2P15A

Crystal structure of the er alpha ligand binding domain with the agonist ortho-trifluoromethylphenylvinyl estradiol
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
245
structure length
242
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural plasticity in the oestrogen receptor ligand-binding domain.
pubmed doi rcsb
molecule keywords Estrogen receptor
molecule tags Hormone receptor
source organism Homo sapiens
total genus 95
structure length 242
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2p15A00
1PCGA 2VV0A 3VJTA 3ADVA 1T5ZA 2Q61A 1PRGA 4E4KA 3R8DA 3DZYA 4UDCA 2ZK4A 4OKBA 4RUOX 5DIDA 1Z5XU 3F5CA 3ET2A 5DWLA 2R6YA 3VTCA 2Q8SA 1LBDA 4E4QA 3K6PA 5G45A 2GP7A 5EJVA 2Q70A 3LBDA 4IWFA 1XAPA 2HASA 3TKCA 4NQAB 3W5QA 4JAZA 3VT5A 4DM6A 3R5NA 5KRIA 3A2JA 3CDPA 3UVVB 3ADXA 3R2AA 2J4AA 1LV2A 3O1EA 1YIMA 2ZK5A 3H0AA 2GL8A 2PJLA 3PO9A 1K7LA 4OEAA 3G9EA 3S9SA 3R29A 3FALB 2OVHA 2P7ZA 4S15A 4OH6A 2OUZA 2Q59B 1RKHA 3VT3A 3BQDA 1EREA 3U9QA 4IA2A 5DXEA 5KRFA 4G1DA 1K4WA 3GN8A 2ZNOA 2JF9A 1XOWA 2QA8A 2PIWA 5AWJA 4B7WA 5KD9A 3VT4A 4G1ZA 4IS8A 1FCYA 3HLVA 5APKA 4MGDA 2AA5A 2AMBA 3W0GA 2QZOB 3V49A 3VRWA 1XQ3A 5DWJA 4PP6A 1YOWA 5KCUA 4G20A 3FXVA 2PKLA 1ZUCA 3W0YA 2POBA 2VV1A 4G2IA 4JL4A 3DR1A 3LMPA 5DV3A 4PPSA 3AZ2A 3ERTA 3VRVA 4FHHA 1GWRA 2Q6SA 4IV2A 3OMMA 5KCTA 1T7FA 4OEDA 4MGBB 4WHFA 2XYXA 1R6GA 1E3GA 1S0XA 3L03A 3AFRA 2OAXA 3Q95A 5C4SA 4POJA 2Q5GA 4YMQA 3IA6A 3UU7A 3VRUA 2HC4A 2IOGA 2Q60A 5DKGA 4LNXA 1Z5XE 3HQ5A 1FCXA 4YT1A 1A28A 5E14A 2VV4B 2P1TA 2YFEA 3WT7A 2ZXMA 1K74D 3HM1A 4JGVA 3F5CB 4NIEA 3FC6A 2XHSA 3AUNA 2QNVA 3E00D 4RAKA 3R8AA 1X7JA 3VT6A 1PQ6A 3JZCA 1KV6A 2QGTA 3OSAA 1SKXA 4DQMA 3UP0A 1MV9A 4QJRA 3B0QA 1NUOA 3IXPD 2J14A 2R6WA 5DWGA 5AWKA 1X7EA 1XDKB 1HG4A 5DZ0A 4IV4A 5DV6A 2HWQA 1NQ0A 4UDBA 1N83A 5DMCA 2QE4A 2ZK6A 5DP0A 3OGTA 1QKMA 3L3XA 4QE8A 5L11A 4OKXA 5C4UA 3CS4A 2QSEA 5E0WA 4OZRU 3B3KA 3OOKA 2VV2A 2QA8B 4J5WA 2QTUA 3SP6A 1MZNA 1GWXA 4G2HA 1S9QA 5DXQA 4OHAA 3UVVA 1L2JA 2B50A 5EITA 4IQRA 5KCWA 5KRLA 1G1UA 2EWPA 3FALA 4L98A 2QMVA 4RMCA 5KRJA 2Q59A 4J24A 3GYUA 3KDTA 3A40X 3P8XA 3GBKA 5KYJA 1ERRA 2ZMIA 4N1YA 5KRHA 3AZ3A 3W0IA 1RDTD 4IA1A 4PPPA 2AA7A 1Y0SA 1FM6A 4R2UA 5HCVA 4ITFA 1QKTA 2R40A 5KRAA 3KWYA 1T63A 5DYDA 4RZFA 2QZOA 3OKHA 1X7BA 2B1ZA 5L7GA 1RK3A 4CSJA 2PIXA 3UU7B 2ZXZA 3MNPA 2ZK2A 3OS9A 2HFPA 3VT7A 4Q50A 3MNOA 3W0JA 3WWRA 4CI4A 3KMZA 3KDUA 3ILZA 4NUFA 1U3SA 3PEQA 2YLYA 3QT0A 5E15A 5IZ0A 2HBHA 3B68A 1ILGA 5FQTA 3V9YA 4OILA 1T7TA 4LBDA 5AAUA 4MGBA 2OVMA 4WVDA 5AAVB 2Q1HA 3FEIA 4RWVA 4N8RA 1XP9A 1Y0XX 5C4TA 1WM0X 1XLSA 2YLOA 1XPCA 3N00A 3L0JA 3L0LA 2ZKCA 3L3ZA 3SZ1A 2NXXE 5FQSA 1NRLA 3W0CA 3WTQA 5DX3A 3RLJA 4YPQA 3UUAB 1I7GA 3KPZA 1UPVA 4OKTA 1T76A 5HJPA 4RFWA 3CS6A 2VV4A 3K8SA 1PQ9A 1FM9A 2B1VA 2QABA 3E7CA 1R1KD 3KMRA 4HEEX 3OSIA 5K13A 5M96A 1S9PA 2HAMA 3PRGA 4OZRE 4Q0AC 1YJEA 2AB2A 4WHGA 5DZHA 3WFGA 4K6IA 2PIUA 4FHIA 2P15A 2GPPA 4L96A 3KFCA 3ERDA 3CWDA 3DCUA 4MDDA 1YY4A 3DZUD 1PDUA 4TUZA 1XVPB 2QH6A 1XDKA 3OZJA 3FS1A 1FBYA 3RUUA 4WQPA 2G0HA 2PINA 4Q13A 4ZN7A 2AWHA 2Z4JA 1I38A 4LTWA 4OK1A 3MNEA 5DRJA 4WLBA 1Q4XA 3HC6A 3ET3A 2FSZA 5E7VA 2H77A 2AAXA 4DK7A 2JJ3A 1DB1A 1RKGA 2Z4BA 2YJAB 1M13A 2GWXA 4DK8A 4HLWA 3W5TA 2G44A 5A86A 3CS8A 2GTKA 4S14A 3OMPA 4RMEA 2ZK3A 4J5XA 4OGHA 3NSQA 2GIUA 3HO0A 4TV1B 4PP5A 4N5GA 4ZJWA 1P93A 3VT9A 2AYRA 2FVJA 3L0EA 2PITA 5EI1A 1I37A 1KKQA 5EC9A 3W0AA 1TFCA 4IA3A 3ET1A 2ZNQA 2QPYA 4P6XA 4X1GA 5C4OA 1XP1A 2HB8A 2P7GA 2V0VA 4FN9A 1NDEA 4OFRA 4OJ9A 5JI0D 2Q6JA 4E2JA 1X76A 3X36A 4OJ4A 4PWLA 3GZ9A 4R06A 1MVCA 4S0SA 5DX3B 5DZIA 2ZNPA 4NB6A 2LBDA 5HJPB 4NY9A 4PXMA 4REEA 2Q5PA 2PIOA 2F4BA 1T74A 1YMTA 2HB7A 5EHJA 2GPUA 2PIVA 3B5RA 3GD2A 4MG7B 3KBAA 4RZEA 2HCDA 3DY6A 4PLEA 5AVIA 5KYAA 3V9VA 4DOSA 3G0WA 5I4VA 5AAVA 3TY0A 2GPOA 4J26A 4OC7A 2Q7JA 3VI8A 4PRGA 2QA6A 4MG5A 5L7EA 1ZAFA 4QL8A 3F7DA 4XUHA 3DZYD 1KNUA 2PIQA 3A78A 3JZBA 3OZ0A 3IPSA 2Q3YA 3PLZA 4RZGA 5JY3A 5DXMA 5FQPA 3UUAA 2O9IA 4PVUA 4TUZB 1T79A 1S19A 1ZH7A 4N73A 1ZKYA 2ZMHA 3SP9A 1YOKA 4J5XC 3X1IA 3B67A 2G0GA 2Q6RA 2Q7LA 3B0RA 4G1YA 1R20A 5DUHA 2QXMA 5DZ1A 2I0GA 3P88A 1DKFB 4XAOA 3H52A 2AA6A 3VJIA 5G43A 2I4ZA 3H0AD 1M7WA 4EMAA 5E19A 5AYGA 5HYKA 4LSJA 4ZNVA 4BCRA 2AX7A 3PBAA 5SYZA 1OT7A 4PP3A 5HJSA 3EYBA 1XVPA 1SR7A 5DXRA 2PRGA 1NQ1A 5H1EA 3D24A 4QM0A 3D90A 3D5FA 2ZFXA 4MGAB 5DKSA 1ZDTA 5DY8A 2O4RA 2ZK0A 4ZJRA 4XHDA 4IA7A 3WJ4A 3W0HA 2P1VA 2P54A 3KMGA 3OS8C 2OCFA 3OAPA 3R5MA 5L7HA 3AN3A 5DWEA 1YINA 3VJSA 5E0XA 1S0ZA 1ZDUA 2Q5SA 4IUIA 3V3EA 5DU5A 5KROA 4OH5A 5KRMA 3D6DA 2NW4A 2ZMJA 4KZJA 4RMDA 4TV1A 5B41A 1BSXA 1T7MA 3PCUA 4FGYA 4ZO1X 1QKNA 2H79A 2AMAA 3ZRAA 4PF3A 1PK5A 5APJA 1NAXA 2I4PA 4KZIA 3X1HA 2ZL9A 1XNNA 4MG9A 3ADWA 3VHVA 