APKA 2V7CA 3MNPA 1ZDTA 1RK3A 5DI7A 2Q6RA 2G44A 3RUUA 2NPAA 3CWDA 3A2JA 3EYBA 1XVPB 2YJAB 3OMMA 5DKBA 1XAPA 4MGDB 3E00D 1XNNA 5DMFA 5G3JA 3B0TA 1KV6A 4O8FA 2E2RA 4A4VA 1XPCA 5KCFA 3UP3A 3L3ZA 2ZNNA 3TX7B 5DWEA 1NDEA 2Q6JA 2Q70A 1Z5XE 3X1HA 2PIUA 4ZJRA 5DXKA 2OZ7A 2HC4A 1ILHA 4FHIA 4EMAA 3HO0A 1XOWA 4NB6A 2LBDA 4MG6A 2VSTA 1X76A 3PEQA 4NUFA 1YP0A 4ZOMA 2PITA 5DMCA 5H1EA 3O1EA 2QZOB 1RDTA 4P6XA 4JYIA 3V9YA 5DXMA 4MG8B 2PIRA 1UOMA 1XP9A 3OSIA 4WHFA 2ZL9A 4QL8A 5DUEA 2H77A 2ZY0A 5L7HA 1G1UA 2ACLB 3WFGA 1T7RA 2JFAB 1ZEOA 3DR1A 4M8HA 1S0XA 2ATHA 2ZLCA 4UDCA 2QA8B 3JZBA 4REFA 4WHGA 1RKGA 3VRWA 3OKHA 1NQ1A 2EWPA 1R6GA 3D24A 2PIQA 3OS8A 3A40X 3ADSA 4N1YA 3W0GA 4YNKA 3ERDA 3OSWA 1ZKYA 4RAKA 1WM0X 1XVPA 5DL4A 4DQMA 4MGDA 4IA1A 2ZVTA 2ZXZA 3V49A 3VT4A 4S0SA 5DWLA 2FAIA 3AN3A 4DM6A 2XKWA 1FD0A 3CDPA 2REWA 5DK9A 3FEJA 5FQVA 2ZK1A 3SZ1A 3V3EA 5C4OA 1R1KA 2OCFA 4OC7A 2ZK5A 4OFUA 3W5TA 3FEIA 3NSPA 3VRUA 4OIUA 2GWXA 1IE9A 3UU7B 4G1YA 1Q4XA 3W0JA 5KROA 3FS1A 2QZOA 3VI8A 2VV4B 3X36A 1IE8A 1GS4A 4G2HA 2J7XA 1T73A 4MG8A 5DXBB 1G5YA 4PXMA 1XLSE 4OZRU 3GD2A 2ACLA 4ZN7A 1EXAA 2JFAA 3S9SA 4A4WA 2QA8A 3FURA 4WLBA 4MDDA 3VSOA 5KRLA 5EI1A 3RUTA 3L0LA 4ITFA 2AO6A 1E3GA 1R1KD 1NHZA 1TXIA 5HZCA 2B23A 2OAXA 3GZ9A 3D90A 3R5NA 1PQCA 3FALB 4JAZA 4LBDA 5DXQA 2ZNQA 4N5GA 5E19A 4MG9B 4G1ZA 5DZIA 1GWRA 3L03A 2QXMA 5IAWA 2ZBSA 3WJ5A 5AAVA 3R8IA 3HM1A 1M2ZA 2G0HA 1U3SA 4L98A 3VN2A 3OZ0A 4DK8A 1S19A 3UU7A 3G8OA 4RMCA 5KRJA 3V9TA 5KRAA 3KFCA 2VV4A 3ET3A 4IQRA 1FCZA 1DKFB 3GWXA 3SP6A 3K8SA 4REEA 4DORA 5DXBA 3CS8A 3BEJA 4MG5A 3X31A 5DWIA 2IOGA 5DYDA 4LNWA 4R2UA 4RZFA 1YOWA 1YUCA 5GICA 3KDTA 4F9MA 4WQPA 3ZR7A 4ZI1A 5CJ6A 5DUGA 1S9QA 2HBHA 5G5WA 3HC6A 3AUNA 5KCCA 5E14A 2YATA 4OJ9A 3BQDA 3VJIA 4DOSA 1X7RA 1XQCA 3B0WA 2I0JA 2AA2A 2H79A 2QSEA 3CS6A 4CI5A 3A3ZX 3GYUA 2Q1HA 2PIWA 2HAMA 3FALA 2ZMIA 3KMZA 1YINA 4MG9A 5KRMA 3AZ1A 3W0AA 4OZTU 2QPYA 4XHDA 2FVJA 3OLLA 1U9EA 2R40D 3ET0A 4PPSA 5SYZA 1NQ7A 2GPUA 3NSQA 1G2NA 2P1VA 4M8EA 1T76A 3A78A 5G43A 4B7WA 5AZVA 1ZH7A 2ZK0A 3ZRBA 5KCEA 5I4VA 1KNUA 3VTBA 3RY9A 3VHUA 3R8AA 5B5BA 4FGYA 1DKFA 1ZUCA 5DXGA 4OGHA 2QGWA 3LBDA 2GIUA 5DKGA 1KKQA 2YFEA 5DLRA 3OKIA 1QKNA 4L96A 3M7RA 2QR9A 2OM9A 1YYEA 4UDDA 5G44A 4Y29A 5HJPB 2Q61A 3GWSX 5AK2A 4UDBA 5HJSA 5DP0A 3VSPA 4LSJA 5KCTA 4ZNSA 5DSHA 5E7VA 2PKLA 2R6WA 1E3KA 1XZXX 1K4WA 3W5QA 4TV1A 1XP1A 2AAXA 2VV1B 4POHA 4WPFA 1XV9B 2Z4BA 4IVWA 5DV6A 5DYBA 2P15A 3VT7A 4RMDA 2VV2A 3K22A 2ZK4A 1QKUA 5DTVA 5DIGA 4DM8A 3V4AA 4POJA 2AB2A 4MG7B 1PK5A 4RMEA 3AUQA 4DK7A 1X7JA 3G9EA 1Y0SA 3WMHA 5HYRA 1PRGA 3SP9A 4KZJA 2AWHA 3OMKA 5EJVA 5DVSA 4IWCA 1YIMA 4R6SA 2W8YA 4ZO1B 4OJ4A 4RFWA 5AVIA 1UPVA 4QK4A 2O9IA 5KD9A 3B5RA 2PNUA 3OS9A 1N46A 3OMQA 5DZ3A 1X7EA 4JL4A 4APUA 3V9VA 5HJPA 4PP6A 4E4KA 3VJSA 4RWVA 4OKWA 1UHLB 2AMBA 5AAUA 4S15A 4PWLA 4DMAA 3KMGA 3TKMA 4S0TA 3ADVA 1NUOA 3TKCA 1Z5XU 4IV4A 2VV1A 2ZMJA 1XV9A 2I0GA 3W5RA 3L1BA 1S0ZA 2P7GA 3ADWA 3GYTA 3H0AA 3FXVA 4RUOX 2NXXE 5KCWA 5G46A 2AMAA 1HG4A 2QXSA 4PP5A 3OMPA 1RKHA 2HVCA 4MG7A 3WT5A 2QABA 1XIUA 3VT3A 1X78A 3UVVB 5APJA 5ETHA 1HJ1A 2AX8A 2G0GA 2PINA 2Q5PA 2XYJA 4RZEA 2HWRA 2P7AA 2P4YA 5DZ0A 3X1IA 5KYJA 3F7DA 4OEDA 1NYXA 3A2HA 1T7MA 1XJ7A 1YA3A 4XUMA 2PIOA 1NRLA 2QNVA 1N4HA 3ADUA 2AA7A 3B1MA 4HLWA 2Q5GA 4G2IA 3QT0A 3W0CA 3AZ2A 1XNXA 1SR7A 4IA7A 1DB1A 5KR9A 1T7TA 3H0AD 3DCUA 1ZGYA 3ZRAA 2GL8A 5KCDA 3RLLA 1UHLA 4P6WA 2HCDA 5M96A 5IZ0A 5K13A 3Q95B 2BJ4B 2HWQA 5DUHA 4XLDA 3VJHA 2AXAA 2GPPA 3B67A 2GPOA 4IA3A 3WGPA 2VV3A 3O1DA 5DXRA 1MZNA 1TFCA 3VHWA 2XYXA 2HFPA 3P8XA 4KZIA 3VJTA 1NQ0A 2R40A 3F5CB 3K23A 4S14A 3IA6A 1A52A 3G8IA 3KDUA 3UVVA 2Q1VA 5GIEA 1NQ2A 2QA6A 2B1ZA 4X1GA 5DWGA 3B68A 3CLDA 4OZTE 4OH6A 2O4RA 1I38A 2I4ZA 2P54A 3A2IA 3K6PA 2Q5SA 4IW8A 4OKTA 5KCUA 5ICKA 3KWYA 3PBAA 5HYKA 4K4JA 5IXKA 1PQ9A 1Y0XX 4OFRA 2NW4A 3HZFA 4J5WC 1U3QA 5AYGA 1SJ0A 4IV2A 4IW6A 4XT9A 5A86A 4NIEA 1Y9RA 4ZN9A 4XI3A 4OEZA 2ABIA 3ADTA 3VHVA 5AZTA 4JYGA 2ZASA 3ADXA 2F4BA 1FM6D 3HVLA 5GIDA 3ERTA 4IWFA 5GT4A 5LWPA 4XTAA 5C4TA 3Q95A 2BJ4A 4OHAA 1LV2A 4ZJWA 1PZLA 1YJEA 2HASA 2QGTA 4ZNVA 3AZ3A 2YLYA 3JZCA 2PJLA 5FQSA 3WFFA 4RE8A 4IVYA 4JGVA 5E15A 2PIPL 4JYHA 2POGA 1T65A 3BC5A 2Q7KA 4TUZB 3OGTA 2AX7A 5DX3B 3CQVA 4PLDA 3F5CA 5E0XA 2QW4A 4J5XC 1I37A 1S9PA 1ZAFA 3W0HA 4MGCA 3FLIA 3OSAA 4IS8A 4BCRA 1G50A 4UDAA 3DCTA 3CS4A 2YLOA 3G0WA 5DV3A 2I4PA 2YLPA 3V3QA 1OVLB 1N83A 4K7AA 4QE8A 2HB7A 3HLVA 3ZQTA 3TY0A 2P1TA 3OOKA 1GWXA 4RUJA 1ZDUA 4FHHA 1L2IA 4RUPA 5DVCA 4MGAB 1YY4A 1T5ZA 3MNEA 1XDKB 5DVVA 5HCVA 3L3XA 2HB8A 5KRIA 3UUCA 2YLQA 1YOKA 3ILZA 2IHQA 2ZXNA 3HODA 3B0RA 2O4JA 3P89A 3ET2A 3PCUA 1ERRA 2AYRA 3IPUA 1NAXA 3IXPA 5EHJA 3WT7A 1XQ3A 3FC6B 4IUIA 3P88A 5DKSA 3D6DA 3OLSA 5DIDA 1UPWA 4CI4A 4FNEA 2GTKA 4K6IA 1U3RA 2PRGA 4TUZA 3N00A 1QKTA 5DX3A 5E0WA 4IA2A 2OVMA 1I7IA 4G21A 4MGBB 4WVDA 3RVFA 2POBA 2G5OA 1P8DA 2Q59B 5DRJA 1PCGA 1Z95A 5EGVA 4J24A 1OVLA 1RJKA 4ITEA 1FM9A 4PRGA 4OKBA 5FQTA 1QKMA 4G1DA 4YMQA 1XB7A 1MVCA
chains in the Genus database with same CATH superfamily
4OZRE 2J7YA 1LBDA 1MV9A 2AX9A 3CTBA 3IXPD 3R5MA 5DXEA 4MGAA 5C4UA 4E2JA 3DT3A 1XDKA 4LNXA 5E1CA 4ZNUA 1T7FA 3W0YA 2Q7JA 3OZJA 3D5FA 4Q0AC 5F9BA 3WWRA 1L2JA 2PIXA 4OLMA 5DZ1A 1SQNA 1H9UA 5AWJA 1FCYA 5B41A 4YT1A 4G20A 4KZMA 2Q8SA 1K7LA 5L7GA 2NV7A 3AFRA 3FC6A 2P1UA 1SKXA 2ZMHA 5AVLA 1A28A 3OS8C 3KMRA 2AM9A 1R5KA 4J26A 4IU7A 1FCXA 3DY6A 3RLJA 5DKEA 5AAVB 2A3IA 1FM9D 3VTDA 4Q50A 1RDTD 2HARA 4X1FA 3VT8A 4CSJA 4PP3A 3H52A 3VRVA 1ILGA 2ZK6A 4MGBA 2OVHA 3A9EB 1T63A 3AN4A 3L0EA 2B1VA 5JJMB 3MNOA 2VV0A 4HEEX 4PPPA 1M7WA 2Q59A 3KYTA 3UUAB 3FUGA 5LGAA 1T74A 1NAVA 2IOKA 2ZNOA 3R29A 4XAOA 2BAWA 2Q7LA 1EXXA 1GWQA 4A2JA 5DIEA 2Q3YA 1OSHA 2ZLAA 4Q13A 3IMYA 2J14A 3OOFA 4PLEA 1OT7A 2ZK3A 4FN9A 3B3KA 1R20A 3UUDB 3B66A 5FQPA 1FM6A 3CJWA 3OMOA 2B50A 3VT9A 3IPQA 2YJDA 5DZHA 4E4QA 3VTCA 2XHSA 4LTWA 4OK1A 3B0QA 4NY9A 3T03A 5L11A 4QE6A 3KBAA 2XYWA 3KPZA 3PO9A 4EM9A 3HC5A 4ZO1X 5G42A 3DZUA 1BSXA 4OEYA 3VT5A 2Q60A 3IPSA 4NQAB 4J5WA 2JJ3A 1YMTA 2J4AA 3LMPA 4ONIA 4QJRA 3AURA 3W0IA 3DZYA 3NOAA 1OSVA 2AX6A 2NXXA 3A9EA 3L0JA 5EC9A 4ZNTA 5JJMA 2ZKCA 4QM0A 3UP0A 2Z4JA 3E94A 4OIVA 4RZGA 