3CLDA 4XUMA 2ABIA 2VSRA 2YLPA 4ZNUA 1QKUA 2I0JA 1N4HA 2QR9A 2REWA 2V7CA 4O8FA 4A4VA 3X31A 1OSHA 4UDAA 4OARA 3GYTA 1XZXX 3A2HA 4IU7A 4REFA 3A9EB 1PZLA 1YUCA 3IMYA 5DXBB 5G3JA 3OLFA 3VTBA 2POGA 3V9TA 3WT5A 2JFAA 2ZNNA 5KCFA 5ACCA 3ADUA 1X78A 2YHDA 3OLLA 4CI5A 2IOKA 1UOMA 4MG7A 4A2JA 2J7YA 5F9BA 2OM9A 3T03A 2AO6A 5DKEA 3OOFA 4ZO1B 5AZTA 3DCTA 2G5OA 1ZEOA 3AZ1A 3WGPA 4IVYA 3RVFA 5KR9A 4ITEA 1XV9B 4K4JA 1M2ZA 2AA2A 3A2IA 2ZLAA 5LGAA 2ACLB 1YP0A 4ZN9A 3FUGA 1K74A 4ZI1A 2I4JA 5EGVA 4EM9A 4XT9A 1XJ7A 3WJ5A 2J7XA 4XI3A 3E00A 1SQNA 4POHA 3GWXA 1NHZA 5DUGA 3A3ZX 5GT4A 1RJKA 1DKFA 4FNEA 1ZGYA 4ZNTA 4XLDA 5DWIA 3BC5A 5FQRA 3R8IA 2BAWA 3IXPA 2VV3A 5DVVA 2YLQA 4MG8B 4KZMA 4IVWA 2PNUA 5DZ3A 5IAWA 3VRTA 4UDDA 2XKWA 1IE8A 3B65A 3TKMA 3VSOA 4JYHA 5KRCA 1A52A 1Z95A 1P8DA 3K22A 1L2IA 4MGAA 2P4YA 3V4AA 1EXAA 3HVLA 1FM6D 1OVLB 2ZASA 2YATA 5DSHA 3B1MA 3OMQA 4M8EA 2ZK1A 4ONIA 2R40D 5DL4A 2BJ4A 2VSTA 5FQVA 4MG9B 3AN4A 5ICKA 3TX7B 3HODA 3G8IA 3AX8A 1NYXA 5AVLA 3VSPA 2IHQA 2AX6A 5DMFA 2NXXA 5DVSA 4RUPA 2OZ7A 3D57A 2ZXNA 3DT3A 4F9MA 5JJMB 3UUDB 5DVCA 2ZY0A 4YNKA 5DKBA 5DRMA 3NSPA 2A3IA 2JFAB 3B0TA 5GIEA 1RDTA 3OS8A 1VJBA 3WFFA 2ZVTA 2Q7IA 5GIDA 3AUQA 4XTAA 1SJ0A 1UHLA 3VT8A 3B0WA 4APUA 5KCEA 1ILHA 3CJWA 1U9EA 3NOAA 5DXKA 4G21A 1FM9D 2P7AA 3A9EA 3OMOA 4IW8A 1NQ7A 1IE9A 2NV7A 1T7RA 5DXBA 2HWRA 4M8HA 3G8OA 3VTDA 1N46A 2Q1VA 4MG6A 2PIPL 4S0TA 1XQCA 5IXKA 1YYEA 4A4WA 3L1BA 3P89A 1Y9RA 3RLLA 1G2NA 3VN2A 5CJ6A 1U3QA 5KCDA 2ATHA 4ZOMA 5ETHA 1GS4A 2XYJA 5DI7A 5E1CA 1NAVA 2AXAA 1G5YA 2O4JA 3HC5A 2QW4A 4OJBA 1XV9A 3OMKA 4OZTU 3ZR7A 5G44A 5HZCA 2ACLA 5DXGA 2AX9A 3CTBA 1R1KA 1NQ2A 3VHWA 3HZFA 3E94A 4MGCA 4OEZA 1XLSE 4ZNSA 1X7RA 4OLMA 4WPFA 4DORA 2GPVA 1H9UA 2NPAA 5LWPA 3IPQA 1T65A 2W8YA 3O1DA 4R6SA 5DK9A 5G42A 2ZBSA 3ADTA 3FLIA 1UPWA 5AZVA 2BJ4B 3OLSA 5G46A 4OIVA 3DZUA 2ZLCA 1YA3A 4JYIA 2P1UA 4MG8A 5KRKA 2E2RA 3IPUA 4X1FA 5KCCA 4Y29A 3ZQTA 1U3RA 3FURA 4RUJA 5DXPA 1PQCA 1T73A 4K7AA 4MGDB 4DMAA 1OVLA 1GWQA 5APHA 3ZRBA 3B66A 4OFUA 3UUCA 1FD0A 3CQVA 5DIEA 4DM8A 1TXIA 5B5BA 3OSWA 2B23A 3WT6A 2VV1B 5HYRA 3RY9A 2QXSA 1HJ1A 1UHLB 3AURA 3UP3A 3WMHA 1EXXA 5G5WA 3RUTA 1FCZA 3KYTA 1E3KA 4JYGA 4PLDA 1XIUA 1XP6A 5JJMA 3K23A 3UUDA 3V3QA 2AX8A 3VJHA 5AK2A 4OEYA 3ET0A 5DTVA 3W5RA 3Q95B 5DIGA 2Q7KA 3GWSX 5GICA 2QGWA 4QE6A 4ZNHA 1G50A 1OSVA 2YJDA 3ADSA 4IW6A 3FEJA 5DYBA 4QK4A 2PIRA 1XB7A 1R5KA 4ZNWA 4OZTE 1I7IA 2FAIA 4OKWA 2HVCA 2XYWA 3W5PA 3M7RA 3P0UA 1XNXA 3FC6B 3OKIA 3BEJA 3VHUA 4LNWA 4P6WA 5DLRA 2AM9A 1R20D 5DV8A 5DUEA 3CDSA 4OIUA 2HARA 4J5WC 4IWCA 4RE8A
chains in the Genus database with same CATH superfamily
1PCGA 2VV0A 3VJTA 3ADVA 1T5ZA 2Q61A 1PRGA 4E4KA 3R8DA 3DZYA 4UDCA 2ZK4A 4OKBA 4RUOX 5DIDA 1Z5XU 3F5CA 3ET2A 5DWLA 2R6YA 3VTCA 2Q8SA 1LBDA 4E4QA 3K6PA 5G45A 2GP7A 5EJVA 2Q70A 3LBDA 4IWFA 1XAPA 2HASA 3TKCA 4NQAB 3W5QA 4JAZA 3VT5A 4DM6A 3R5NA 5KRIA 3A2JA 3CDPA 3UVVB 3ADXA 3R2AA 2J4AA 1LV2A 3O1EA 1YIMA 2ZK5A 3H0AA 2GL8A 2PJLA 3PO9A 1K7LA 4OEAA 3G9EA 3S9SA 3R29A 3FALB 2OVHA 2P7ZA 4S15A 4OH6A 2OUZA 2Q59B 1RKHA 3VT3A 3BQDA 1EREA 3U9QA 4IA2A 5DXEA 5KRFA 4G1DA 1K4WA 3GN8A 2ZNOA 2JF9A 1XOWA 2QA8A 2PIWA 5AWJA 4B7WA 5KD9A 3VT4A 4G1ZA 4IS8A 1FCYA 3HLVA 5APKA 4MGDA 2AA5A 2AMBA 3W0GA 2QZOB 3V49A 3VRWA 1XQ3A 5DWJA 4PP6A 1YOWA 5KCUA 4G20A 3FXVA 2PKLA 1ZUCA 3W0YA 2POBA 2VV1A 4G2IA 4JL4A 3DR1A 3LMPA 5DV3A 4PPSA 3AZ2A 3ERTA 3VRVA 4FHHA 1GWRA 2Q6SA 4IV2A 3OMMA 5KCTA 1T7FA 4OEDA 4MGBB 4WHFA 2XYXA 1R6GA 1E3GA 1S0XA 3L03A 3AFRA 2OAXA 3Q95A 5C4SA 4POJA 2Q5GA 4YMQA 3IA6A 3UU7A 3VRUA 2HC4A 2IOGA 2Q60A 5DKGA 4LNXA 1Z5XE 3HQ5A 1FCXA 4YT1A 1A28A 5E14A 2VV4B 2P1TA 2YFEA 3WT7A 2ZXMA 1K74D 3HM1A 4JGVA 3F5CB 4NIEA 3FC6A 2XHSA 3AUNA 2QNVA 3E00D 4RAKA 3R8AA 1X7JA 3VT6A 1PQ6A 3JZCA 1KV6A 2QGTA 3OSAA 1SKXA 4DQMA 3UP0A 1MV9A 4QJRA 3B0QA 1NUOA 3IXPD 2J14A 2R6WA 5DWGA 5AWKA 1X7EA 1XDKB 1HG4A 5DZ0A 4IV4A 5DV6A 2HWQA 1NQ0A 4UDBA 1N83A 5DMCA 2QE4A 2ZK6A 5DP0A 3OGTA 1QKMA 3L3XA 4QE8A 5L11A 4OKXA 5C4UA 3CS4A 2QSEA 5E0WA 4OZRU 3B3KA 3OOKA 2VV2A 2QA8B 4J5WA 2QTUA 3SP6A 1MZNA 1GWXA 4G2HA 1S9QA 5DXQA 4OHAA 3UVVA 1L2JA 2B50A 5EITA 4IQRA 5KCWA 5KRLA 1G1UA 2EWPA 3FALA 4L98A 2QMVA 4RMCA 5KRJA 2Q59A 4J24A 3GYUA 3KDTA 3A40X 3P8XA 3GBKA 5KYJA 1ERRA 2ZMIA 4N1YA 5KRHA 3AZ3A 3W0IA 1RDTD 4IA1A 4PPPA 2AA7A 1Y0SA 1FM6A 4R2UA 5HCVA 4ITFA 1QKTA 2R40A 5KRAA 3KWYA 1T63A 5DYDA 4RZFA 2QZOA 3OKHA 1X7BA 2B1ZA 5L7GA 1RK3A 4CSJA 2PIXA 3UU7B 2ZXZA 3MNPA 2ZK2A 3OS9A 2HFPA 3VT7A 4Q50A 3MNOA 3W0JA 3WWRA 4CI4A 3KMZA 3KDUA 3ILZA 4NUFA 1U3SA 3PEQA 2YLYA 3QT0A 5E15A 5IZ0A 2HBHA 3B68A 1ILGA 5FQTA 3V9YA 4OILA 1T7TA 4LBDA 5AAUA 4MGBA 2OVMA 4WVDA 5AAVB 2Q1HA 3FEIA 4RWVA 4N8RA 1XP9A 1Y0XX 5C4TA 1WM0X 1XLSA 2YLOA 1XPCA 3N00A 3L0JA 3L0LA 2ZKCA 3L3ZA 3SZ1A 2NXXE 5FQSA 