2V0VA 5DV8A 5AWKA 2QTUA 5G45A 3U9QA 5L7EA 2GP7A 2P7ZA 3R2AA 1PQ6A 1R20D 2ZFXA 3D57A 4OJBA 1P93A 3UUAA 3WJ4A 1XLSA 3ET1A 5KRKA 2GPVA 5C4SA 5APHA 2FSZA 4N73A 5KRCA 3WT6A 3OLFA 4ZNHA 1K74A 1PDUA 2R6YA 3PRGA 3PLZA 5DWJA 4OH5A 3UUDA 2AA5A 3E7CA 4J5XA 4PF3A 3DZUD 1VJBA 2QMVA 5KRHA 1I7GA 2ZNPA 3GBKA 4OILA 4YPQA 3WTQA 3DZYD 3HQ5A 4ZNWA 4TV1B 1T79A 5DRMA 5KYAA 5JY3A 3W5PA 4OKXA 3R8DA 4N8RA 1M13A 3VRTA 3E00A 2QH6A 2VSRA 4XUHA 5EITA 5JI0D 5ACCA 3GN8A 2ZXMA 1XP6A 5DXPA 3AX8A 2PIVA 4R06A 4PVUA 4OARA 3P0UA 3VT6A 2OUZA 2AA6A 5FQRA 2QE4A 5DU5A 3CDSA 2ZK2A 5KRFA 2Q7IA 2JF9A 1X7BA 1FBYA 3OAPA 2I4JA 1K74D 5DY8A 4OEAA 1EREA 2Q6SA 2YHDA 3B65A 5APKA 2V7CA 3MNPA 1ZDTA 1RK3A 5DI7A 2Q6RA 2G44A 3RUUA 2NPAA 3CWDA 3A2JA 3EYBA 1XVPB 2YJAB 3OMMA 5DKBA 1XAPA 4MGDB 3E00D 1XNNA 5DMFA 5G3JA 3B0TA 1KV6A 4O8FA 2E2RA 4A4VA 1XPCA 5KCFA 3UP3A 3L3ZA 2ZNNA 3TX7B 5DWEA 1NDEA 2Q6JA 2Q70A 1Z5XE 3X1HA 2PIUA 4ZJRA 5DXKA 2OZ7A 2HC4A 1ILHA 4FHIA 4EMAA 3HO0A 1XOWA 4NB6A 2LBDA 4MG6A 2VSTA 1X76A 3PEQA 4NUFA 1YP0A 4ZOMA 2PITA 5DMCA 5H1EA 3O1EA 2QZOB 1RDTA 4P6XA 4JYIA 3V9YA 5DXMA 4MG8B 2PIRA 1UOMA 1XP9A 3OSIA 4WHFA 2ZL9A 4QL8A 5DUEA 2H77A 2ZY0A 5L7HA 1G1UA 2ACLB 3WFGA 1T7RA 2JFAB 1ZEOA 3DR1A 4M8HA 1S0XA 2ATHA 2ZLCA 4UDCA 2QA8B 3JZBA 4REFA 4WHGA 1RKGA 3VRWA 3OKHA 1NQ1A 2EWPA 1R6GA 3D24A 2PIQA 3OS8A 3A40X 3ADSA 4N1YA 3W0GA 4YNKA 3ERDA 3OSWA 1ZKYA 4RAKA 1WM0X 1XVPA 5DL4A 4DQMA 4MGDA 4IA1A 2ZVTA 2ZXZA 3V49A 3VT4A 4S0SA 5DWLA 2FAIA 3AN3A 4DM6A 2XKWA 1FD0A 3CDPA 2REWA 5DK9A 3FEJA 5FQVA 2ZK1A 3SZ1A 3V3EA 5C4OA 1R1KA 2OCFA 4OC7A 2ZK5A 4OFUA 3W5TA 3FEIA 3NSPA 3VRUA 4OIUA 2GWXA 1IE9A 3UU7B 4G1YA 1Q4XA 3W0JA 5KROA 3FS1A 2QZOA 3VI8A 2VV4B 3X36A 1IE8A 1GS4A 4G2HA 2J7XA 1T73A 4MG8A 5DXBB 1G5YA 4PXMA 1XLSE 4OZRU 3GD2A 2ACLA 4ZN7A 1EXAA 2JFAA 3S9SA 4A4WA 2QA8A 3FURA 4WLBA 4MDDA 3VSOA 5KRLA 5EI1A 3RUTA 3L0LA 4ITFA 2AO6A 1E3GA 1R1KD 1NHZA 1TXIA 5HZCA 2B23A 2OAXA 3GZ9A 3D90A 3R5NA 1PQCA 3FALB 4JAZA 4LBDA 5DXQA 2ZNQA 4N5GA 5E19A 4MG9B 4G1ZA 5DZIA 1GWRA 3L03A 2QXMA 5IAWA 2ZBSA 3WJ5A 5AAVA 3R8IA 3HM1A 1M2ZA 2G0HA 1U3SA 4L98A 3VN2A 3OZ0A 4DK8A 1S19A 3UU7A 3G8OA 4RMCA 5KRJA 3V9TA 5KRAA 3KFCA 2VV4A 3ET3A 4IQRA 1FCZA 1DKFB 3GWXA 3SP6A 3K8SA 4REEA 4DORA 5DXBA 3CS8A 3BEJA 4MG5A 3X31A 5DWIA 2IOGA 5DYDA 4LNWA 4R2UA 4RZFA 1YOWA 1YUCA 5GICA 3KDTA 4F9MA 4WQPA 3ZR7A 4ZI1A 5CJ6A 5DUGA 1S9QA 2HBHA 5G5WA 3HC6A 3AUNA 5KCCA 5E14A 2YATA 4OJ9A 3BQDA 3VJIA 4DOSA 1X7RA 1XQCA 3B0WA 2I0JA 2AA2A 2H79A 2QSEA 3CS6A 4CI5A 3A3ZX 3GYUA 2Q1HA 2PIWA 2HAMA 3FALA 2ZMIA 3KMZA 1YINA 4MG9A 5KRMA 3AZ1A 3W0AA 4OZTU 2QPYA 4XHDA 2FVJA 3OLLA 1U9EA 2R40D 3ET0A 4PPSA 5SYZA 1NQ7A 2GPUA 3NSQA 1G2NA 2P1VA 4M8EA 1T76A 3A78A 5G43A 4B7WA 5AZVA 1ZH7A 2ZK0A 3ZRBA 5KCEA 5I4VA 1KNUA 3VTBA 3RY9A 3VHUA 3R8AA 5B5BA 4FGYA 1DKFA 1ZUCA 5DXGA 4OGHA 2QGWA 3LBDA 2GIUA 5DKGA 1KKQA 2YFEA 5DLRA 3OKIA 1QKNA 4L96A 3M7RA 2QR9A 2OM9A 1YYEA 4UDDA 5G44A 4Y29A 5HJPB 2Q61A 3GWSX 5AK2A 4UDBA 5HJSA 5DP0A 3VSPA 4LSJA 5KCTA 4ZNSA 5DSHA 5E7VA 2PKLA 2R6WA 1E3KA 1XZXX 1K4WA 3W5QA 4TV1A 1XP1A 2AAXA 2VV1B 4POHA 4WPFA 1XV9B 2Z4BA 4IVWA 5DV6A 5DYBA 2P15A 3VT7A 4RMDA 2VV2A 3K22A 2ZK4A 1QKUA 5DTVA 5DIGA 4DM8A 3V4AA 4POJA 2AB2A 4MG7B 1PK5A 4RMEA 3AUQA 4DK7A 1X7JA 3G9EA 1Y0SA 3WMHA 5HYRA 1PRGA 3SP9A 4KZJA 2AWHA 3OMKA 5EJVA 5DVSA 4IWCA 1YIMA 4R6SA 2W8YA 4ZO1B 4OJ4A 4RFWA 5AVIA 1UPVA 4QK4A 2O9IA 5KD9A 3B5RA 2PNUA 3OS9A 1N46A 3OMQA 5DZ3A 1X7EA 4JL4A 4APUA 3V9VA 5HJPA 4PP6A 4E4KA 3VJSA 4RWVA 4OKWA 1UHLB 2AMBA 5AAUA 4S15A 4PWLA 4DMAA 3KMGA 3TKMA 4S0TA 3ADVA 1NUOA 3TKCA 1Z5XU 4IV4A 2VV1A 2ZMJA 1XV9A 2I0GA 3W5RA 3L1BA 1S0ZA 2P7GA 3ADWA 3GYTA 3H0AA 3FXVA 4RUOX 2NXXE 5KCWA 5G46A 2AMAA 1HG4A 2QXSA 4PP5A 3OMPA 1RKHA 2HVCA 4MG7A 3WT5A 2QABA 1XIUA 3VT3A 1X78A 3UVVB 5APJA 5ETHA 1HJ1A 2AX8A 2G0GA 2PINA 2Q5PA 2XYJA 4RZEA 2HWRA 2P7AA 2P4YA 5DZ0A 3X1IA 5KYJA 3F7DA 4OEDA 1NYXA 3A2HA 1T7MA 1XJ7A 1YA3A 4XUMA 2PIOA 1NRLA 2QNVA 1N4HA 3ADUA 2AA7A 3B1MA 4HLWA 2Q5GA 4G2IA 3QT0A 3W0CA 3AZ2A 1XNXA 1SR7A 4IA7A 1DB1A 5KR9A 1T7TA 3H0AD 3DCUA 1ZGYA 3ZRAA 2GL8A 5KCDA 3RLLA 1UHLA 4P6WA 2HCDA 5M96A 5IZ0A 5K13A 3Q95B 2BJ4B 2HWQA 5DUHA 4XLDA 3VJHA 2AXAA 2GPPA 3B67A 2GPOA 4IA3A 3WGPA 2VV3A 3O1DA 5DXRA 1MZNA 1TFCA 3VHWA 2XYXA 2HFPA 3P8XA 4KZIA 3VJTA 1NQ0A 2R40A 3F5CB 3K23A 4S14A 3IA6A 1A52A 3G8IA 3KDUA 3UVVA 2Q1VA 5GIEA 1NQ2A 2QA6A 2B1ZA 4X1GA 5DWGA 3B68A 3CLDA 4OZTE 4OH6A 2O4RA 1I38A 2I4ZA 2P54A 3A2IA 3K6PA 2Q5SA 4IW8A 4OKTA 5KCUA 5ICKA 3KWYA 3PBAA 5HYKA 4K4JA 5IXKA 1PQ9A 1Y0XX 4OFRA 2NW4A 3HZFA 4J5WC 1U3QA 5AYGA 1SJ0A 4IV2A 4IW6A 4XT9A 5A86A 4NIEA 1Y9RA 4ZN9A 4XI3A 4OEZA 2ABIA 3ADTA 3VHVA 5AZTA 4JYGA 2ZASA 3ADXA 2F4BA 1FM6D 3HVLA 5GIDA 3ERTA 4IWFA 5GT4A 5LWPA 4XTAA 5C4TA 3Q95A 2BJ4A 4OHAA 1LV2A 4ZJWA 1PZLA 1YJEA 2HASA 2QGTA 4ZNVA 3AZ3A 2YLYA 3JZCA 2PJLA 5FQSA 3WFFA 4RE8A 4IVYA 4JGVA 5E15A 2PIPL 4JYHA 2POGA 1T65A 3BC5A 2Q7KA 4TUZB 3OGTA 2AX7A 5DX3B 3CQVA 4PLDA 3F5CA 5E0XA 2QW4A 4J5XC 1I37A 1S9PA 1ZAFA 3W0HA 4MGCA 3FLIA 3OSAA 4IS8A 4BCRA 1G50A 4UDAA 3DCTA 3CS4A 2YLOA 3G0WA 5DV3A 2I4PA 2YLPA 3V3QA 1OVLB 1N83A 4K7AA 4QE8A 2HB7A 3HLVA 3ZQTA 3TY0A 2P1TA 3OOKA 1GWXA 4RUJA 1ZDUA 4FHHA 1L2IA 4RUPA 5DVCA 4MGAB 1YY4A 1T5ZA 3MNEA 1XDKB 5DVVA 5HCVA 3L3XA 2HB8A 5KRIA 3UUCA 2YLQA 1YOKA 3ILZA 2IHQA 2ZXNA 3HODA 3B0RA 2O4JA 3P89A 3ET2A 3PCUA 1ERRA 2AYRA 3IPUA 1NAXA 3IXPA 5EHJA 3WT7A 1XQ3A 3FC6B 4IUIA 3P88A 5DKSA 3D6DA 3OLSA 5DIDA 1UPWA 4CI4A 4FNEA 2GTKA 4K6IA 1U3RA 2PRGA 4TUZA 3N00A 1QKTA 5DX3A 5E0WA 4IA2A 2OVMA 1I7IA 4G21A 4MGBB 4WVDA 3RVFA 2POBA 2G5OA 1P8DA 2Q59B 5DRJA 1PCGA 1Z95A 5EGVA 4J24A 1OVLA 1RJKA 4ITEA 1FM9A 4PRGA 4OKBA 5FQTA 1QKMA 4G1DA 4YMQA 1XB7A 1MVCA
chains in the Genus database with same CATH topology
4OZRE 2J7YA 1LBDA 1MV9A 2AX9A 3CTBA 3IXPD 3R5MA 5DXEA 4MGAA 5C4UA 4E2JA 3DT3A 1XDKA 4LNXA 5E1CA 4ZNUA 1T7FA 3W0YA 2Q7JA 3OZJA 3D5FA 4Q0AC 5F9BA 3WWRA 1L2JA 2PIXA 4OLMA 5DZ1A 1SQNA 1H9UA 5AWJA 1FCYA 5B41A 4YT1A 4G20A 4KZMA 2Q8SA 1K7LA 5L7GA 2NV7A 3AFRA 3FC6A 2P1UA 1SKXA 2ZMHA 5AVLA 1A28A 3OS8C 3KMRA 2AM9A 1R5KA 4J26A 4IU7A 1FCXA 3DY6A 3RLJA 5DKEA 5AAVB 2A3IA 1FM9D 3VTDA 4Q50A 1RDTD 2HARA 4X1FA 3VT8A 4CSJA 4PP3A 3H52A 3VRVA 1ILGA 2ZK6A 4MGBA 2OVHA 3A9EB 1T63A 3AN4A 3L0EA 2B1VA 5JJMB 3MNOA 2VV0A 4HEEX 4PPPA 1M7WA 2Q59A 3KYTA 3UUAB 3FUGA 5LGAA 1T74A 1NAVA 2IOKA 2ZNOA 3R29A 4XAOA 2BAWA 2Q7LA 1EXXA 1GWQA 4A2JA 5DIEA 2Q3YA 1OSHA 2ZLAA 4Q13A 3IMYA 2J14A 3OOFA 4PLEA 1OT7A 2ZK3A 4FN9A 3B3KA 1R20A 3UUDB 3B66A 5FQPA 1FM6A 3CJWA 3OMOA 2B50A 3VT9A 3IPQA 2YJDA 5DZHA 4E4QA 3VTCA 2XHSA 4LTWA 4OK1A 3B0QA 4NY9A 3T03A 5L11A 4QE6A 3KBAA 2XYWA 3KPZA 3PO9A 4EM9A 3HC5A 4ZO1X 5G42A 3DZUA 1BSXA 4OEYA 3VT5A 2Q60A 3IPSA 4NQAB 4J5WA 2JJ3A 1YMTA 2J4AA 3LMPA 4ONIA 4QJRA 3AURA 3W0IA 3DZYA 3NOAA 1OSVA 2AX6A 2NXXA 3A9EA 3L0JA 5EC9A 4ZNTA 5JJMA 2ZKCA 4QM0A 3UP0A 2Z4JA 3E94A 4OIVA 4RZGA 2V0VA 5DV8A 5AWKA 2QTUA 5G45A 3U9QA 5L7EA 2GP7A 2P7ZA 3R2AA 1PQ6A 1R20D 2ZFXA 3D57A 4OJBA 1P93A 3UUAA 3WJ4A 1XLSA 3ET1A 5KRKA 2GPVA 5C4SA 5APHA 2FSZA 4N73A 5KRCA 3WT6A 3OLFA 4ZNHA 1K74A 1PDUA 2R6YA 3PRGA 3PLZA 5DWJA 4OH5A 3UUDA 2AA5A 3E7CA 4J5XA 4PF3A 3DZUD 1VJBA 2QMVA 5KRHA 1I7GA 2ZNPA 3GBKA 4OILA 4YPQA 3WTQA 3DZYD 3HQ5A 4ZNWA 4TV1B 1T79A 5DRMA 5KYAA 5JY3A 3W5PA 4OKXA 3R8DA 4N8RA 1M13A 3VRTA 3E00A 2QH6A 2VSRA 4XUHA 5EITA 5JI0D 5ACCA 3GN8A 2ZXMA 1XP6A 5DXPA 3AX8A 2PIVA 4R06A 4PVUA 4OARA 3P0UA 3VT6A 2OUZA 2AA6A 5FQRA 2QE4A 5DU5A 3CDSA 2ZK2A 5KRFA 2Q7IA 2JF9A 1X7BA 1FBYA 3OAPA 2I4JA 1K74D 5DY8A 4OEAA 1EREA 2Q6SA 2YHDA 3B65A 5APKA 2V7CA 3MNPA 1ZDTA 1RK3A 5DI7A 2Q6RA 2G44A 3RUUA 2NPAA 3CWDA 3A2JA 3EYBA 1XVPB 2YJAB 3OMMA 5DKBA 1XAPA 4MGDB 3E00D 1XNNA 5DMFA 5G3JA 3B0TA 1KV6A 4O8FA 2E2RA 4A4VA 1XPCA 5KCFA 3UP3A 3L3ZA 2ZNNA 3TX7B 5DWEA 1NDEA 2Q6JA 2Q70A 1Z5XE 3X1HA 2PIUA 4ZJRA 5DXKA 2OZ7A 2HC4A 1ILHA 4FHIA 4EMAA 3HO0A 1XOWA 4NB6A 2LBDA 4MG6A 2VSTA 1X76A 3PEQA 4NUFA 1YP0A 4ZOMA 2PITA 5DMCA 5H1EA 3O1EA 2QZOB 1RDTA 4P6XA 4JYIA 3V9YA 5DXMA 4MG8B 2PIRA 1UOMA 1XP9A 3OSIA 4WHFA 2ZL9A 4QL8A 5DUEA 2H77A 2ZY0A 5L7HA 1G1UA 2ACLB 3WFGA 1T7RA 2JFAB 1ZEOA 3DR1A 4M8HA 1S0XA 2ATHA 2ZLCA 4UDCA 2QA8B 3JZBA 4REFA 4WHGA 1RKGA 3VRWA 3OKHA 1NQ1A 2EWPA 1R6GA 3D24A 2PIQA 3OS8A 3A40X 3ADSA 4N1YA 3W0GA 4YNKA 3ERDA 3OSWA 1ZKYA 4RAKA 1WM0X 1XVPA 5DL4A 4DQMA 4MGDA 4IA1A 2ZVTA 2ZXZA 3V49A 3VT4A 4S0SA 5DWLA 2FAIA 3AN3A 4DM6A 2XKWA 1FD0A 3CDPA 2REWA 5DK9A 3FEJA 5FQVA 2ZK1A 3SZ1A 3V3EA 5C4OA 1R1KA 2OCFA 4OC7A 2ZK5A 4OFUA 3W5TA 3FEIA 3NSPA 3VRUA 4OIUA 2GWXA 1IE9A 3UU7B 4G1YA 1Q4XA 3W0JA 5KROA 3FS1A 2QZOA 3VI8A 2VV4B 3X36A 1IE8A 1GS4A 4G2HA 2J7XA 1T73A 4MG8A 5DXBB 1G5YA 4PXMA 1XLSE 4OZRU 3GD2A 2ACLA 4ZN7A 1EXAA 2JFAA 3S9SA 4A4WA 2QA8A 3FURA 4WLBA 4MDDA 3VSOA 5KRLA 5EI1A 3RUTA 3L0LA 4ITFA 2AO6A 1E3GA 1R1KD 1NHZA 1TXIA 5HZCA 2B23A 2OAXA 3GZ9A 3D90A 3R5NA 1PQCA 3FALB 4JAZA 4LBDA 5DXQA 2ZNQA 4N5GA 5E19A 4MG9B 4G1ZA 5DZIA 1GWRA 3L03A 2QXMA 5IAWA 2ZBSA 3WJ5A 5AAVA 3R8IA 3HM1A 1M2ZA 2G0HA 1U3SA 4L98A 3VN2A 3OZ0A 4DK8A 1S19A 3UU7A 3G8OA 4RMCA 5KRJA 3V9TA 5KRAA 3KFCA 2VV4A 3ET3A 4IQRA 1FCZA 1DKFB 3GWXA 3SP6A 3K8SA 4REEA 4DORA 5DXBA 3CS8A 3BEJA 4MG5A 3X31A 5DWIA 2IOGA 5DYDA 4LNWA 4R2UA 4RZFA 1YOWA 1YUCA 5GICA 3KDTA 4F9MA 4WQPA 3ZR7A 4ZI1A 5CJ6A 5DUGA 1S9QA 2HBHA 5G5WA 3HC6A 3AUNA 5KCCA 5E14A 2YATA 4OJ9A 3BQDA 3VJIA 4DOSA 1X7RA 1XQCA 3B0WA 2I0JA 2AA2A 2H79A 2QSEA 3CS6A 4CI5A 3A3ZX 3GYUA 2Q1HA 2PIWA 2HAMA 3FALA 2ZMIA 3KMZA 1YINA 4MG9A 5KRMA 3AZ1A 3W0AA 4OZTU 2QPYA 4XHDA 2FVJA 3OLLA 1U9EA 2R40D 3ET0A 4PPSA 5SYZA 1NQ7A 2GPUA 3NSQA 1G2NA 2P1VA 4M8EA 1T76A 3A78A 5G43A 4B7WA 5AZVA 1ZH7A 2ZK0A 3ZRBA 5KCEA 5I4VA 1KNUA 3VTBA 3RY9A 3VHUA 3R8AA 5B5BA 4FGYA 1DKFA 1ZUCA 5DXGA 4OGHA 2QGWA 3LBDA 2GIUA 5DKGA 1KKQA 2YFEA 5DLRA 3OKIA 1QKNA 4L96A 3M7RA 2QR9A 2OM9A 1YYEA 4UDDA 5G44A 4Y29A 5HJPB 2Q61A 3GWSX 5AK2A 4UDBA 5HJSA 5DP0A 3VSPA 4LSJA 5KCTA 4ZNSA 5DSHA 5E7VA 2PKLA 2R6WA 1E3KA 1XZXX 1K4WA 3W5QA 4TV1A 1XP1A 2AAXA 2VV1B 4POHA 4WPFA 1XV9B 2Z4BA 4IVWA 5DV6A 5DYBA 2P15A 3VT7A 4RMDA 2VV2A 3K22A 2ZK4A 1QKUA 5DTVA 5DIGA 4DM8A 3V4AA 4POJA 2AB2A 4MG7B 1PK5A 4RMEA 3AUQA 4DK7A 1X7JA 3G9EA 1Y0SA 3WMHA 5HYRA 1PRGA 3SP9A 4KZJA 2AWHA 3OMKA 5EJVA 5DVSA 4IWCA 1YIMA 4R6SA 2W8YA 4ZO1B 4OJ4A 4RFWA 5AVIA 1UPVA 4QK4A 2O9IA 5KD9A 3B5RA 2PNUA 3OS9A 1N46A 3OMQA 5DZ3A 1X7EA 4JL4A 4APUA 3V9VA 5HJPA 4PP6A 4E4KA 3VJSA 4RWVA 4OKWA 1UHLB 2AMBA 5AAUA 4S15A 4PWLA 4DMAA 3KMGA 3TKMA 4S0TA 3ADVA 1NUOA 3TKCA 1Z5XU 4IV4A 2VV1A 2ZMJA 1XV9A 2I0GA 3W5RA 3L1BA 1S0ZA 2P7GA 3ADWA 3GYTA 3H0AA 3FXVA 4RUOX 2NXXE 5KCWA 5G46A 2AMAA 1HG4A 2QXSA 4PP5A 3OMPA 1RKHA 2HVCA 4MG7A 3WT5A 2QABA 1XIUA 3VT3A 1X78A 3UVVB 5APJA 5ETHA 1HJ1A 2AX8A 2G0GA 2PINA 2Q5PA 2XYJA 4RZEA 2HWRA 2P7AA 2P4YA 5DZ0A 3X1IA 5KYJA 3F7DA 4OEDA 1NYXA 3A2HA 1T7MA 1XJ7A 1YA3A 4XUMA 2PIOA 1NRLA 2QNVA 1N4HA 3ADUA 2AA7A 3B1MA 4HLWA 2Q5GA 4G2IA 3QT0A 3W0CA 3AZ2A 1XNXA 1SR7A 4IA7A 1DB1A 5KR9A 1T7TA 3H0AD 3DCUA 1ZGYA 3ZRAA 2GL8A 5KCDA 3RLLA 1UHLA 4P6WA 2HCDA 5M96A 5IZ0A 5K13A 3Q95B 2BJ4B 2HWQA 5DUHA 4XLDA 3VJHA 2AXAA 2GPPA 3B67A 2GPOA 4IA3A 3WGPA 2VV3A 3O1DA 5DXRA 1MZNA 1TFCA 3VHWA 2XYXA 2HFPA 3P8XA 4KZIA 3VJTA 1NQ0A 2R40A 3F5CB 3K23A 4S14A 3IA6A 1A52A 3G8IA 3KDUA 3UVVA 2Q1VA 5GIEA 1NQ2A 2QA6A 2B1ZA 4X1GA 5DWGA 3B68A 3CLDA 4OZTE 4OH6A 2O4RA 1I38A 2I4ZA 2P54A 3A2IA 3K6PA 2Q5SA 4IW8A 4OKTA 5KCUA 5ICKA 3KWYA 3PBAA 5HYKA 4K4JA 5IXKA 1PQ9A 1Y0XX 4OFRA 2NW4A 3HZFA 4J5WC 1U3QA 5AYGA 1SJ0A 4IV2A 4IW6A 4XT9A 5A86A 4NIEA 1Y9RA 4ZN9A 4XI3A 4OEZA 2ABIA 3ADTA 3VHVA 5AZTA 4JYGA 2ZASA 3ADXA 2F4BA 1FM6D 3HVLA 5GIDA 3ERTA 4IWFA 5GT4A 5LWPA 4XTAA 5C4TA 3Q95A 2BJ4A 4OHAA 1LV2A 4ZJWA 1PZLA 1YJEA 2HASA 2QGTA 4ZNVA 3AZ3A 2YLYA 3JZCA 2PJLA 5FQSA 3WFFA 4RE8A 4IVYA 4JGVA 5E15A 2PIPL 4JYHA 2POGA 1T65A 3BC5A 2Q7KA 4TUZB 3OGTA 2AX7A 5DX3B 3CQVA 4PLDA 3F5CA 5E0XA 2QW4A 4J5XC 1I37A 1S9PA 1ZAFA 3W0HA 4MGCA 3FLIA 3OSAA 4IS8A 4BCRA 1G50A 4UDAA 3DCTA 3CS4A 2YLOA 3G0WA 5DV3A 2I4PA 2YLPA 3V3QA 1OVLB 1N83A 4K7AA 4QE8A 2HB7A 3HLVA 3ZQTA 3TY0A 2P1TA 3OOKA 1GWXA 4RUJA 1ZDUA 4FHHA 1L2IA 4RUPA 5DVCA 4MGAB 1YY4A 1T5ZA 3MNEA 1XDKB 5DVVA 5HCVA 3L3XA 2HB8A 5KRIA 3UUCA 2YLQA 1YOKA 3ILZA 2IHQA 2ZXNA 3HODA 3B0RA 2O4JA 3P89A 3ET2A 3PCUA 1ERRA 2AYRA 3IPUA 1NAXA 3IXPA 5EHJA 3WT7A 1XQ3A 3FC6B 4IUIA 3P88A 5DKSA 3D6DA 3OLSA 5DIDA 1UPWA 4CI4A 4FNEA 2GTKA 4K6IA 1U3RA 2PRGA 4TUZA 3N00A 1QKTA 5DX3A 5E0WA 4IA2A 2OVMA 1I7IA 4G21A 4MGBB 4WVDA 