1NRLA 3W0CA 3WTQA 5DX3A 3RLJA 4YPQA 3UUAB 1I7GA 3KPZA 1UPVA 4OKTA 1T76A 5HJPA 4RFWA 3CS6A 2VV4A 3K8SA 1PQ9A 1FM9A 2B1VA 2QABA 3E7CA 1R1KD 3KMRA 4HEEX 3OSIA 5K13A 5M96A 1S9PA 2HAMA 3PRGA 4OZRE 4Q0AC 1YJEA 2AB2A 4WHGA 5DZHA 3WFGA 4K6IA 2PIUA 4FHIA 2P15A 2GPPA 4L96A 3KFCA 3ERDA 3CWDA 3DCUA 4MDDA 1YY4A 3DZUD 1PDUA 4TUZA 1XVPB 2QH6A 1XDKA 3OZJA 3FS1A 1FBYA 3RUUA 4WQPA 2G0HA 2PINA 4Q13A 4ZN7A 2AWHA 2Z4JA 1I38A 4LTWA 4OK1A 3MNEA 5DRJA 4WLBA 1Q4XA 3HC6A 3ET3A 2FSZA 5E7VA 2H77A 2AAXA 4DK7A 2JJ3A 1DB1A 1RKGA 2Z4BA 2YJAB 1M13A 2GWXA 4DK8A 4HLWA 3W5TA 2G44A 5A86A 3CS8A 2GTKA 4S14A 3OMPA 4RMEA 2ZK3A 4J5XA 4OGHA 3NSQA 2GIUA 3HO0A 4TV1B 4PP5A 4N5GA 4ZJWA 1P93A 3VT9A 2AYRA 2FVJA 3L0EA 2PITA 5EI1A 1I37A 1KKQA 5EC9A 3W0AA 1TFCA 4IA3A 3ET1A 2ZNQA 2QPYA 4P6XA 4X1GA 5C4OA 1XP1A 2HB8A 2P7GA 2V0VA 4FN9A 1NDEA 4OFRA 4OJ9A 5JI0D 2Q6JA 4E2JA 1X76A 3X36A 4OJ4A 4PWLA 3GZ9A 4R06A 1MVCA 4S0SA 5DX3B 5DZIA 2ZNPA 4NB6A 2LBDA 5HJPB 4NY9A 4PXMA 4REEA 2Q5PA 2PIOA 2F4BA 1T74A 1YMTA 2HB7A 5EHJA 2GPUA 2PIVA 3B5RA 3GD2A 4MG7B 3KBAA 4RZEA 2HCDA 3DY6A 4PLEA 5AVIA 5KYAA 3V9VA 4DOSA 3G0WA 5I4VA 5AAVA 3TY0A 2GPOA 4J26A 4OC7A 2Q7JA 3VI8A 4PRGA 2QA6A 4MG5A 5L7EA 1ZAFA 4QL8A 3F7DA 4XUHA 3DZYD 1KNUA 2PIQA 3A78A 3JZBA 3OZ0A 3IPSA 2Q3YA 3PLZA 4RZGA 5JY3A 5DXMA 5FQPA 3UUAA 2O9IA 4PVUA 4TUZB 1T79A 1S19A 1ZH7A 4N73A 1ZKYA 2ZMHA 3SP9A 1YOKA 4J5XC 3X1IA 3B67A 2G0GA 2Q6RA 2Q7LA 3B0RA 4G1YA 1R20A 5DUHA 2QXMA 5DZ1A 2I0GA 3P88A 1DKFB 4XAOA 3H52A 2AA6A 3VJIA 5G43A 2I4ZA 3H0AD 1M7WA 4EMAA 5E19A 5AYGA 5HYKA 4LSJA 4ZNVA 4BCRA 2AX7A 3PBAA 5SYZA 1OT7A 4PP3A 5HJSA 3EYBA 1XVPA 1SR7A 5DXRA 2PRGA 1NQ1A 5H1EA 3D24A 4QM0A 3D90A 3D5FA 2ZFXA 4MGAB 5DKSA 1ZDTA 5DY8A 2O4RA 2ZK0A 4ZJRA 4XHDA 4IA7A 3WJ4A 3W0HA 2P1VA 2P54A 3KMGA 3OS8C 2OCFA 3OAPA 3R5MA 5L7HA 3AN3A 5DWEA 1YINA 3VJSA 5E0XA 1S0ZA 1ZDUA 2Q5SA 4IUIA 3V3EA 5DU5A 5KROA 4OH5A 5KRMA 3D6DA 2NW4A 2ZMJA 4KZJA 4RMDA 4TV1A 5B41A 1BSXA 1T7MA 3PCUA 4FGYA 4ZO1X 1QKNA 2H79A 2AMAA 3ZRAA 4PF3A 1PK5A 5APJA 1NAXA 2I4PA 4KZIA 3X1HA 2ZL9A 1XNNA 4MG9A 3ADWA 3VHVA 3CLDA 4XUMA 2ABIA 2VSRA 2YLPA 4ZNUA 1QKUA 2I0JA 1N4HA 2QR9A 2REWA 2V7CA 4O8FA 4A4VA 3X31A 1OSHA 4UDAA 4OARA 3GYTA 1XZXX 3A2HA 4IU7A 4REFA 3A9EB 1PZLA 1YUCA 3IMYA 5DXBB 5G3JA 3OLFA 3VTBA 2POGA 3V9TA 3WT5A 2JFAA 2ZNNA 5KCFA 5ACCA 3ADUA 1X78A 2YHDA 3OLLA 4CI5A 2IOKA 1UOMA 4MG7A 4A2JA 2J7YA 5F9BA 2OM9A 3T03A 2AO6A 5DKEA 3OOFA 4ZO1B 5AZTA 3DCTA 2G5OA 1ZEOA 3AZ1A 3WGPA 4IVYA 3RVFA 5KR9A 4ITEA 1XV9B 4K4JA 1M2ZA 2AA2A 3A2IA 2ZLAA 5LGAA 2ACLB 1YP0A 4ZN9A 3FUGA 1K74A 4ZI1A 2I4JA 5EGVA 4EM9A 4XT9A 1XJ7A 3WJ5A 2J7XA 4XI3A 3E00A 1SQNA 4POHA 3GWXA 1NHZA 5DUGA 3A3ZX 5GT4A 1RJKA 1DKFA 4FNEA 1ZGYA 4ZNTA 4XLDA 5DWIA 3BC5A 5FQRA 3R8IA 2BAWA 3IXPA 2VV3A 5DVVA 2YLQA 4MG8B 4KZMA 4IVWA 2PNUA 5DZ3A 5IAWA 3VRTA 4UDDA 2XKWA 1IE8A 3B65A 3TKMA 3VSOA 4JYHA 5KRCA 1A52A 1Z95A 1P8DA 3K22A 1L2IA 4MGAA 2P4YA 3V4AA 1EXAA 3HVLA 1FM6D 1OVLB 2ZASA 2YATA 5DSHA 3B1MA 3OMQA 4M8EA 2ZK1A 4ONIA 2R40D 5DL4A 2BJ4A 2VSTA 5FQVA 4MG9B 3AN4A 5ICKA 3TX7B 3HODA 3G8IA 3AX8A 1NYXA 5AVLA 3VSPA 2IHQA 2AX6A 5DMFA 2NXXA 5DVSA 4RUPA 2OZ7A 3D57A 2ZXNA 3DT3A 4F9MA 5JJMB 3UUDB 5DVCA 2ZY0A 4YNKA 5DKBA 5DRMA 3NSPA 2A3IA 2JFAB 3B0TA 5GIEA 1RDTA 3OS8A 1VJBA 3WFFA 2ZVTA 2Q7IA 5GIDA 3AUQA 4XTAA 1SJ0A 1UHLA 3VT8A 3B0WA 4APUA 5KCEA 1ILHA 3CJWA 1U9EA 3NOAA 5DXKA 4G21A 1FM9D 2P7AA 3A9EA 3OMOA 4IW8A 1NQ7A 1IE9A 2NV7A 1T7RA 5DXBA 2HWRA 4M8HA 3G8OA 3VTDA 1N46A 2Q1VA 4MG6A 2PIPL 4S0TA 1XQCA 5IXKA 1YYEA 4A4WA 3L1BA 3P89A 1Y9RA 3RLLA 1G2NA 3VN2A 5CJ6A 1U3QA 5KCDA 2ATHA 4ZOMA 5ETHA 1GS4A 2XYJA 5DI7A 5E1CA 1NAVA 2AXAA 1G5YA 2O4JA 3HC5A 2QW4A 4OJBA 1XV9A 3OMKA 4OZTU 3ZR7A 5G44A 5HZCA 2ACLA 5DXGA 2AX9A 3CTBA 1R1KA 1NQ2A 3VHWA 3HZFA 3E94A 4MGCA 4OEZA 1XLSE 4ZNSA 1X7RA 4OLMA 4WPFA 4DORA 2GPVA 1H9UA 2NPAA 5LWPA 3IPQA 1T65A 2W8YA 3O1DA 4R6SA 5DK9A 5G42A 2ZBSA 3ADTA 3FLIA 1UPWA 5AZVA 2BJ4B 3OLSA 5G46A 4OIVA 3DZUA 2ZLCA 1YA3A 4JYIA 2P1UA 4MG8A 5KRKA 2E2RA 3IPUA 4X1FA 5KCCA 4Y29A 3ZQTA 1U3RA 3FURA 4RUJA 5DXPA 1PQCA 1T73A 4K7AA 4MGDB 4DMAA 1OVLA 1GWQA 5APHA 3ZRBA 3B66A 4OFUA 3UUCA 1FD0A 3CQVA 5DIEA 4DM8A 1TXIA 5B5BA 3OSWA 2B23A 3WT6A 2VV1B 5HYRA 3RY9A 2QXSA 1HJ1A 1UHLB 3AURA 3UP3A 3WMHA 1EXXA 5G5WA 3RUTA 1FCZA 3KYTA 1E3KA 4JYGA 4PLDA 1XIUA 1XP6A 5JJMA 3K23A 3UUDA 3V3QA 2AX8A 3VJHA 5AK2A 4OEYA 3ET0A 5DTVA 3W5RA 3Q95B 5DIGA 2Q7KA 3GWSX 5GICA 2QGWA 4QE6A 4ZNHA 1G50A 1OSVA 2YJDA 3ADSA 4IW6A 3FEJA 5DYBA 4QK4A 2PIRA 1XB7A 1R5KA 4ZNWA 4OZTE 1I7IA 2FAIA 4OKWA 2HVCA 2XYWA 3W5PA 3M7RA 3P0UA 1XNXA 3FC6B 3OKIA 3BEJA 3VHUA 4LNWA 4P6WA 5DLRA 2AM9A 1R20D 5DV8A 5DUEA 3CDSA 4OIUA 2HARA 4J5WC 4IWCA 4RE8A
chains in the Genus database with same CATH topology
1PCGA 2VV0A 3VJTA 3ADVA 1T5ZA 2Q61A 1PRGA 4E4KA 3R8DA 3DZYA 4UDCA 2ZK4A 4OKBA 4RUOX 5DIDA 1Z5XU 3F5CA 3ET2A 5DWLA 2R6YA 3VTCA 2Q8SA 1LBDA 4E4QA 3K6PA 5G45A 2GP7A 5EJVA 2Q70A 3LBDA 4IWFA 1XAPA 2HASA 3TKCA 4NQAB 3W5QA 4JAZA 3VT5A 4DM6A 3R5NA 5KRIA 3A2JA 3CDPA 3UVVB 3ADXA 3R2AA 2J4AA 1LV2A 3O1EA 1YIMA 2ZK5A 3H0AA 2GL8A 2PJLA 3PO9A 1K7LA 4OEAA 3G9EA 3S9SA 3R29A 3FALB 2OVHA 2P7ZA 4S15A 4OH6A 2OUZA 2Q59B 1RKHA 3VT3A 3BQDA 1EREA 3U9QA 4IA2A 5DXEA 5KRFA 4G1DA 1K4WA 3GN8A 2ZNOA 2JF9A 1XOWA 2QA8A 2PIWA 5AWJA 4B7WA 5KD9A 3VT4A 4G1ZA 4IS8A 1FCYA 3HLVA 5APKA 4MGDA 2AA5A 2AMBA 3W0GA 2QZOB 3V49A 3VRWA 1XQ3A 5DWJA 4PP6A 1YOWA 5KCUA 4G20A 3FXVA 2PKLA 1ZUCA 3W0YA 2POBA 2VV1A 4G2IA 4JL4A 3DR1A 3LMPA 5DV3A 4PPSA 3AZ2A 3ERTA 3VRVA 4FHHA 1GWRA 2Q6SA 4IV2A 3OMMA 5KCTA 1T7FA 4OEDA 4MGBB 4WHFA 2XYXA 1R6GA 1E3GA 1S0XA 3L03A 3AFRA 2OAXA 3Q95A 5C4SA 4POJA 2Q5GA 4YMQA 3IA6A 3UU7A 3VRUA 2HC4A 2IOGA 2Q60A 5DKGA 4LNXA 1Z5XE 3HQ5A 1FCXA 4YT1A 1A28A 5E14A 2VV4B 2P1TA 2YFEA 3WT7A 2ZXMA 1K74D 3HM1A 4JGVA 3F5CB 4NIEA 3FC6A 2XHSA 3AUNA 2QNVA 3E00D 4RAKA 3R8AA 1X7JA 3VT6A 1PQ6A 3JZCA 1KV6A 2QGTA 3OSAA 1SKXA 4DQMA 3UP0A 1MV9A 4QJRA 3B0QA 1NUOA 3IXPD 2J14A 2R6WA 5DWGA 5AWKA 1X7EA 1XDKB 1HG4A 5DZ0A 4IV4A 5DV6A 2HWQA 1NQ0A 4UDBA 1N83A 5DMCA 2QE4A 2ZK6A 5DP0A 3OGTA 1QKMA 3L3XA 4QE8A 5L11A 4OKXA 5C4UA 3CS4A 2QSEA 5E0WA 4OZRU 3B3KA 3OOKA 2VV2A 2QA8B 4J5WA 2QTUA 3SP6A 1MZNA 1GWXA 4G2HA 1S9QA 5DXQA 4OHAA 3UVVA 1L2JA 2B50A 5EITA 4IQRA 5KCWA 5KRLA 1G1UA 2EWPA 3FALA 4L98A 2QMVA 4RMCA 5KRJA 2Q59A 4J24A 3GYUA 3KDTA 3A40X 3P8XA 3GBKA 5KYJA 1ERRA 2ZMIA 4N1YA 5KRHA 3AZ3A 3W0IA 1RDTD 4IA1A 4PPPA 2AA7A 1Y0SA 1FM6A 4R2UA 5HCVA 4ITFA 1QKTA 2R40A 5KRAA 3KWYA 1T63A 5DYDA 4RZFA 2QZOA 3OKHA 1X7BA 2B1ZA 5L7GA 1RK3A 4CSJA 2PIXA 3UU7B 2ZXZA 3MNPA 2ZK2A 3OS9A 2HFPA 3VT7A 4Q50A 3MNOA 3W0JA 3WWRA 4CI4A 3KMZA 3KDUA 3ILZA 4NUFA 1U3SA 3PEQA 2YLYA 3QT0A 5E15A 5IZ0A 2HBHA 3B68A 1ILGA 5FQTA 3V9YA 4OILA 1T7TA 4LBDA 5AAUA 4MGBA 2OVMA 4WVDA 5AAVB 2Q1HA 3FEIA 4RWVA 4N8RA 1XP9A 1Y0XX 5C4TA 1WM0X 1XLSA 2YLOA 1XPCA 3N00A 3L0JA 3L0LA 2ZKCA 3L3ZA 3SZ1A 2NXXE 5FQSA 1NRLA 3W0CA 3WTQA 5DX3A 3RLJA 4YPQA 3UUAB 1I7GA 3KPZA 1UPVA 4OKTA 1T76A 5HJPA 4RFWA 3CS6A 2VV4A 3K8SA 1PQ9A 1FM9A 2B1VA 2QABA 3E7CA 1R1KD 3KMRA 4HEEX 3OSIA 5K13A 5M96A 1S9PA 2HAMA 3PRGA 4OZRE 4Q0AC 1YJEA 2AB2A 4WHGA 5DZHA 3WFGA 4K6IA 2PIUA 4FHIA 2P15A 2GPPA 4L96A 3KFCA 3ERDA 3CWDA 3DCUA 4MDDA 1YY4A 3DZUD 1PDUA 4TUZA 1XVPB 2QH6A 1XDKA 3OZJA 3FS1A 1FBYA 3RUUA 4WQPA 2G0HA 2PINA 4Q13A 4ZN7A 2AWHA 2Z4JA 1I38A 4LTWA 4OK1A 3MNEA 5DRJA 4WLBA 1Q4XA 3HC6A 3ET3A 2FSZA 5E7VA 2H77A 2AAXA 4DK7A 2JJ3A 1DB1A 1RKGA 2Z4BA 2YJAB 1M13A 2GWXA 4DK8A 4HLWA 3W5TA 2G44A 5A86A 3CS8A 2GTKA 4S14A 3OMPA 4RMEA 2ZK3A 4J5XA 4OGHA 3NSQA 2GIUA 3HO0A 4TV1B 4PP5A 4N5GA 4ZJWA 1P93A 3VT9A 2AYRA 2FVJA 3L0EA 2PITA 5EI1A 1I37A 1KKQA 5EC9A 3W0AA 1TFCA 4IA3A 3ET1A 2ZNQA 2QPYA 4P6XA 4X1GA 5C4OA 1XP1A 2HB8A 2P7GA 2V0VA 4FN9A 1NDEA 4OFRA 4OJ9A 5JI0D 2Q6JA 4E2JA 1X76A 3X36A 4OJ4A 4PWLA 3GZ9A 4R06A 1MVCA 4S0SA 5DX3B 5DZIA 2ZNPA 4NB6A 2LBDA 5HJPB 4NY9A 4PXMA 4REEA 2Q5PA 2PIOA 2F4BA 1T74A 1YMTA 2HB7A 5EHJA 2GPUA 2PIVA 3B5RA 3GD2A 4MG7B 3KBAA 4RZEA 2HCDA 3DY6A 4PLEA 5AVIA 5KYAA 3V9VA 4DOSA 3G0WA 5I4VA 5AAVA 3TY0A 2GPOA 4J26A 4OC7A 2Q7JA 3VI8A 4PRGA 2QA6A 4MG5A 5L7EA 1ZAFA 4QL8A 3F7DA 4XUHA 3DZYD 1KNUA 2PIQA 3A78A 3JZBA 3OZ0A 3IPSA 2Q3YA 3PLZA 4RZGA 5JY3A 5DXMA 5FQPA 3UUAA 2O9IA 4PVUA 4TUZB 1T79A 1S19A 1ZH7A 4N73A 1ZKYA 2ZMHA 3SP9A 1YOKA 4J5XC 3X1IA 3B67A 2G0GA 2Q6RA 2Q7LA 3B0RA 4G1YA 1R20A 5DUHA 2QXMA 5DZ1A 2I0GA 3P88A 1DKFB 4XAOA 3H52A 2AA6A 3VJIA 5G43A 2I4ZA 3H0AD 1M7WA 4EMAA 5E19A 5AYGA 5HYKA 4LSJA 4ZNVA 4BCRA 2AX7A 3PBAA 5SYZA 1OT7A 4PP3A 5HJSA 3EYBA 1XVPA 1SR7A 5DXRA 2PRGA 1NQ1A 5H1EA 3D24A 4QM0A 3D90A 3D5FA 2ZFXA 4MGAB 5DKSA 1ZDTA 5DY8A 2O4RA 2ZK0A 4ZJRA 4XHDA 4IA7A 3WJ4A 3W0HA 2P1VA 2P54A 3KMGA 3OS8C 2OCFA 3OAPA 3R5MA 5L7HA 3AN3A 5DWEA 1YINA 3VJSA 5E0XA 1S0ZA 1ZDUA 2Q5SA 4IUIA 3V3EA 5DU5A 5KROA 4OH5A 5KRMA 3D6DA 2NW4A 2ZMJA 4KZJA 4RMDA 4TV1A 5B41A 1BSXA 1T7MA 3PCUA 4FGYA 4ZO1X 1QKNA 2H79A 2AMAA 3ZRAA 4PF3A 1PK5A 5APJA 1NAXA 2I4PA 4KZIA 3X1HA 2ZL9A 1XNNA 4MG9A 3ADWA 3VHVA 3CLDA 4XUMA 2ABIA 2VSRA 2YLPA 4ZNUA 1QKUA 2I0JA 1N4HA 2QR9A 2REWA 2V7CA 4O8FA 4A4VA 3X31A 1OSHA 4UDAA 4OARA 3GYTA 1XZXX 3A2HA 4IU7A 4REFA 3A9EB 1PZLA 1YUCA 3IMYA 5DXBB 5G3JA 3OLFA 3VTBA 2POGA 3V9TA 3WT5A 2JFAA 2ZNNA 5KCFA 5ACCA 3ADUA 1X78A 2YHDA 3OLLA 4CI5A 2IOKA 1UOMA 4MG7A 4A2JA 2J7YA 5F9BA 2OM9A 3T03A 2AO6A 5DKEA 3OOFA 4ZO1B 5AZTA 3DCTA 2G5OA 1ZEOA 3AZ1A 3WGPA 4IVYA 3RVFA 5KR9A 4ITEA 1XV9B 4K4JA 1M2ZA 2AA2A 3A2IA 2ZLAA 5LGAA 2ACLB 1YP0A 4ZN9A 3FUGA 1K74A 4ZI1A 2I4JA 5EGVA 4EM9A 4XT9A 1XJ7A 3WJ5A 2J7XA 4XI3A 3E00A 1SQNA 4POHA 3GWXA 1NHZA 5DUGA 3A3ZX 5GT4A 1RJKA 1DKFA 4FNEA 