3RVFA 2POBA 2G5OA 1P8DA 2Q59B 5DRJA 1PCGA 1Z95A 5EGVA 4J24A 1OVLA 1RJKA 4ITEA 1FM9A 4PRGA 4OKBA 5FQTA 1QKMA 4G1DA 4YMQA 1XB7A 1MVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZR E;  2J7Y A;  1LBD A;  1MV9 A;  2AX9 A;  3CTB A;  3IXP D;  3R5M A;  5DXE A;  4MGA A;  5C4U A;  4E2J A;  3DT3 A;  1XDK A;  4LNX A;  5E1C A;  4ZNU A;  1T7F A;  3W0Y A;  2Q7J A;  3OZJ A;  3D5F A;  4Q0A C;  5F9B A;  3WWR A;  1L2J A;  2PIX A;  4OLM A;  5DZ1 A;  1SQN A;  1H9U A;  5AWJ A;  1FCY A;  5B41 A;  4YT1 A;  4G20 A;  4KZM A;  2Q8S A;  1K7L A;  5L7G A;  2NV7 A;  3AFR A;  3FC6 A;  2P1U A;  1SKX A;  2ZMH A;  5AVL A;  1A28 A;  3OS8 C;  3KMR A;  2AM9 A;  1R5K A;  4J26 A;  4IU7 A;  1FCX A;  3DY6 A;  3RLJ A;  5DKE A;  5AAV B;  2A3I A;  1FM9 D;  3VTD A;  4Q50 A;  1RDT D;  2HAR A;  4X1F A;  3VT8 A;  4CSJ A;  4PP3 A;  3H52 A;  3VRV A;  1ILG A;  2ZK6 A;  4MGB A;  2OVH A;  3A9E B;  1T63 A;  3AN4 A;  3L0E A;  2B1V A;  5JJM B;  3MNO A;  2VV0 A;  4HEE X;  4PPP A;  1M7W A;  2Q59 A;  3KYT A;  3UUA B;  3FUG A;  5LGA A;  1T74 A;  1NAV A;  2IOK A;  2ZNO A;  3R29 A;  4XAO A;  2BAW A;  2Q7L A;  1EXX A;  1GWQ A;  4A2J A;  5DIE A;  2Q3Y A;  1OSH A;  2ZLA A;  4Q13 A;  3IMY A;  2J14 A;  3OOF A;  4PLE A;  1OT7 A;  2ZK3 A;  4FN9 A;  3B3K A;  1R20 A;  3UUD B;  3B66 A;  5FQP A;  1FM6 A;  3CJW A;  3OMO A;  2B50 A;  3VT9 A;  3IPQ A;  2YJD A;  5DZH A;  4E4Q A;  3VTC A;  2XHS A;  4LTW A;  4OK1 A;  3B0Q A;  4NY9 A;  3T03 A;  5L11 A;  4QE6 A;  3KBA A;  2XYW A;  3KPZ A;  3PO9 A;  4EM9 A;  3HC5 A;  4ZO1 X;  5G42 A;  3DZU A;  1BSX A;  4OEY A;  3VT5 A;  2Q60 A;  3IPS A;  4NQA B;  4J5W A;  2JJ3 A;  1YMT A;  2J4A A;  3LMP A;  4ONI A;  4QJR A;  3AUR A;  3W0I A;  3DZY A;  3NOA A;  1OSV A;  2AX6 A;  2NXX A;  3A9E A;  3L0J A;  5EC9 A;  4ZNT A;  5JJM A;  2ZKC A;  4QM0 A;  3UP0 A;  2Z4J A;  3E94 A;  4OIV A;  4RZG A;  2V0V A;  5DV8 A;  5AWK A;  2QTU A;  5G45 A;  3U9Q A;  5L7E A;  2GP7 A;  2P7Z A;  3R2A A;  1PQ6 A;  1R20 D;  2ZFX A;  3D57 A;  4OJB A;  1P93 A;  3UUA A;  3WJ4 A;  1XLS A;  3ET1 A;  5KRK A;  2GPV A;  5C4S A;  5APH A;  2FSZ A;  4N73 A;  5KRC A;  3WT6 A;  3OLF A;  4ZNH A;  1K74 A;  1PDU A;  2R6Y A;  3PRG A;  3PLZ A;  5DWJ A;  4OH5 A;  3UUD A;  2AA5 A;  3E7C A;  4J5X A;  4PF3 A;  3DZU D;  1VJB A;  2QMV A;  5KRH A;  1I7G A;  2ZNP A;  3GBK A;  4OIL A;  4YPQ A;  3WTQ A;  3DZY D;  3HQ5 A;  4ZNW A;  4TV1 B;  1T79 A;  5DRM A;  5KYA A;  5JY3 A;  3W5P A;  4OKX A;  3R8D A;  4N8R A;  1M13 A;  3VRT A;  3E00 A;  2QH6 A;  2VSR A;  4XUH A;  5EIT A;  5JI0 D;  5ACC A;  3GN8 A;  2ZXM A;  1XP6 A;  5DXP A;  3AX8 A;  2PIV A;  4R06 A;  4PVU A;  4OAR A;  3P0U A;  3VT6 A;  2OUZ A;  2AA6 A;  5FQR A;  2QE4 A;  5DU5 A;  3CDS A;  2ZK2 A;  5KRF A;  2Q7I A;  2JF9 A;  1X7B A;  1FBY A;  3OAP A;  2I4J A;  1K74 D;  5DY8 A;  4OEA A;  1ERE A;  2Q6S A;  2YHD A;  3B65 A;  5APK A;  2V7C A;  3MNP A;  1ZDT A;  1RK3 A;  5DI7 A;  2Q6R A;  2G44 A;  3RUU A;  2NPA A;  3CWD A;  3A2J A;  3EYB A;  1XVP B;  2YJA B;  3OMM A;  5DKB A;  1XAP A;  4MGD B;  3E00 D;  1XNN A;  5DMF A;  5G3J A;  3B0T A;  1KV6 A;  4O8F A;  2E2R A;  4A4V A;  1XPC A;  5KCF A;  3UP3 A;  3L3Z A;  2ZNN A;  3TX7 B;  5DWE A;  1NDE A;  2Q6J A;  2Q70 A;  1Z5X E;  3X1H A;  2PIU A;  4ZJR A;  5DXK A;  2OZ7 A;  2HC4 A;  1ILH A;  4FHI A;  4EMA A;  3HO0 A;  1XOW A;  4NB6 A;  2LBD A;  4MG6 A;  2VST A;  1X76 A;  3PEQ A;  4NUF A;  1YP0 A;  4ZOM A;  2PIT A;  5DMC A;  5H1E A;  3O1E A;  2QZO B;  1RDT A;  4P6X A;  4JYI A;  3V9Y A;  5DXM A;  4MG8 B;  2PIR A;  1UOM A;  1XP9 A;  3OSI A;  4WHF A;  2ZL9 A;  4QL8 A;  5DUE A;  2H77 A;  2ZY0 A;  5L7H A;  1G1U A;  2ACL B;  3WFG A;  1T7R A;  2JFA B;  1ZEO A;  3DR1 A;  4M8H A;  1S0X A;  2ATH A;  2ZLC A;  4UDC A;  2QA8 B;  3JZB A;  4REF A;  4WHG A;  1RKG A;  3VRW A;  3OKH A;  1NQ1 A;  2EWP A;  1R6G A;  3D24 A;  2PIQ A;  3OS8 A;  3A40 X;  3ADS A;  4N1Y A;  3W0G A;  4YNK A;  3ERD A;  3OSW A;  1ZKY A;  4RAK A;  1WM0 X;  1XVP A;  5DL4 A;  4DQM A;  4MGD A;  4IA1 A;  2ZVT A;  2ZXZ A;  3V49 A;  3VT4 A;  4S0S A;  5DWL A;  2FAI A;  3AN3 A;  4DM6 A;  2XKW A;  1FD0 A;  3CDP A;  2REW A;  5DK9 A;  3FEJ A;  5FQV A;  2ZK1 A;  3SZ1 A;  3V3E A;  5C4O A;  1R1K A;  2OCF A;  4OC7 A;  2ZK5 A;  4OFU A;  3W5T A;  3FEI A;  3NSP A;  3VRU A;  4OIU A;  2GWX A;  1IE9 A;  3UU7 B;  4G1Y A;  1Q4X A;  3W0J A;  5KRO A;  3FS1 A;  2QZO A;  3VI8 A;  2VV4 B;  3X36 A;  1IE8 A;  1GS4 A;  4G2H A;  2J7X A;  1T73 A;  4MG8 A;  5DXB B;  1G5Y A;  4PXM A;  1XLS E;  4OZR U;  3GD2 A;  2ACL A;  4ZN7 A;  1EXA A;  2JFA A;  3S9S A;  4A4W A;  2QA8 A;  3FUR A;  4WLB A;  4MDD A;  3VSO A;  5KRL A;  5EI1 A;  3RUT A;  3L0L A;  4ITF A;  2AO6 A;  1E3G A;  1R1K D;  1NHZ A;  1TXI A;  5HZC A;  2B23 A;  2OAX A;  3GZ9 A;  3D90 A;  3R5N A;  1PQC A;  3FAL B;  4JAZ A;  4LBD A;  5DXQ A;  2ZNQ A;  4N5G A;  5E19 A;  4MG9 B;  4G1Z A;  5DZI A;  1GWR A;  3L03 A;  2QXM A;  5IAW A;  2ZBS A;  3WJ5 A;  5AAV A;  3R8I A;  3HM1 A;  1M2Z A;  2G0H A;  1U3S A;  4L98 A;  3VN2 A;  3OZ0 A;  4DK8 A;  1S19 A;  3UU7 A;  3G8O A;  4RMC A;  5KRJ A;  3V9T A;  5KRA A;  3KFC A;  2VV4 A;  3ET3 A;  4IQR A;  1FCZ A;  1DKF B;  3GWX A;  3SP6 A;  3K8S A;  4REE A;  4DOR A;  5DXB A;  3CS8 A;  3BEJ A;  4MG5 A;  3X31 A;  5DWI A;  2IOG A;  5DYD A;  4LNW A;  4R2U A;  4RZF A;  1YOW A;  1YUC A;  5GIC A;  3KDT A;  4F9M A;  4WQP A;  3ZR7 A;  4ZI1 A;  5CJ6 A;  5DUG A;  1S9Q A;  2HBH A;  5G5W A;  3HC6 A;  3AUN A;  5KCC A;  5E14 A;  2YAT A;  4OJ9 A;  3BQD A;  3VJI A;  4DOS A;  1X7R A;  1XQC A;  3B0W A;  2I0J A;  2AA2 A;  2H79 A;  2QSE A;  3CS6 A;  4CI5 A;  3A3Z X;  3GYU A;  2Q1H A;  2PIW A;  2HAM A;  3FAL A;  2ZMI A;  3KMZ A;  1YIN A;  4MG9 A;  5KRM A;  3AZ1 A;  3W0A A;  4OZT U;  2QPY A;  4XHD A;  2FVJ A;  3OLL A;  1U9E A;  2R40 D;  3ET0 A;  4PPS A;  5SYZ A;  1NQ7 A;  2GPU A;  3NSQ A;  1G2N A;  2P1V A;  4M8E A;  1T76 A;  3A78 A;  5G43 A;  4B7W A;  5AZV A;  1ZH7 A;  2ZK0 A;  3ZRB A;  5KCE A;  5I4V A;  1KNU A;  3VTB A;  3RY9 A;  3VHU A;  3R8A A;  5B5B A;  4FGY A;  1DKF A;  1ZUC A;  5DXG A;  4OGH A;  2QGW A;  3LBD A;  2GIU A;  5DKG A;  1KKQ A;  2YFE A;  5DLR A;  3OKI A;  1QKN A;  4L96 A;  3M7R A;  2QR9 A;  2OM9 A;  1YYE A;  4UDD A;  5G44 A;  4Y29 A;  5HJP B;  2Q61 A;  3GWS X;  5AK2 A;  4UDB A;  5HJS A;  5DP0 A;  3VSP A;  4LSJ A;  5KCT A;  4ZNS A;  5DSH A;  5E7V A;  2PKL A;  2R6W A;  1E3K A;  1XZX X;  1K4W A;  3W5Q A;  4TV1 A;  1XP1 A;  2AAX A;  2VV1 B;  4POH A;  4WPF A;  1XV9 B;  2Z4B A;  4IVW A;  5DV6 A;  5DYB A;  2P15 A;  3VT7 A;  4RMD A;  2VV2 A;  3K22 A;  2ZK4 A;  1QKU A;  5DTV A;  5DIG A;  4DM8 A;  3V4A A;  4POJ A;  2AB2 A;  4MG7 B;  1PK5 A;  4RME A;  3AUQ A;  4DK7 A;  1X7J A;  3G9E A;  1Y0S A;  3WMH A;  5HYR A;  1PRG A;  3SP9 A;  4KZJ A;  2AWH A;  3OMK A;  5EJV A;  5DVS A;  4IWC A;  1YIM A;  4R6S A;  2W8Y A;  4ZO1 B;  4OJ4 A;  4RFW A;  5AVI A;  1UPV A;  4QK4 A;  2O9I A;  5KD9 A;  3B5R A;  2PNU A;  3OS9 A;  1N46 A;  3OMQ A;  5DZ3 A;  1X7E A;  4JL4 A;  4APU A;  3V9V A;  5HJP A;  4PP6 A;  4E4K A;  3VJS A;  4RWV A;  4OKW A;  1UHL B;  2AMB A;  5AAU A;  4S15 A;  4PWL A;  4DMA A;  3KMG A;  3TKM A;  4S0T A;  3ADV A;  1NUO A;  3TKC A;  1Z5X U;  4IV4 A;  2VV1 A;  2ZMJ A;  1XV9 A;  2I0G A;  3W5R A;  3L1B A;  1S0Z A;  2P7G A;  3ADW A;  3GYT A;  3H0A A;  3FXV A;  4RUO X;  2NXX E;  5KCW A;  5G46 A;  2AMA A;  1HG4 A;  2QXS A;  4PP5 A;  3OMP A;  1RKH A;  2HVC A;  4MG7 A;  3WT5 A;  2QAB A;  1XIU A;  3VT3 A;  1X78 A;  3UVV B;  5APJ A;  5ETH A;  1HJ1 A;  2AX8 A;  2G0G A;  2PIN A;  2Q5P A;  2XYJ A;  4RZE A;  2HWR A;  2P7A A;  2P4Y A;  5DZ0 A;  3X1I A;  5KYJ A;  3F7D A;  4OED A;  1NYX A;  3A2H A;  1T7M A;  1XJ7 A;  1YA3 A;  4XUM A;  2PIO A;  1NRL A;  2QNV A;  1N4H A;  3ADU A;  2AA7 A;  3B1M A;  4HLW A;  2Q5G A;  4G2I A;  3QT0 A;  3W0C A;  3AZ2 A;  1XNX A;  1SR7 A;  4IA7 A;  1DB1 A;  5KR9 A;  1T7T A;  3H0A D;  3DCU A;  1ZGY A;  3ZRA A;  2GL8 A;  5KCD A;  3RLL A;  1UHL A;  4P6W A;  2HCD A;  5M96 A;  5IZ0 A;  5K13 A;  3Q95 B;  2BJ4 B;  2HWQ A;  5DUH A;  4XLD A;  3VJH A;  2AXA A;  2GPP A;  3B67 A;  2GPO A;  4IA3 A;  3WGP A;  2VV3 A;  3O1D A;  5DXR A;  1MZN A;  1TFC A;  3VHW A;  2XYX A;  2HFP A;  3P8X A;  4KZI A;  3VJT A;  1NQ0 A;  2R40 A;  3F5C B;  3K23 A;  4S14 A;  3IA6 A;  1A52 A;  3G8I A;  3KDU A;  3UVV A;  2Q1V A;  5GIE A;  1NQ2 A;  2QA6 A;  2B1Z A;  4X1G A;  5DWG A;  3B68 A;  3CLD A;  4OZT E;  4OH6 A;  2O4R A;  1I38 A;  2I4Z A;  2P54 A;  3A2I A;  3K6P A;  2Q5S A;  4IW8 A;  4OKT A;  5KCU A;  5ICK A;  3KWY A;  3PBA A;  5HYK A;  4K4J A;  5IXK A;  1PQ9 A;  1Y0X X;  4OFR A;  2NW4 A;  3HZF A;  4J5W C;  1U3Q A;  5AYG A;  1SJ0 A;  4IV2 A;  4IW6 A;  4XT9 A;  5A86 A;  4NIE A;  1Y9R A;  4ZN9 A;  4XI3 A;  4OEZ A;  2ABI A;  3ADT A;  3VHV A;  5AZT A;  4JYG A;  2ZAS A;  3ADX A;  2F4B A;  1FM6 D;  3HVL A;  5GID A;  3ERT A;  4IWF A;  5GT4 A;  5LWP A;  4XTA A;  5C4T A;  3Q95 A;  2BJ4 A;  4OHA A;  1LV2 A;  4ZJW A;  1PZL A;  1YJE A;  2HAS A;  2QGT A;  4ZNV A;  3AZ3 A;  2YLY A;  3JZC A;  2PJL A;  5FQS A;  3WFF A;  4RE8 A;  4IVY A;  4JGV A;  5E15 A;  2PIP L;  4JYH A;  2POG A;  1T65 A;  3BC5 A;  2Q7K A;  4TUZ B;  3OGT A;  2AX7 A;  5DX3 B;  3CQV A;  4PLD A;  3F5C A;  5E0X A;  2QW4 A;  4J5X C;  1I37 A;  1S9P A;  1ZAF A;  3W0H A;  4MGC A;  3FLI A;  3OSA A;  4IS8 A;  4BCR A;  1G50 A;  4UDA A;  3DCT A;  3CS4 A;  2YLO A;  3G0W A;  5DV3 A;  2I4P A;  2YLP A;  3V3Q A;  1OVL B;  1N83 A;  4K7A A;  4QE8 A;  2HB7 A;  3HLV A;  3ZQT A;  3TY0 A;  2P1T A;  3OOK A;  1GWX A;  4RUJ A;  1ZDU A;  4FHH A;  1L2I A;  4RUP A;  5DVC A;  4MGA B;  1YY4 A;  1T5Z A;  3MNE A;  1XDK B;  5DVV A;  5HCV A;  3L3X A;  2HB8 A;  5KRI A;  3UUC A;  2YLQ A;  1YOK A;  3ILZ A;  2IHQ A;  2ZXN A;  3HOD A;  3B0R A;  2O4J A;  3P89 A;  3ET2 A;  3PCU A;  1ERR A;  2AYR A;  3IPU A;  1NAX A;  3IXP A;  5EHJ A;  3WT7 A;  1XQ3 A;  3FC6 B;  4IUI A;  3P88 A;  5DKS A;  3D6D A;  3OLS A;  5DID A;  1UPW A;  4CI4 A;  4FNE A;  2GTK A;  4K6I A;  1U3R A;  2PRG A;  4TUZ A;  3N00 A;  1QKT A;  5DX3 A;  5E0W A;  4IA2 A;  2OVM A;  1I7I A;  4G21 A;  4MGB B;  4WVD A;  3RVF A;  2POB A;  2G5O A;  1P8D A;  2Q59 B;  5DRJ A;  1PCG A;  1Z95 A;  5EGV A;  4J24 A;  1OVL A;  1RJK A;  4ITE A;  1FM9 A;  4PRG A;  4OKB A;  5FQT A;  1QKM A;  4G1D A;  4YMQ A;  1XB7 A;  1MVC A; 
#chains in the Genus database with same CATH topology
 4OZR E;  2J7Y A;  1LBD A;  1MV9 A;  2AX9 A;  3CTB A;  3IXP D;  3R5M A;  5DXE A;  4MGA A;  5C4U A;  4E2J A;  3DT3 A;  1XDK A;  4LNX A;  5E1C A;  4ZNU A;  1T7F A;  3W0Y A;  2Q7J A;  3OZJ A;  3D5F A;  4Q0A C;  5F9B A;  3WWR A;  1L2J A;  2PIX A;  4OLM A;  5DZ1 A;  1SQN A;  1H9U A;  5AWJ A;  1FCY A;  5B41 A;  4YT1 A;  4G20 A;  4KZM A;  2Q8S A;  1K7L A;  5L7G A;  2NV7 A;  3AFR A;  3FC6 A;  2P1U A;  1SKX A;  2ZMH A;  5AVL A;  1A28 A;  3OS8 C;  3KMR A;  2AM9 A;  1R5K A;  4J26 A;  4IU7 A;  1FCX A;  3DY6 A;  3RLJ A;  5DKE A;  5AAV B;  2A3I A;  1FM9 D;  3VTD A;  4Q50 A;  1RDT D;  2HAR A;  4X1F A;  3VT8 A;  4CSJ A;  4PP3 A;  3H52 A;  3VRV A;  1ILG A;  2ZK6 A;  4MGB A;  2OVH A;  3A9E B;  1T63 A;  3AN4 A;  3L0E A;  2B1V A;  5JJM B;  3MNO A;  2VV0 A;  4HEE X;  4PPP A;  1M7W A;  2Q59 A;  3KYT A;  3UUA B;  3FUG A;  5LGA A;  1T74 A;  1NAV A;  2IOK A;  2ZNO A;  3R29 A;  4XAO A;  2BAW A;  2Q7L A;  1EXX A;  1GWQ A;  4A2J A;  5DIE A;  2Q3Y A;  1OSH A;  2ZLA A;  4Q13 A;  3IMY A;  2J14 A;  3OOF A;  4PLE A;  1OT7 A;  2ZK3 A;  4FN9 A;  3B3K A;  1R20 A;  3UUD B;  3B66 A;  5FQP A;  1FM6 A;  3CJW A;  3OMO A;  2B50 A;  3VT9 A;  3IPQ A;  2YJD A;  5DZH A;  4E4Q A;  3VTC A;  2XHS A;  4LTW A;  4OK1 A;  3B0Q A;  4NY9 A;  3T03 A;  5L11 A;  4QE6 A;  3KBA A;  2XYW A;  3KPZ A;  3PO9 A;  4EM9 A;  3HC5 A;  4ZO1 X;  5G42 A;  3DZU A;  1BSX A;  4OEY A;  3VT5 A;  2Q60 A;  3IPS A;  4NQA B;  4J5W A;  2JJ3 A;  1YMT A;  2J4A A;  3LMP A;  4ONI A;  4QJR A;  3AUR A;  3W0I A;  3DZY A;  3NOA A;  1OSV A;  2AX6 A;  2NXX A;  3A9E A;  3L0J A;  5EC9 A;  4ZNT A;  5JJM A;  2ZKC A;  4QM0 A;  3UP0 A;  2Z4J A;  3E94 A;  4OIV A;  4RZG A;  2V0V A;  5DV8 A;  5AWK A;  2QTU A;  5G45 A;  3U9Q A;  5L7E A;  2GP7 A;  2P7Z A;  3R2A A;  1PQ6 A;  1R20 D;  2ZFX A;  3D57 A;  4OJB A;  1P93 A;  3UUA A;  3WJ4 A;  1XLS A;  3ET1 A;  5KRK A;  2GPV A;  5C4S A;  5APH A;  2FSZ A;  