1ZGYA 4ZNTA 4XLDA 5DWIA 3BC5A 5FQRA 3R8IA 2BAWA 3IXPA 2VV3A 5DVVA 2YLQA 4MG8B 4KZMA 4IVWA 2PNUA 5DZ3A 5IAWA 3VRTA 4UDDA 2XKWA 1IE8A 3B65A 3TKMA 3VSOA 4JYHA 5KRCA 1A52A 1Z95A 1P8DA 3K22A 1L2IA 4MGAA 2P4YA 3V4AA 1EXAA 3HVLA 1FM6D 1OVLB 2ZASA 2YATA 5DSHA 3B1MA 3OMQA 4M8EA 2ZK1A 4ONIA 2R40D 5DL4A 2BJ4A 2VSTA 5FQVA 4MG9B 3AN4A 5ICKA 3TX7B 3HODA 3G8IA 3AX8A 1NYXA 5AVLA 3VSPA 2IHQA 2AX6A 5DMFA 2NXXA 5DVSA 4RUPA 2OZ7A 3D57A 2ZXNA 3DT3A 4F9MA 5JJMB 3UUDB 5DVCA 2ZY0A 4YNKA 5DKBA 5DRMA 3NSPA 2A3IA 2JFAB 3B0TA 5GIEA 1RDTA 3OS8A 1VJBA 3WFFA 2ZVTA 2Q7IA 5GIDA 3AUQA 4XTAA 1SJ0A 1UHLA 3VT8A 3B0WA 4APUA 5KCEA 1ILHA 3CJWA 1U9EA 3NOAA 5DXKA 4G21A 1FM9D 2P7AA 3A9EA 3OMOA 4IW8A 1NQ7A 1IE9A 2NV7A 1T7RA 5DXBA 2HWRA 4M8HA 3G8OA 3VTDA 1N46A 2Q1VA 4MG6A 2PIPL 4S0TA 1XQCA 5IXKA 1YYEA 4A4WA 3L1BA 3P89A 1Y9RA 3RLLA 1G2NA 3VN2A 5CJ6A 1U3QA 5KCDA 2ATHA 4ZOMA 5ETHA 1GS4A 2XYJA 5DI7A 5E1CA 1NAVA 2AXAA 1G5YA 2O4JA 3HC5A 2QW4A 4OJBA 1XV9A 3OMKA 4OZTU 3ZR7A 5G44A 5HZCA 2ACLA 5DXGA 2AX9A 3CTBA 1R1KA 1NQ2A 3VHWA 3HZFA 3E94A 4MGCA 4OEZA 1XLSE 4ZNSA 1X7RA 4OLMA 4WPFA 4DORA 2GPVA 1H9UA 2NPAA 5LWPA 3IPQA 1T65A 2W8YA 3O1DA 4R6SA 5DK9A 5G42A 2ZBSA 3ADTA 3FLIA 1UPWA 5AZVA 2BJ4B 3OLSA 5G46A 4OIVA 3DZUA 2ZLCA 1YA3A 4JYIA 2P1UA 4MG8A 5KRKA 2E2RA 3IPUA 4X1FA 5KCCA 4Y29A 3ZQTA 1U3RA 3FURA 4RUJA 5DXPA 1PQCA 1T73A 4K7AA 4MGDB 4DMAA 1OVLA 1GWQA 5APHA 3ZRBA 3B66A 4OFUA 3UUCA 1FD0A 3CQVA 5DIEA 4DM8A 1TXIA 5B5BA 3OSWA 2B23A 3WT6A 2VV1B 5HYRA 3RY9A 2QXSA 1HJ1A 1UHLB 3AURA 3UP3A 3WMHA 1EXXA 5G5WA 3RUTA 1FCZA 3KYTA 1E3KA 4JYGA 4PLDA 1XIUA 1XP6A 5JJMA 3K23A 3UUDA 3V3QA 2AX8A 3VJHA 5AK2A 4OEYA 3ET0A 5DTVA 3W5RA 3Q95B 5DIGA 2Q7KA 3GWSX 5GICA 2QGWA 4QE6A 4ZNHA 1G50A 1OSVA 2YJDA 3ADSA 4IW6A 3FEJA 5DYBA 4QK4A 2PIRA 1XB7A 1R5KA 4ZNWA 4OZTE 1I7IA 2FAIA 4OKWA 2HVCA 2XYWA 3W5PA 3M7RA 3P0UA 1XNXA 3FC6B 3OKIA 3BEJA 3VHUA 4LNWA 4P6WA 5DLRA 2AM9A 1R20D 5DV8A 5DUEA 3CDSA 4OIUA 2HARA 4J5WC 4IWCA 4RE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PCG A;  2VV0 A;  3VJT A;  3ADV A;  1T5Z A;  2Q61 A;  1PRG A;  4E4K A;  3R8D A;  3DZY A;  4UDC A;  2ZK4 A;  4OKB A;  4RUO X;  5DID A;  1Z5X U;  3F5C A;  3ET2 A;  5DWL A;  2R6Y A;  3VTC A;  2Q8S A;  1LBD A;  4E4Q A;  3K6P A;  5G45 A;  2GP7 A;  5EJV A;  2Q70 A;  3LBD A;  4IWF A;  1XAP A;  2HAS A;  3TKC A;  4NQA B;  3W5Q A;  4JAZ A;  3VT5 A;  4DM6 A;  3R5N A;  5KRI A;  3A2J A;  3CDP A;  3UVV B;  3ADX A;  3R2A A;  2J4A A;  1LV2 A;  3O1E A;  1YIM A;  2ZK5 A;  3H0A A;  2GL8 A;  2PJL A;  3PO9 A;  1K7L A;  4OEA A;  3G9E A;  3S9S A;  3R29 A;  3FAL B;  2OVH A;  2P7Z A;  4S15 A;  4OH6 A;  2OUZ A;  2Q59 B;  1RKH A;  3VT3 A;  3BQD A;  1ERE A;  3U9Q A;  4IA2 A;  5DXE A;  5KRF A;  4G1D A;  1K4W A;  3GN8 A;  2ZNO A;  2JF9 A;  1XOW A;  2QA8 A;  2PIW A;  5AWJ A;  4B7W A;  5KD9 A;  3VT4 A;  4G1Z A;  4IS8 A;  1FCY A;  3HLV A;  5APK A;  4MGD A;  2AA5 A;  2AMB A;  3W0G A;  2QZO B;  3V49 A;  3VRW A;  1XQ3 A;  5DWJ A;  4PP6 A;  1YOW A;  5KCU A;  4G20 A;  3FXV A;  2PKL A;  1ZUC A;  3W0Y A;  2POB A;  2VV1 A;  4G2I A;  4JL4 A;  3DR1 A;  3LMP A;  5DV3 A;  4PPS A;  3AZ2 A;  3ERT A;  3VRV A;  4FHH A;  1GWR A;  2Q6S A;  4IV2 A;  3OMM A;  5KCT A;  1T7F A;  4OED A;  4MGB B;  4WHF A;  2XYX A;  1R6G A;  1E3G A;  1S0X A;  3L03 A;  3AFR A;  2OAX A;  3Q95 A;  5C4S A;  4POJ A;  2Q5G A;  4YMQ A;  3IA6 A;  3UU7 A;  3VRU A;  2HC4 A;  2IOG A;  2Q60 A;  5DKG A;  4LNX A;  1Z5X E;  3HQ5 A;  1FCX A;  4YT1 A;  1A28 A;  5E14 A;  2VV4 B;  2P1T A;  2YFE A;  3WT7 A;  2ZXM A;  1K74 D;  3HM1 A;  4JGV A;  3F5C B;  4NIE A;  3FC6 A;  2XHS A;  3AUN A;  2QNV A;  3E00 D;  4RAK A;  3R8A A;  1X7J A;  3VT6 A;  1PQ6 A;  3JZC A;  1KV6 A;  2QGT A;  3OSA A;  1SKX A;  4DQM A;  3UP0 A;  1MV9 A;  4QJR A;  3B0Q A;  1NUO A;  3IXP D;  2J14 A;  2R6W A;  5DWG A;  5AWK A;  1X7E A;  1XDK B;  1HG4 A;  5DZ0 A;  4IV4 A;  5DV6 A;  2HWQ A;  1NQ0 A;  4UDB A;  1N83 A;  5DMC A;  2QE4 A;  2ZK6 A;  5DP0 A;  3OGT A;  1QKM A;  3L3X A;  4QE8 A;  5L11 A;  4OKX A;  5C4U A;  3CS4 A;  2QSE A;  5E0W A;  4OZR U;  3B3K A;  3OOK A;  2VV2 A;  2QA8 B;  4J5W A;  2QTU A;  3SP6 A;  1MZN A;  1GWX A;  4G2H A;  1S9Q A;  5DXQ A;  4OHA A;  3UVV A;  1L2J A;  2B50 A;  5EIT A;  4IQR A;  5KCW A;  5KRL A;  1G1U A;  2EWP A;  3FAL A;  4L98 A;  2QMV A;  4RMC A;  5KRJ A;  2Q59 A;  4J24 A;  3GYU A;  3KDT A;  3A40 X;  3P8X A;  3GBK A;  5KYJ A;  1ERR A;  2ZMI A;  4N1Y A;  5KRH A;  3AZ3 A;  3W0I A;  1RDT D;  4IA1 A;  4PPP A;  2AA7 A;  1Y0S A;  1FM6 A;  4R2U A;  5HCV A;  4ITF A;  1QKT A;  2R40 A;  5KRA A;  3KWY A;  1T63 A;  5DYD A;  4RZF A;  2QZO A;  3OKH A;  1X7B A;  2B1Z A;  5L7G A;  1RK3 A;  4CSJ A;  2PIX A;  3UU7 B;  2ZXZ A;  3MNP A;  2ZK2 A;  3OS9 A;  2HFP A;  3VT7 A;  