4N73 A;  5KRC A;  3WT6 A;  3OLF A;  4ZNH A;  1K74 A;  1PDU A;  2R6Y A;  3PRG A;  3PLZ A;  5DWJ A;  4OH5 A;  3UUD A;  2AA5 A;  3E7C A;  4J5X A;  4PF3 A;  3DZU D;  1VJB A;  2QMV A;  5KRH A;  1I7G A;  2ZNP A;  3GBK A;  4OIL A;  4YPQ A;  3WTQ A;  3DZY D;  3HQ5 A;  4ZNW A;  4TV1 B;  1T79 A;  5DRM A;  5KYA A;  5JY3 A;  3W5P A;  4OKX A;  3R8D A;  4N8R A;  1M13 A;  3VRT A;  3E00 A;  2QH6 A;  2VSR A;  4XUH A;  5EIT A;  5JI0 D;  5ACC A;  3GN8 A;  2ZXM A;  1XP6 A;  5DXP A;  3AX8 A;  2PIV A;  4R06 A;  4PVU A;  4OAR A;  3P0U A;  3VT6 A;  2OUZ A;  2AA6 A;  5FQR A;  2QE4 A;  5DU5 A;  3CDS A;  2ZK2 A;  5KRF A;  2Q7I A;  2JF9 A;  1X7B A;  1FBY A;  3OAP A;  2I4J A;  1K74 D;  5DY8 A;  4OEA A;  1ERE A;  2Q6S A;  2YHD A;  3B65 A;  5APK A;  2V7C A;  3MNP A;  1ZDT A;  1RK3 A;  5DI7 A;  2Q6R A;  2G44 A;  3RUU A;  2NPA A;  3CWD A;  3A2J A;  3EYB A;  1XVP B;  2YJA B;  3OMM A;  5DKB A;  1XAP A;  4MGD B;  3E00 D;  1XNN A;  5DMF A;  5G3J A;  3B0T A;  1KV6 A;  4O8F A;  2E2R A;  4A4V A;  1XPC A;  5KCF A;  3UP3 A;  3L3Z A;  2ZNN A;  3TX7 B;  5DWE A;  1NDE A;  2Q6J A;  2Q70 A;  1Z5X E;  3X1H A;  2PIU A;  4ZJR A;  5DXK A;  2OZ7 A;  2HC4 A;  1ILH A;  4FHI A;  4EMA A;  3HO0 A;  1XOW A;  4NB6 A;  2LBD A;  4MG6 A;  2VST A;  1X76 A;  3PEQ A;  4NUF A;  1YP0 A;  4ZOM A;  2PIT A;  5DMC A;  5H1E A;  3O1E A;  2QZO B;  1RDT A;  4P6X A;  4JYI A;  3V9Y A;  5DXM A;  4MG8 B;  2PIR A;  1UOM A;  1XP9 A;  3OSI A;  4WHF A;  2ZL9 A;  4QL8 A;  5DUE A;  2H77 A;  2ZY0 A;  5L7H A;  1G1U A;  2ACL B;  3WFG A;  1T7R A;  2JFA B;  1ZEO A;  3DR1 A;  4M8H A;  1S0X A;  2ATH A;  2ZLC A;  4UDC A;  2QA8 B;  3JZB A;  4REF A;  4WHG A;  1RKG A;  3VRW A;  3OKH A;  1NQ1 A;  2EWP A;  1R6G A;  3D24 A;  2PIQ A;  3OS8 A;  3A40 X;  3ADS A;  4N1Y A;  3W0G A;  4YNK A;  3ERD A;  3OSW A;  1ZKY A;  4RAK A;  1WM0 X;  1XVP A;  5DL4 A;  4DQM A;  4MGD A;  4IA1 A;  2ZVT A;  2ZXZ A;  3V49 A;  3VT4 A;  4S0S A;  5DWL A;  2FAI A;  3AN3 A;  4DM6 A;  2XKW A;  1FD0 A;  3CDP A;  2REW A;  5DK9 A;  3FEJ A;  5FQV A;  2ZK1 A;  3SZ1 A;  3V3E A;  5C4O A;  1R1K A;  2OCF A;  4OC7 A;  2ZK5 A;  4OFU A;  3W5T A;  3FEI A;  3NSP A;  3VRU A;  4OIU A;  2GWX A;  1IE9 A;  3UU7 B;  4G1Y A;  1Q4X A;  3W0J A;  5KRO A;  3FS1 A;  2QZO A;  3VI8 A;  2VV4 B;  3X36 A;  1IE8 A;  1GS4 A;  4G2H A;  2J7X A;  1T73 A;  4MG8 A;  5DXB B;  1G5Y A;  4PXM A;  1XLS E;  4OZR U;  3GD2 A;  2ACL A;  4ZN7 A;  1EXA A;  2JFA A;  3S9S A;  4A4W A;  2QA8 A;  3FUR A;  4WLB A;  4MDD A;  3VSO A;  5KRL A;  5EI1 A;  3RUT A;  3L0L A;  4ITF A;  2AO6 A;  1E3G A;  1R1K D;  1NHZ A;  1TXI A;  5HZC A;  2B23 A;  2OAX A;  3GZ9 A;  3D90 A;  3R5N A;  1PQC A;  3FAL B;  4JAZ A;  4LBD A;  5DXQ A;  2ZNQ A;  4N5G A;  5E19 A;  4MG9 B;  4G1Z A;  5DZI A;  1GWR A;  3L03 A;  2QXM A;  5IAW A;  2ZBS A;  3WJ5 A;  5AAV A;  3R8I A;  3HM1 A;  1M2Z A;  2G0H A;  1U3S A;  4L98 A;  3VN2 A;  3OZ0 A;  4DK8 A;  1S19 A;  3UU7 A;  3G8O A;  4RMC A;  5KRJ A;  3V9T A;  5KRA A;  3KFC A;  2VV4 A;  3ET3 A;  4IQR A;  1FCZ A;  1DKF B;  3GWX A;  3SP6 A;  3K8S A;  4REE A;  4DOR A;  5DXB A;  3CS8 A;  3BEJ A;  4MG5 A;  3X31 A;  5DWI A;  2IOG A;  5DYD A;  4LNW A;  4R2U A;  4RZF A;  1YOW A;  1YUC A;  5GIC A;  3KDT A;  4F9M A;  4WQP A;  3ZR7 A;  4ZI1 A;  5CJ6 A;  5DUG A;  1S9Q A;  2HBH A;  5G5W A;  3HC6 A;  3AUN A;  5KCC A;  5E14 A;  2YAT A;  4OJ9 A;  3BQD A;  3VJI A;  4DOS A;  1X7R A;  1XQC A;  3B0W A;  2I0J A;  2AA2 A;  2H79 A;  2QSE A;  3CS6 A;  4CI5 A;  3A3Z X;  3GYU A;  2Q1H A;  2PIW A;  2HAM A;  3FAL A;  2ZMI A;  3KMZ A;  1YIN A;  4MG9 A;  5KRM A;  3AZ1 A;  3W0A A;  4OZT U;  2QPY A;  4XHD A;  2FVJ A;  3OLL A;  1U9E A;  2R40 D;  3ET0 A;  4PPS A;  5SYZ A;  1NQ7 A;  2GPU A;  3NSQ A;  1G2N A;  2P1V A;  4M8E A;  1T76 A;  3A78 A;  5G43 A;  4B7W A;  5AZV A;  1ZH7 A;  2ZK0 A;  3ZRB A;  5KCE A;  5I4V A;  1KNU A;  3VTB A;  3RY9 A;  3VHU A;  3R8A A;  5B5B A;  4FGY A;  1DKF A;  1ZUC A;  5DXG A;  4OGH A;  2QGW A;  3LBD A;  2GIU A;  5DKG A;  1KKQ A;  2YFE A;  5DLR A;  3OKI A;  1QKN A;  4L96 A;  3M7R A;  2QR9 A;  2OM9 A;  1YYE A;  4UDD A;  5G44 A;  4Y29 A;  5HJP B;  2Q61 A;  3GWS X;  5AK2 A;  4UDB A;  5HJS A;  5DP0 A;  3VSP A;  4LSJ A;  5KCT A;  4ZNS A;  5DSH A;  5E7V A;  2PKL A;  2R6W A;  1E3K A;  1XZX X;  1K4W A;  3W5Q A;  4TV1 A;  1XP1 A;  2AAX A;  2VV1 B;  4POH A;  4WPF A;  1XV9 B;  2Z4B A;  4IVW A;  5DV6 A;  5DYB A;  2P15 A;  3VT7 A;  4RMD A;  2VV2 A;  3K22 A;  2ZK4 A;  1QKU A;  5DTV A;  5DIG A;  4DM8 A;  3V4A A;  4POJ A;  2AB2 A;  4MG7 B;  1PK5 A;  4RME A;  3AUQ A;  4DK7 A;  1X7J A;  3G9E A;  1Y0S A;  3WMH A;  5HYR A;  1PRG A;  3SP9 A;  4KZJ A;  2AWH A;  3OMK A;  5EJV A;  5DVS A;  4IWC A;  1YIM A;  4R6S A;  2W8Y A;  4ZO1 B;  4OJ4 A;  4RFW A;  5AVI A;  1UPV A;  4QK4 A;  2O9I A;  5KD9 A;  3B5R A;  2PNU A;  3OS9 A;  1N46 A;  3OMQ A;  5DZ3 A;  1X7E A;  4JL4 A;  4APU A;  3V9V A;  5HJP A;  4PP6 A;  4E4K A;  3VJS A;  4RWV A;  4OKW A;  1UHL B;  2AMB A;  5AAU A;  4S15 A;  4PWL A;  4DMA A;  3KMG A;  3TKM A;  4S0T A;  3ADV A;  1NUO A;  3TKC A;  1Z5X U;  4IV4 A;  2VV1 A;  2ZMJ A;  1XV9 A;  2I0G A;  3W5R A;  3L1B A;  1S0Z A;  2P7G A;  3ADW A;  3GYT A;  3H0A A;  3FXV A;  4RUO X;  2NXX E;  5KCW A;  5G46 A;  2AMA A;  1HG4 A;  2QXS A;  4PP5 A;  3OMP A;  1RKH A;  2HVC A;  4MG7 A;  3WT5 A;  2QAB A;  1XIU A;  3VT3 A;  1X78 A;  3UVV B;  5APJ A;  5ETH A;  1HJ1 A;  2AX8 A;  2G0G A;  2PIN A;  2Q5P A;  2XYJ A;  4RZE A;  2HWR A;  2P7A A;  2P4Y A;  5DZ0 A;  3X1I A;  5KYJ A;  3F7D A;  4OED A;  1NYX A;  3A2H A;  1T7M A;  1XJ7 A;  1YA3 A;  4XUM A;  2PIO A;  1NRL A;  2QNV A;  1N4H A;  3ADU A;  2AA7 A;  3B1M A;  4HLW A;  2Q5G A;  4G2I A;  3QT0 A;  3W0C A;  3AZ2 A;  1XNX A;  1SR7 A;  4IA7 A;  1DB1 A;  5KR9 A;  1T7T A;  3H0A D;  3DCU A;  1ZGY A;  3ZRA A;  2GL8 A;  5KCD A;  3RLL A;  1UHL A;  4P6W A;  2HCD A;  5M96 A;  5IZ0 A;  5K13 A;  3Q95 B;  2BJ4 B;  2HWQ A;  5DUH A;  4XLD A;  3VJH A;  2AXA A;  2GPP A;  3B67 A;  2GPO A;  4IA3 A;  3WGP A;  2VV3 A;  3O1D A;  5DXR A;  1MZN A;  1TFC A;  3VHW A;  2XYX A;  2HFP A;  3P8X A;  4KZI A;  3VJT A;  1NQ0 A;  2R40 A;  3F5C B;  3K23 