4Q50 A;  3MNO A;  3W0J A;  3WWR A;  4CI4 A;  3KMZ A;  3KDU A;  3ILZ A;  4NUF A;  1U3S A;  3PEQ A;  2YLY A;  3QT0 A;  5E15 A;  5IZ0 A;  2HBH A;  3B68 A;  1ILG A;  5FQT A;  3V9Y A;  4OIL A;  1T7T A;  4LBD A;  5AAU A;  4MGB A;  2OVM A;  4WVD A;  5AAV B;  2Q1H A;  3FEI A;  4RWV A;  4N8R A;  1XP9 A;  1Y0X X;  5C4T A;  1WM0 X;  1XLS A;  2YLO A;  1XPC A;  3N00 A;  3L0J A;  3L0L A;  2ZKC A;  3L3Z A;  3SZ1 A;  2NXX E;  5FQS A;  1NRL A;  3W0C A;  3WTQ A;  5DX3 A;  3RLJ A;  4YPQ A;  3UUA B;  1I7G A;  3KPZ A;  1UPV A;  4OKT A;  1T76 A;  5HJP A;  4RFW A;  3CS6 A;  2VV4 A;  3K8S A;  1PQ9 A;  1FM9 A;  2B1V A;  2QAB A;  3E7C A;  1R1K D;  3KMR A;  4HEE X;  3OSI A;  5K13 A;  5M96 A;  1S9P A;  2HAM A;  3PRG A;  4OZR E;  4Q0A C;  1YJE A;  2AB2 A;  4WHG A;  5DZH A;  3WFG A;  4K6I A;  2PIU A;  4FHI A;  2P15 A;  2GPP A;  4L96 A;  3KFC A;  3ERD A;  3CWD A;  3DCU A;  4MDD A;  1YY4 A;  3DZU D;  1PDU A;  4TUZ A;  1XVP B;  2QH6 A;  1XDK A;  3OZJ A;  3FS1 A;  1FBY A;  3RUU A;  4WQP A;  2G0H A;  2PIN A;  4Q13 A;  4ZN7 A;  2AWH A;  2Z4J A;  1I38 A;  4LTW A;  4OK1 A;  3MNE A;  5DRJ A;  4WLB A;  1Q4X A;  3HC6 A;  3ET3 A;  2FSZ A;  5E7V A;  2H77 A;  2AAX A;  4DK7 A;  2JJ3 A;  1DB1 A;  1RKG A;  2Z4B A;  2YJA B;  1M13 A;  2GWX A;  4DK8 A;  4HLW A;  3W5T A;  2G44 A;  5A86 A;  3CS8 A;  2GTK A;  4S14 A;  3OMP A;  4RME A;  2ZK3 A;  4J5X A;  4OGH A;  3NSQ A;  2GIU A;  3HO0 A;  4TV1 B;  4PP5 A;  4N5G A;  4ZJW A;  1P93 A;  3VT9 A;  2AYR A;  2FVJ A;  3L0E A;  2PIT A;  5EI1 A;  1I37 A;  1KKQ A;  5EC9 A;  3W0A A;  1TFC A;  4IA3 A;  3ET1 A;  2ZNQ A;  2QPY A;  4P6X A;  4X1G A;  5C4O A;  1XP1 A;  2HB8 A;  2P7G A;  2V0V A;  4FN9 A;  1NDE A;  4OFR A;  4OJ9 A;  5JI0 D;  2Q6J A;  4E2J A;  1X76 A;  3X36 A;  4OJ4 A;  4PWL A;  3GZ9 A;  4R06 A;  1MVC A;  4S0S A;  5DX3 B;  5DZI A;  2ZNP A;  4NB6 A;  2LBD A;  5HJP B;  4NY9 A;  4PXM A;  4REE A;  2Q5P A;  2PIO A;  2F4B A;  1T74 A;  1YMT A;  2HB7 A;  5EHJ A;  2GPU A;  2PIV A;  3B5R A;  3GD2 A;  4MG7 B;  3KBA A;  4RZE A;  2HCD A;  3DY6 A;  4PLE A;  5AVI A;  5KYA A;  3V9V A;  4DOS A;  3G0W A;  5I4V A;  5AAV A;  3TY0 A;  2GPO A;  4J26 A;  4OC7 A;  2Q7J A;  3VI8 A;  4PRG A;  2QA6 A;  4MG5 A;  5L7E A;  1ZAF A;  4QL8 A;  3F7D A;  4XUH A;  3DZY D;  1KNU A;  2PIQ A;  3A78 A;  3JZB A;  3OZ0 A;  3IPS A;  2Q3Y A;  3PLZ A;  4RZG A;  5JY3 A;  5DXM A;  5FQP A;  3UUA A;  2O9I A;  4PVU A;  4TUZ B;  1T79 A;  1S19 A;  1ZH7 A;  4N73 A;  1ZKY A;  2ZMH A;  3SP9 A;  1YOK A;  4J5X C;  3X1I A;  3B67 A;  2G0G A;  2Q6R A;  2Q7L A;  3B0R A;  4G1Y A;  1R20 A;  5DUH A;  2QXM A;  5DZ1 A;  2I0G A;  3P88 A;  1DKF B;  4XAO A;  3H52 A;  2AA6 A;  3VJI A;  5G43 A;  2I4Z A;  3H0A D;  1M7W A;  4EMA A;  5E19 A;  5AYG A;  5HYK A;  4LSJ A;  4ZNV A;  4BCR A;  2AX7 A;  3PBA A;  5SYZ A;  1OT7 A;  4PP3 A;  5HJS A;  3EYB A;  1XVP A;  1SR7 A;  5DXR A;  2PRG A;  1NQ1 A;  5H1E A;  3D24 A;  4QM0 A;  3D90 A;  3D5F A;  2ZFX A;  4MGA B;  5DKS A;  1ZDT A;  5DY8 A;  2O4R A;  2ZK0 A;  4ZJR A;  4XHD A;  4IA7 A;  3WJ4 A;  3W0H A;  2P1V A;  2P54 A;  3KMG A;  3OS8 C;  2OCF A;  3OAP A;  3R5M A;  5L7H A;  3AN3 A;  5DWE A;  1YIN A;  3VJS A;  5E0X A;  1S0Z A;  1ZDU A;  2Q5S A;  4IUI A;  3V3E A;  5DU5 A;  5KRO A;  4OH5 A;  5KRM A;  3D6D A;  2NW4 A;  2ZMJ A;  4KZJ A;  4RMD A;  4TV1 A;  5B41 A;  1BSX A;  1T7M A;  3PCU A;  4FGY A;  4ZO1 X;  1QKN A;  2H79 A;  2AMA A;  3ZRA A;  4PF3 A;  1PK5 A;  5APJ A;  1NAX A;  2I4P A;  4KZI A;  3X1H A;  2ZL9 A;  1XNN A;  4MG9 A;  3ADW A;  3VHV A;  3CLD A;  4XUM A;  2ABI A;  2VSR A;  2YLP A;  4ZNU A;  1QKU A;  2I0J A;  1N4H A;  2QR9 A;  2REW A;  2V7C A;  4O8F A;  4A4V A;  3X31 A;  1OSH A;  4UDA A;  4OAR A;  3GYT A;  1XZX X;  3A2H A;  4IU7 A;  4REF A;  3A9E B;  1PZL A;  1YUC A;  3IMY A;  5DXB B;  5G3J A;  3OLF A;  3VTB A;  2POG A;  3V9T A;  3WT5 A;  2JFA A;  2ZNN A;  5KCF A;  5ACC A;  3ADU A;  1X78 A;  2YHD A;  3OLL A;  4CI5 A;  2IOK A;  1UOM A;  4MG7 A;  4A2J A;  2J7Y A;  5F9B A;  2OM9 A;  3T03 A;  2AO6 A;  5DKE A;  3OOF A;  4ZO1 B;  5AZT A;  3DCT A;  2G5O A;  1ZEO A;  3AZ1 A;  3WGP A;  4IVY A;  3RVF A;  5KR9 A;  4ITE A;  1XV9 B;  4K4J A;  1M2Z A;  2AA2 A;  3A2I A;  2ZLA A;  5LGA A;  2ACL B;  1YP0 A;  4ZN9 A;  3FUG A;  1K74 A;  4ZI1 A;  2I4J A;  5EGV A;  4EM9 A;  4XT9 A;  1XJ7 A;  3WJ5 A;  2J7X A;  4XI3 A;  3E00 A;  1SQN A;  4POH A;  3GWX A;  1NHZ A;  5DUG A;  3A3Z X;  5GT4 A;  1RJK A;  1DKF A;  4FNE A;  1ZGY A;  4ZNT A;  4XLD A;  5DWI A;  3BC5 A;  5FQR A;  3R8I A;  2BAW A;  3IXP A;  2VV3 A;  5DVV A;  2YLQ A;  4MG8 B;  4KZM A;  4IVW A;  2PNU A;  5DZ3 A;  5IAW A;  3VRT A;  4UDD A;  2XKW A;  1IE8 A;  3B65 A;  3TKM A;  3VSO A;  4JYH A;  5KRC A;  1A52 A;  1Z95 A;  1P8D A;  3K22 A;  1L2I A;  4MGA A;  2P4Y A;  3V4A A;  1EXA A;  3HVL A;  1FM6 D;  1OVL B;  2ZAS A;  2YAT A;  5DSH A;  3B1M A;  3OMQ A;  4M8E A;  2ZK1 A;  4ONI A;  2R40 D;  5DL4 A;  2BJ4 A;  2VST A;  5FQV A;  4MG9 B;  3AN4 A;  5ICK A;  3TX7 B;  3HOD A;  3G8I A;  3AX8 A;  1NYX A;  5AVL A;  3VSP A;  2IHQ A;  2AX6 A;  5DMF A;  2NXX A;  5DVS A;  4RUP A;  2OZ7 A;  3D57 A;  2ZXN A;  3DT3 A;  4F9M A;  5JJM B;  3UUD B;  5DVC A;  2ZY0 A;  4YNK A;  5DKB A;  5DRM A;  3NSP A;  2A3I A;  2JFA B;  3B0T A;  5GIE A;  1RDT A;  3OS8 A;  1VJB A;  3WFF A;  2ZVT A;  2Q7I A;  5GID A;  3AUQ A;  4XTA A;  1SJ0 A;  1UHL A;  3VT8 A;  3B0W A;  4APU A;  5KCE A;  1ILH A;  3CJW A;  1U9E A;  3NOA A;  5DXK A;  4G21 A;  1FM9 D;  2P7A A;  3A9E A;  3OMO A;  4IW8 A;  1NQ7 A;  1IE9 A;  2NV7 A;  1T7R A;  5DXB A;  2HWR A;  4M8H A;  3G8O A;  3VTD A;  1N46 A;  2Q1V A;  4MG6 A;  2PIP L;  4S0T A;  1XQC A;  5IXK A;  1YYE A;  4A4W A;  3L1B A;  3P89 A;  1Y9R A;  3RLL A;  1G2N A;  3VN2 A;  5CJ6 A;  1U3Q A;  5KCD A;  2ATH A;  4ZOM A;  5ETH A;  1GS4 A;  2XYJ A;  5DI7 A;  5E1C A;  1NAV A;  2AXA A;  1G5Y A;  2O4J A;  3HC5 A;  2QW4 A;  4OJB A;  1XV9 A;  3OMK A;  4OZT U;  3ZR7 A;  5G44 A;  5HZC A;  2ACL A;  5DXG A;  2AX9 A;  3CTB A;  1R1K A;  1NQ2 A;  3VHW A;  3HZF A;  3E94 A;  4MGC A;  4OEZ A;  1XLS E;  4ZNS A;  1X7R A;  4OLM A;  4WPF A;  4DOR A;  2GPV A;  1H9U A;  2NPA A;  5LWP A;  3IPQ A;  1T65 A;  2W8Y A;  3O1D A;  4R6S A;  5DK9 A;  5G42 A;  2ZBS A;  3ADT A;  3FLI A;  1UPW A;  5AZV A;  2BJ4 B;  3OLS A;  5G46 A;  4OIV A;  3DZU A;  2ZLC A;  1YA3 A;  4JYI A;  2P1U A;  4MG8 A;  5KRK A;  2E2R A;  3IPU A;  4X1F A;  5KCC A;  4Y29 A;  3ZQT A;  1U3R A;  3FUR A;  4RUJ A;  5DXP A;  1PQC A;  1T73 A;  4K7A A;  4MGD B;  4DMA A;  1OVL A;  1GWQ A;  5APH A;  3ZRB A;  3B66 A;  4OFU A;  3UUC A;  1FD0 A;  3CQV A;  5DIE A;  4DM8 A;  1TXI A;  5B5B A;  3OSW A;  2B23 A;  3WT6 A;  2VV1 B;  5HYR A;  3RY9 A;  2QXS A;  1HJ1 A;  1UHL B;  3AUR A;  3UP3 A;  3WMH A;  1EXX A;  5G5W A;  3RUT A;  1FCZ A;  3KYT A;  1E3K A;  4JYG A;  4PLD A;  1XIU A;  1XP6 A;  5JJM A;  3K23 A;  3UUD A;  3V3Q A;  2AX8 A;  3VJH A;  5AK2 A;  4OEY A;  3ET0 A;  5DTV A;  3W5R A;  3Q95 B;  5DIG A;  2Q7K A;  3GWS X;  5GIC A;  2QGW A;  4QE6 A;  4ZNH A;  1G50 A;  1OSV A;  2YJD A;  3ADS A;  4IW6 A;  3FEJ A;  5DYB A;  4QK4 A;  2PIR A;  1XB7 A;  1R5K A;  4ZNW A;  4OZT E;  1I7I A;  2FAI A;  4OKW A;  2HVC A;  2XYW A;  3W5P A;  3M7R A;  3P0U A;  1XNX A;  3FC6 B;  3OKI A;  3BEJ A;  3VHU A;  4LNW A;  4P6W A;  5DLR A;  2AM9 A;  1R20 D;  5DV8 A;  5DUE A;  3CDS A;  4OIU A;  2HAR A;  4J5W C;  4IWC A;  4RE8 A; 
#chains in the Genus database with same CATH topology
 1PCG A;  2VV0 A;  3VJT A;  3ADV A;  1T5Z A;  2Q61 A;  1PRG A;  4E4K A;  3R8D A;  3DZY A;  4UDC A;  2ZK4 A;  4OKB A;  4RUO X;  5DID A;  1Z5X U;  3F5C A;  3ET2 A;  5DWL A;  2R6Y A;  3VTC A;  2Q8S A;  1LBD A;  4E4Q A;  3K6P A;  5G45 A;  2GP7 A;  5EJV A;  2Q70 A;  3LBD A;  4IWF A;  1XAP A;  2HAS A;  3TKC A;  4NQA B;  3W5Q A;  4JAZ A;  3VT5 A;  4DM6 A;  3R5N A;  5KRI A;  3A2J A;  3CDP A;  3UVV B;  3ADX A;  3R2A A;  2J4A A;  1LV2 A;  3O1E A;  1YIM A;  2ZK5 A;  3H0A A;  2GL8 A;  2PJL A;  3PO9 A;  1K7L A;  4OEA A;  3G9E A;  3S9S A;  3R29 A;  3FAL B;  2OVH A;  2P7Z A;  4S15 A;  4OH6 A;  2OUZ A;  2Q59 B;  1RKH A;  3VT3 A;  3BQD A;  1ERE A;  3U9Q A;  4IA2 A;  5DXE A;  5KRF A;  4G1D A;  1K4W A;  3GN8 A;  2ZNO A;  2JF9 A;  1XOW A;  2QA8 A;  2PIW A;  5AWJ A;  4B7W A;  5KD9 A;  3VT4 A;  4G1Z A;  4IS8 A;  1FCY A;  3HLV A;  5APK A;  4MGD A;  2AA5 A;  2AMB A;  3W0G A;  2QZO B;  3V49 A;  3VRW A;  1XQ3 A;  5DWJ A;  4PP6 A;  1YOW A;  5KCU A;  4G20 A;  3FXV A;  2PKL A;  1ZUC A;  3W0Y A;  2POB A;  2VV1 A;  4G2I A;  4JL4 A;  3DR1 A;  3LMP A;  5DV3 A;  4PPS A;  3AZ2 A;  3ERT A;  3VRV A;  4FHH A;  1GWR A;  2Q6S A;  4IV2 A;  3OMM A;  5KCT A;  1T7F A;  4OED A;  4MGB B;  4WHF A;  2XYX A;  1R6G A;  1E3G A;  1S0X A;  3L03 A;  3AFR A;  2OAX A;  3Q95 A;  5C4S A;  4POJ A;  2Q5G A;  4YMQ A;  3IA6 A;  3UU7 A;  3VRU A;  2HC4 A;  2IOG A;  2Q60 A;  5DKG A;  4LNX A;  1Z5X E;  3HQ5 A;  1FCX A;  4YT1 A;  1A28 A;  5E14 A;  2VV4 B;  2P1T A;  2YFE A;  3WT7 A;  2ZXM A;  1K74 D;  3HM1 A;  4JGV A;  3F5C B;  4NIE A;  3FC6 A;  2XHS A;  3AUN A;  2QNV A;  3E00 D;  4RAK A;  3R8A A;  1X7J A;  3VT6 A;  1PQ6 A;  3JZC A;  1KV6 A;  2QGT A;  3OSA A;  1SKX A;  4DQM A;  3UP0 A;  1MV9 A;  4QJR A;  3B0Q A;  1NUO A;  3IXP D;  2J14 A;  2R6W A;  5DWG A;  5AWK A;  1X7E A;  1XDK B;  1HG4 A;  5DZ0 A;  4IV4 A;  5DV6 A;  2HWQ A;  1NQ0 A;  4UDB A;  1N83 A;  5DMC A;  2QE4 A;  2ZK6 A;  5DP0 A;  3OGT A;  1QKM A;  3L3X A;  4QE8 A;  5L11 A;  4OKX A;  5C4U A;  3CS4 A;  2QSE A;  