A;  4S14 A;  3IA6 A;  1A52 A;  3G8I A;  3KDU A;  3UVV A;  2Q1V A;  5GIE A;  1NQ2 A;  2QA6 A;  2B1Z A;  4X1G A;  5DWG A;  3B68 A;  3CLD A;  4OZT E;  4OH6 A;  2O4R A;  1I38 A;  2I4Z A;  2P54 A;  3A2I A;  3K6P A;  2Q5S A;  4IW8 A;  4OKT A;  5KCU A;  5ICK A;  3KWY A;  3PBA A;  5HYK A;  4K4J A;  5IXK A;  1PQ9 A;  1Y0X X;  4OFR A;  2NW4 A;  3HZF A;  4J5W C;  1U3Q A;  5AYG A;  1SJ0 A;  4IV2 A;  4IW6 A;  4XT9 A;  5A86 A;  4NIE A;  1Y9R A;  4ZN9 A;  4XI3 A;  4OEZ A;  2ABI A;  3ADT A;  3VHV A;  5AZT A;  4JYG A;  2ZAS A;  3ADX A;  2F4B A;  1FM6 D;  3HVL A;  5GID A;  3ERT A;  4IWF A;  5GT4 A;  5LWP A;  4XTA A;  5C4T A;  3Q95 A;  2BJ4 A;  4OHA A;  1LV2 A;  4ZJW A;  1PZL A;  1YJE A;  2HAS A;  2QGT A;  4ZNV A;  3AZ3 A;  2YLY A;  3JZC A;  2PJL A;  5FQS A;  3WFF A;  4RE8 A;  4IVY A;  4JGV A;  5E15 A;  2PIP L;  4JYH A;  2POG A;  1T65 A;  3BC5 A;  2Q7K A;  4TUZ B;  3OGT A;  2AX7 A;  5DX3 B;  3CQV A;  4PLD A;  3F5C A;  5E0X A;  2QW4 A;  4J5X C;  1I37 A;  1S9P A;  1ZAF A;  3W0H A;  4MGC A;  3FLI A;  3OSA A;  4IS8 A;  4BCR A;  1G50 A;  4UDA A;  3DCT A;  3CS4 A;  2YLO A;  3G0W A;  5DV3 A;  2I4P A;  2YLP A;  3V3Q A;  1OVL B;  1N83 A;  4K7A A;  4QE8 A;  2HB7 A;  3HLV A;  3ZQT A;  3TY0 A;  2P1T A;  3OOK A;  1GWX A;  4RUJ A;  1ZDU A;  4FHH A;  1L2I A;  4RUP A;  5DVC A;  4MGA B;  1YY4 A;  1T5Z A;  3MNE A;  1XDK B;  5DVV A;  5HCV A;  3L3X A;  2HB8 A;  5KRI A;  3UUC A;  2YLQ A;  1YOK A;  3ILZ A;  2IHQ A;  2ZXN A;  3HOD A;  3B0R A;  2O4J A;  3P89 A;  3ET2 A;  3PCU A;  1ERR A;  2AYR A;  3IPU A;  1NAX A;  3IXP A;  5EHJ A;  3WT7 A;  1XQ3 A;  3FC6 B;  4IUI A;  3P88 A;  5DKS A;  3D6D A;  3OLS A;  5DID A;  1UPW A;  4CI4 A;  4FNE A;  2GTK A;  4K6I A;  1U3R A;  2PRG A;  4TUZ A;  3N00 A;  1QKT A;  5DX3 A;  5E0W A;  4IA2 A;  2OVM A;  1I7I A;  4G21 A;  4MGB B;  4WVD A;  3RVF A;  2POB A;  2G5O A;  1P8D A;  2Q59 B;  5DRJ A;  1PCG A;  1Z95 A;  5EGV A;  4J24 A;  1OVL A;  1RJK A;  4ITE A;  1FM9 A;  4PRG A;  4OKB A;  5FQT A;  1QKM A;  4G1D A;  4YMQ A;  1XB7 A;  1MVC A; 
#chains in the Genus database with same CATH homology
 4OZR E;  2J7Y A;  1LBD A;  1MV9 A;  2AX9 A;  3CTB A;  3IXP D;  3R5M A;  5DXE A;  4MGA A;  5C4U A;  4E2J A;  3DT3 A;  1XDK A;  4LNX A;  5E1C A;  4ZNU A;  1T7F A;  3W0Y A;  2Q7J A;  3OZJ A;  3D5F A;  4Q0A C;  5F9B A;  3WWR A;  1L2J A;  2PIX A;  4OLM A;  5DZ1 A;  1SQN A;  1H9U A;  5AWJ A;  1FCY A;  5B41 A;  4YT1 A;  4G20 A;  4KZM A;  2Q8S A;  1K7L A;  5L7G A;  2NV7 A;  3AFR A;  3FC6 A;  2P1U A;  1SKX A;  2ZMH A;  5AVL A;  1A28 A;  3OS8 C;  3KMR A;  2AM9 A;  1R5K A;  4J26 A;  4IU7 A;  1FCX A;  3DY6 A;  3RLJ A;  5DKE A;  5AAV B;  2A3I A;  1FM9 D;  3VTD A;  4Q50 A;  1RDT D;  2HAR A;  4X1F A;  3VT8 A;  4CSJ A;  4PP3 A;  3H52 A;  3VRV A;  1ILG A;  2ZK6 A;  4MGB A;  2OVH A;  3A9E B;  1T63 A;  3AN4 A;  3L0E A;  2B1V A;  5JJM B;  3MNO A;  2VV0 A;  4HEE X;  4PPP A;  1M7W A;  2Q59 A;  3KYT A;  3UUA B;  3FUG A;  5LGA A;  1T74 A;  1NAV A;  2IOK A;  2ZNO A;  3R29 A;  4XAO A;  2BAW A;  2Q7L A;  1EXX A;  1GWQ A;  4A2J A;  5DIE A;  2Q3Y A;  1OSH A;  2ZLA A;  4Q13 A;  3IMY A;  2J14 A;  3OOF A;  4PLE A;  1OT7 A;  2ZK3 A;  4FN9 A;  3B3K A;  1R20 A;  3UUD B;  3B66 A;  5FQP A;  1FM6 A;  3CJW A;  3OMO A;  2B50 A;  3VT9 A;  3IPQ A;  2YJD A;  5DZH A;  4E4Q A;  3VTC A;  2XHS A;  4LTW A;  4OK1 A;  3B0Q A;  4NY9 A;  3T03 A;  5L11 A;  4QE6 A;  3KBA A;  2XYW A;  3KPZ A;  3PO9 A;  4EM9 A;  3HC5 A;  4ZO1 X;  5G42 A;  3DZU A;  1BSX A;  4OEY A;  3VT5 A;  2Q60 A;  3IPS A;  4NQA B;  4J5W A;  2JJ3 A;  1YMT A;  2J4A A;  3LMP A;  4ONI A;  4QJR A;  3AUR A;  3W0I A;  3DZY A;  3NOA A;  1OSV A;  2AX6 A;  2NXX A;  3A9E A;  3L0J A;  5EC9 A;  4ZNT A;  5JJM A;  2ZKC A;  4QM0 A;  3UP0 A;  2Z4J A;  3E94 A;  4OIV A;  4RZG A;  2V0V A;  5DV8 A;  5AWK A;  2QTU A;  5G45 A;  3U9Q A;  5L7E A;  2GP7 A;  2P7Z A;  3R2A A;  1PQ6 A;  1R20 D;  2ZFX A;  3D57 A;  4OJB A;  1P93 A;  3UUA A;  3WJ4 A;  1XLS A;  3ET1 A;  5KRK A;  2GPV A;  5C4S A;  5APH A;  2FSZ A;  4N73 A;  5KRC A;  3WT6 A;  3OLF A;  4ZNH A;  1K74 A;  1PDU A;  2R6Y A;  3PRG A;  3PLZ A;  5DWJ A;  4OH5 A;  3UUD A;  2AA5 A;  3E7C A;  4J5X A;  4PF3 A;  3DZU D;  1VJB A;  2QMV A;  5KRH A;  1I7G A;  2ZNP A;  3GBK A;  4OIL A;  4YPQ A;  3WTQ A;  3DZY D;  3HQ5 A;  4ZNW A;  4TV1 B;  1T79 A;  5DRM A;  5KYA A;  5JY3 A;  3W5P A;  4OKX A;  3R8D A;  4N8R A;  1M13 A;  3VRT A;  3E00 A;  2QH6 A;  2VSR A;  4XUH A;  5EIT A;  5JI0 D;  5ACC A;  3GN8 A;  2ZXM A;  1XP6 A;  5DXP A;  3AX8 A;  2PIV A;  4R06 A;  4PVU A;  4OAR A;  3P0U A;  3VT6 A;  2OUZ A;  2AA6 A;  5FQR A;  2QE4 A;  5DU5 A;  3CDS A;  2ZK2 A;  5KRF A;  2Q7I A;  2JF9 A;  1X7B A;  1FBY A;  3OAP A;  2I4J A;  1K74 D;  5DY8 A;  4OEA A;  1ERE A;  2Q6S A;  2YHD A;  3B65 A;  5APK A;  2V7C A;  3MNP A;  1ZDT A;  1RK3 A;  5DI7 A;  2Q6R A;  2G44 A;  3RUU A;  2NPA A;  3CWD A;  3A2J A;  3EYB A;  1XVP B;  2YJA B;  3OMM A;  5DKB A;  1XAP A;  4MGD B;  3E00 D;  1XNN A;  5DMF A;  5G3J A;  3B0T A;  1KV6 A;  4O8F A;  2E2R A;  4A4V A;  1XPC A;  5KCF A;  3UP3 A;  3L3Z A;  2ZNN A;  3TX7 B;  5DWE A;  1NDE A;  2Q6J A;  2Q70 A;  1Z5X E;  3X1H A;  2PIU A;  4ZJR A;  5DXK A;  2OZ7 A;  2HC4 A;  1ILH A;  4FHI A;  4EMA A;  3HO0 A;  1XOW A;  4NB6 A;  2LBD A;  4MG6 A;  2VST A;  1X76 A;  3PEQ A;  4NUF A;  1YP0 A;  4ZOM A;  2PIT A;  5DMC A;  5H1E A;  3O1E A;  2QZO B;  1RDT A;  4P6X A;  4JYI A;  3V9Y A;  5DXM A;  4MG8 B;  2PIR A;  1UOM A;  1XP9 A;  3OSI A;  4WHF A;  2ZL9 A;  4QL8 A;  5DUE A;  2H77 A;  2ZY0 A;  5L7H A;  1G1U A;  2ACL B;  3WFG A;  1T7R A;  2JFA B;  1ZEO A;  3DR1 A;  4M8H A;  1S0X A;  2ATH A;  2ZLC A;  4UDC A;  2QA8 B;  3JZB A;  4REF A;  4WHG A;  1RKG A;  3VRW A;  3OKH A;  1NQ1 A;  2EWP A;  1R6G A;  3D24 A;  2PIQ A;  3OS8 A;  3A40 X;  3ADS A;  4N1Y A;  3W0G A;  4YNK A;  3ERD A;  3OSW A;  1ZKY A;  4RAK A;  1WM0 X;  1XVP A;  5DL4 A;  4DQM A;  4MGD A;  4IA1 A;  2ZVT A;  2ZXZ A;  3V49 A;  3VT4 A;  4S0S A;  5DWL A;  2FAI A;  3AN3 A;  4DM6 A;  2XKW A;  1FD0 A;  3CDP A;  2REW A;  5DK9 A;  3FEJ A;  5FQV A;  2ZK1 A;  3SZ1 A;  3V3E A;  5C4O A;  1R1K A;  2OCF A;  4OC7 A;  2ZK5 A;  4OFU A;  3W5T A;  3FEI A;  3NSP A;  3VRU A;  4OIU A;  2GWX A;  1IE9 A;  3UU7 B;  4G1Y A;  1Q4X A;  3W0J A;  5KRO A;  3FS1 A;  2QZO A;  3VI8 A;  2VV4 B;  3X36 A;  1IE8 A;  1GS4 A;  4G2H A;  2J7X A;  1T73 A;  4MG8 A;  5DXB B;  1G5Y A;  4PXM A;  1XLS E;  4OZR U;  3GD2 A;  2ACL A;  4ZN7 A;  1EXA A;  2JFA A;  3S9S A;  4A4W A;  2QA8 A;  3FUR A;  4WLB A;  4MDD A;  3VSO A;  5KRL A;  5EI1 A;  3RUT A;  3L0L A;  4ITF A;  2AO6 A;  1E3G A;  1R1K D;  1NHZ A;  1TXI A;  5HZC A;  2B23 A;  2OAX A;  3GZ9 A;  3D90 A;  3R5N A;  1PQC A;  3FAL B;  4JAZ A;  4LBD A;  5DXQ A;  2ZNQ A;  4N5G A;  5E19 A;  4MG9 B;  4G1Z A;  5DZI A;  1GWR A;  3L03 A;  2QXM A;  5IAW A;  2ZBS A;  3WJ5 A;  5AAV A;  3R8I A;  3HM1 A;  1M2Z A;  2G0H A;  1U3S A;  4L98 A;  3VN2 A;  3OZ0 A;  4DK8 A;  1S19 A;  3UU7 A;  3G8O A;  4RMC A;  5KRJ A;  3V9T A;  5KRA A;  3KFC A;  2VV4 A;  3ET3 A;  4IQR A;  1FCZ A;  1DKF B;  3GWX A;  3SP6 A;  3K8S A;  4REE A;  4DOR A;  5DXB A;  3CS8 A;  3BEJ A;  4MG5 A;  3X31 A;  5DWI A;  2IOG A;  5DYD A;  4LNW A;  4R2U A;  4RZF A;  1YOW A;  1YUC A;  5GIC A;  3KDT A;  4F9M A;  4WQP A;  3ZR7 A;  4ZI1 A;  5CJ6 A;  5DUG A;  1S9Q A;  2HBH A;  5G5W A;  3HC6 A;  3AUN A;  5KCC A;  5E14 A;  2YAT A;  4OJ9 A;  3BQD A;  3VJI A;  4DOS A;  1X7R A;  1XQC A;  3B0W A;  2I0J A;  2AA2 A;  2H79 A;  2QSE A;  3CS6 A;  4CI5 A;  3A3Z X;  3GYU A;  2Q1H A;  2PIW A;  2HAM A;  3FAL A;  2ZMI A;  3KMZ A;  1YIN A;  4MG9 A;  5KRM A;  3AZ1 A;  3W0A A;  4OZT U;  2QPY A;  4XHD A;  2FVJ A;  3OLL A;  1U9E A;  2R40 D;  3ET0 A;  4PPS A;  5SYZ A;  1NQ7 A;  2GPU A;  3NSQ A;  1G2N A;  2P1V A;  4M8E A;  1T76 A;  3A78 A;  5G43 A;  4B7W A;  5AZV A;  1ZH7 A;  2ZK0 A;  3ZRB A;  5KCE A;  5I4V A;  1KNU A;  3VTB A;  3RY9 A;  3VHU A;  3R8A A;  5B5B A;  4FGY A;  1DKF A;  1ZUC A;  5DXG A;  4OGH A;  2QGW A;  3LBD A;  2GIU A;  5DKG A;  1KKQ A;  2YFE A;  5DLR A;  3OKI A;  1QKN A;  4L96 A;  3M7R A;  2QR9 A;  2OM9 A;  1YYE A;  4UDD A;  5G44 A;  4Y29 A;  5HJP B;  2Q61 A;  3GWS X;  5AK2 A;  4UDB A;  5HJS A;  5DP0 A;  3VSP A;  4LSJ A;  5KCT A;  4ZNS A;  5DSH A;  5E7V A;  2PKL A;  2R6W A;  1E3K A;  1XZX X;  1K4W A;  3W5Q A;  4TV1 A;  1XP1 A;  2AAX A;  2VV1 B;  4POH A;  4WPF A;  1XV9 B;  2Z4B A;  4IVW A;  5DV6 A;  5DYB A;  2P15 A;  3VT7 A;  4RMD A;  2VV2 A;  3K22 A;  2ZK4 A;  1QKU A;  5DTV A;  5DIG A;  4DM8 A;  3V4A A;  4POJ A;  2AB2 A;  4MG7 B;  1PK5 A;  4RME A;  3AUQ A;  4DK7 A;  1X7J A;  3G9E A;  1Y0S A;  3WMH A;  5HYR A;  1PRG A;  3SP9 A;  4KZJ A;  2AWH A;  3OMK A;  5EJV A;  5DVS A;  4IWC A;  1YIM A;  4R6S A;  2W8Y A;  4ZO1 B;  4OJ4 A;  4RFW A;  5AVI A;  1UPV A;  4QK4 A;  2O9I A;  5KD9 A;  3B5R A;  2PNU A;  3OS9 A;  1N46 A;  3OMQ A;  5DZ3 A;  1X7E A;  4JL4 A;  4APU A;  3V9V A;  5HJP A;  4PP6 A;  4E4K A;  3VJS A;  4RWV A;  4OKW A;  1UHL B;  2AMB A;  5AAU A;  4S15 A;  4PWL A;  4DMA A;  3KMG A;  3TKM A;  4S0T A;  3ADV A;  1NUO A;  3TKC A;  1Z5X U;  4IV4 A;  2VV1 A;  2ZMJ A;  1XV9 A;  2I0G A;  3W5R A;  3L1B A;  1S0Z A;  2P7G A;  3ADW A;  3GYT A;  3H0A A;  3FXV A;  4RUO X;  2NXX E;  5KCW A;  5G46 A;  2AMA A;  1HG4 A;  2QXS A;  4PP5 A;  3OMP A;  1RKH A;  2HVC A;  4MG7 A;  3WT5 A;  2QAB A;  1XIU A;  3VT3 A;  1X78 A;  3UVV B;  5APJ A;  5ETH A;  1HJ1 A;  2AX8 A;  2G0G A;  2PIN A;  2Q5P A;  2XYJ A;  4RZE A;  2HWR A;  2P7A A;  2P4Y A;  5DZ0 A;  3X1I A;  5KYJ A;  3F7D A;  4OED A;  1NYX A;  3A2H A;  1T7M A;  1XJ7 A;  1YA3 A;  4XUM A;  2PIO A;  1NRL A;  2QNV A;  1N4H A;  3ADU A;  2AA7 A;  3B1M A;  4HLW A;  2Q5G A;  4G2I A;  3QT0 A;  3W0C A;  3AZ2 A;  1XNX A;  1SR7 A;  4IA7 A;  1DB1 A;  5KR9 A;  1T7T A;  3H0A D;  3DCU A;  1ZGY A;  3ZRA A;  2GL8 A;  5KCD A;  3RLL A;  1UHL A;  4P6W A;  2HCD A;  5M96 A;  5IZ0 A;  5K13 A;  3Q95 B;  2BJ4 B;  2HWQ A;  5DUH A;  4XLD A;  3VJH A;  2AXA A;  2GPP A;  3B67 A;  2GPO A;  4IA3 A;  3WGP A;  2VV3 A;  3O1D A;  5DXR A;  1MZN A;  1TFC A;  3VHW A;  2XYX A;  2HFP A;  3P8X A;  4KZI A;  3VJT A;  1NQ0 A;  2R40 A;  3F5C B;  3K23 A;  4S14 A;  3IA6 A;  1A52 A;  3G8I A;  3KDU A;  3UVV A;  2Q1V A;  5GIE A;  1NQ2 A;  2QA6 A;  2B1Z A;  4X1G A;  5DWG A;  3B68 A;  3CLD A;  4OZT E;  4OH6 A;  2O4R A;  1I38 A;  2I4Z A;  2P54 A;  3A2I A;  3K6P A;  2Q5S A;  4IW8 A;  4OKT A;  5KCU A;  5ICK A;  3KWY A;  3PBA A;  5HYK A;  4K4J A;  5IXK A;  1PQ9 A;  1Y0X X;  4OFR A;  2NW4 A;  3HZF A;  4J5W C;  1U3Q A;  5AYG A;  1SJ0 A;  4IV2 A;  4IW6 A;  4XT9 A;  5A86 A;  4NIE A;  1Y9R A;  4ZN9 A;  4XI3 A;  4OEZ A;  2ABI A;  3ADT A;  3VHV A;  5AZT A;  4JYG A;  2ZAS A;  3ADX A;  2F4B A;  1FM6 D;  3HVL A;  5GID A;  3ERT A;  4IWF A;  5GT4 A;  5LWP A;  4XTA A;  5C4T A;  3Q95 A;  2BJ4 A;  4OHA A;  1LV2 A;  4ZJW A;  1PZL A;  1YJE A;  2HAS A;  2QGT A;  4ZNV A;  3AZ3 A;  2YLY A;  3JZC A;  2PJL A;  5FQS A;  3WFF A;  4RE8 A;  4IVY A;  4JGV A;  5E15 A;  2PIP L;  4JYH A;  2POG A;  1T65 A;  3BC5 A;  2Q7K A;  4TUZ B;  3OGT A;  2AX7 A;  5DX3 B;  3CQV A;  4PLD A;  3F5C A;  5E0X A;  2QW4 A;  4J5X C;  1I37 A;  1S9P A;  1ZAF A;  3W0H A;  4MGC A;  3FLI A;  3OSA A;  4IS8 A;  4BCR A;  1G50 A;  4UDA A;  3DCT A;  3CS4 A;  2YLO A;  3G0W A;  5DV3 A;  2I4P A;  2YLP A;  3V3Q A;  1OVL B;  1N83 A;  4K7A A;  4QE8 A;  2HB7 A;  3HLV A;  3ZQT A;  3TY0 A;  2P1T A;  3OOK A;  1GWX A;  4RUJ A;  1ZDU A;  4FHH A;  1L2I A;  4RUP A;  5DVC A;  4MGA B;  1YY4 A;  1T5Z A;  3MNE A;  1XDK B;  5DVV A;  5HCV A;  3L3X A;  2HB8 A;  5KRI A;  3UUC A;  2YLQ A;  1YOK A;  3ILZ A;  2IHQ A;  2ZXN A;  3HOD A;  3B0R A;  2O4J A;  3P89 A;  3ET2 A;  3PCU A;  1ERR A;  2AYR A;  3IPU A;  1NAX A;  3IXP A;  5EHJ A;  3WT7 A;  1XQ3 A;  3FC6 B;  4IUI A;  3P88 A;  5DKS A;  3D6D A;  3OLS A;  5DID A;  1UPW A;  4CI4 A;  4FNE A;  2GTK A;  4K6I A;  1U3R A;  2PRG A;  4TUZ A;  3N00 A;  1QKT A;  5DX3 A;  5E0W A;  4IA2 A;  2OVM A;  1I7I A;  4G21 A;  4MGB B;  4WVD A;  3RVF A;  2POB A;  2G5O A;  1P8D A;  2Q59 B;  5DRJ A;  1PCG A;  1Z95 A;  5EGV A;  4J24 A;  1OVL A;  1RJK A;  4ITE A;  1FM9 A;  4PRG A;  4OKB A;  5FQT A;  1QKM A;  4G1D A;  4YMQ A;  1XB7 A;  1MVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...