5E0W A;  4OZR U;  3B3K A;  3OOK A;  2VV2 A;  2QA8 B;  4J5W A;  2QTU A;  3SP6 A;  1MZN A;  1GWX A;  4G2H A;  1S9Q A;  5DXQ A;  4OHA A;  3UVV A;  1L2J A;  2B50 A;  5EIT A;  4IQR A;  5KCW A;  5KRL A;  1G1U A;  2EWP A;  3FAL A;  4L98 A;  2QMV A;  4RMC A;  5KRJ A;  2Q59 A;  4J24 A;  3GYU A;  3KDT A;  3A40 X;  3P8X A;  3GBK A;  5KYJ A;  1ERR A;  2ZMI A;  4N1Y A;  5KRH A;  3AZ3 A;  3W0I A;  1RDT D;  4IA1 A;  4PPP A;  2AA7 A;  1Y0S A;  1FM6 A;  4R2U A;  5HCV A;  4ITF A;  1QKT A;  2R40 A;  5KRA A;  3KWY A;  1T63 A;  5DYD A;  4RZF A;  2QZO A;  3OKH A;  1X7B A;  2B1Z A;  5L7G A;  1RK3 A;  4CSJ A;  2PIX A;  3UU7 B;  2ZXZ A;  3MNP A;  2ZK2 A;  3OS9 A;  2HFP A;  3VT7 A;  4Q50 A;  3MNO A;  3W0J A;  3WWR A;  4CI4 A;  3KMZ A;  3KDU A;  3ILZ A;  4NUF A;  1U3S A;  3PEQ A;  2YLY A;  3QT0 A;  5E15 A;  5IZ0 A;  2HBH A;  3B68 A;  1ILG A;  5FQT A;  3V9Y A;  4OIL A;  1T7T A;  4LBD A;  5AAU A;  4MGB A;  2OVM A;  4WVD A;  5AAV B;  2Q1H A;  3FEI A;  4RWV A;  4N8R A;  1XP9 A;  1Y0X X;  5C4T A;  1WM0 X;  1XLS A;  2YLO A;  1XPC A;  3N00 A;  3L0J A;  3L0L A;  2ZKC A;  3L3Z A;  3SZ1 A;  2NXX E;  5FQS A;  1NRL A;  3W0C A;  3WTQ A;  5DX3 A;  3RLJ A;  4YPQ A;  3UUA B;  1I7G A;  3KPZ A;  1UPV A;  4OKT A;  1T76 A;  5HJP A;  4RFW A;  3CS6 A;  2VV4 A;  3K8S A;  1PQ9 A;  1FM9 A;  2B1V A;  2QAB A;  3E7C A;  1R1K D;  3KMR A;  4HEE X;  3OSI A;  5K13 A;  5M96 A;  1S9P A;  2HAM A;  3PRG A;  4OZR E;  4Q0A C;  1YJE A;  2AB2 A;  4WHG A;  5DZH A;  3WFG A;  4K6I A;  2PIU A;  4FHI A;  2P15 A;  2GPP A;  4L96 A;  3KFC A;  3ERD A;  3CWD A;  3DCU A;  4MDD A;  1YY4 A;  3DZU D;  1PDU A;  4TUZ A;  1XVP B;  2QH6 A;  1XDK A;  3OZJ A;  3FS1 A;  1FBY A;  3RUU A;  4WQP A;  2G0H A;  2PIN A;  4Q13 A;  4ZN7 A;  2AWH A;  2Z4J A;  1I38 A;  4LTW A;  4OK1 A;  3MNE A;  5DRJ A;  4WLB A;  1Q4X A;  3HC6 A;  3ET3 A;  2FSZ A;  5E7V A;  2H77 A;  2AAX A;  4DK7 A;  2JJ3 A;  1DB1 A;  1RKG A;  2Z4B A;  2YJA B;  1M13 A;  2GWX A;  4DK8 A;  4HLW A;  3W5T A;  2G44 A;  5A86 A;  3CS8 A;  2GTK A;  4S14 A;  3OMP A;  4RME A;  2ZK3 A;  4J5X A;  4OGH A;  3NSQ A;  2GIU A;  3HO0 A;  4TV1 B;  4PP5 A;  4N5G A;  4ZJW A;  1P93 A;  3VT9 A;  2AYR A;  2FVJ A;  3L0E A;  2PIT A;  5EI1 A;  1I37 A;  1KKQ A;  5EC9 A;  3W0A A;  1TFC A;  4IA3 A;  3ET1 A;  2ZNQ A;  2QPY A;  4P6X A;  4X1G A;  5C4O A;  1XP1 A;  2HB8 A;  2P7G A;  2V0V A;  4FN9 A;  1NDE A;  4OFR A;  4OJ9 A;  5JI0 D;  2Q6J A;  4E2J A;  1X76 A;  3X36 A;  4OJ4 A;  4PWL A;  3GZ9 A;  4R06 A;  1MVC A;  4S0S A;  5DX3 B;  5DZI A;  2ZNP A;  4NB6 A;  2LBD A;  5HJP B;  4NY9 A;  4PXM A;  4REE A;  2Q5P A;  2PIO A;  2F4B A;  1T74 A;  1YMT A;  2HB7 A;  5EHJ A;  2GPU A;  2PIV A;  3B5R A;  3GD2 A;  4MG7 B;  3KBA A;  4RZE A;  2HCD A;  3DY6 A;  4PLE A;  5AVI A;  5KYA A;  3V9V A;  4DOS A;  3G0W A;  5I4V A;  5AAV A;  3TY0 A;  2GPO A;  4J26 A;  4OC7 A;  2Q7J A;  3VI8 A;  4PRG A;  2QA6 A;  4MG5 A;  5L7E A;  1ZAF A;  4QL8 A;  3F7D A;  4XUH A;  3DZY D;  1KNU A;  2PIQ A;  3A78 A;  3JZB A;  3OZ0 A;  3IPS A;  2Q3Y A;  3PLZ A;  4RZG A;  5JY3 A;  5DXM A;  5FQP A;  3UUA A;  2O9I A;  4PVU A;  4TUZ B;  1T79 A;  1S19 A;  1ZH7 A;  4N73 A;  1ZKY A;  2ZMH A;  3SP9 A;  1YOK A;  4J5X C;  3X1I A;  3B67 A;  2G0G A;  2Q6R A;  2Q7L A;  3B0R A;  4G1Y A;  1R20 A;  5DUH A;  2QXM A;  5DZ1 A;  2I0G A;  3P88 A;  1DKF B;  4XAO A;  3H52 A;  2AA6 A;  3VJI A;  5G43 A;  2I4Z A;  3H0A D;  1M7W A;  4EMA A;  5E19 A;  5AYG A;  5HYK A;  4LSJ A;  4ZNV A;  4BCR A;  2AX7 A;  3PBA A;  5SYZ A;  1OT7 A;  4PP3 A;  5HJS A;  3EYB A;  1XVP A;  1SR7 A;  5DXR A;  2PRG A;  1NQ1 A;  5H1E A;  3D24 A;  4QM0 A;  3D90 A;  3D5F A;  2ZFX A;  4MGA B;  5DKS A;  1ZDT A;  5DY8 A;  2O4R A;  2ZK0 A;  4ZJR A;  4XHD A;  4IA7 A;  3WJ4 A;  3W0H A;  2P1V A;  2P54 A;  3KMG A;  3OS8 C;  2OCF A;  3OAP A;  3R5M A;  5L7H A;  3AN3 A;  5DWE A;  1YIN A;  3VJS A;  5E0X A;  1S0Z A;  1ZDU A;  2Q5S A;  4IUI A;  3V3E A;  5DU5 A;  5KRO A;  4OH5 A;  5KRM A;  3D6D A;  2NW4 A;  2ZMJ A;  4KZJ A;  4RMD A;  4TV1 A;  5B41 A;  1BSX A;  1T7M A;  3PCU A;  4FGY A;  4ZO1 X;  1QKN A;  2H79 A;  2AMA A;  3ZRA A;  4PF3 A;  1PK5 A;  5APJ A;  1NAX A;  2I4P A;  4KZI A;  3X1H A;  2ZL9 A;  1XNN A;  4MG9 A;  3ADW A;  3VHV A;  3CLD A;  4XUM A;  2ABI A;  2VSR A;  2YLP A;  4ZNU A;  1QKU A;  2I0J A;  1N4H A;  2QR9 A;  2REW A;  2V7C A;  4O8F A;  4A4V A;  3X31 A;  1OSH A;  4UDA A;  4OAR A;  3GYT A;  1XZX X;  3A2H A;  4IU7 A;  4REF A;  3A9E B;  1PZL A;  1YUC A;  3IMY A;  5DXB B;  5G3J A;  3OLF A;  3VTB A;  2POG A;  3V9T A;  3WT5 A;  2JFA A;  2ZNN A;  5KCF A;  5ACC A;  3ADU A;  1X78 A;  2YHD A;  3OLL A;  4CI5 A;  2IOK A;  1UOM A;  4MG7 A;  4A2J A;  2J7Y A;  5F9B A;  2OM9 A;  3T03 A;  2AO6 A;  5DKE A;  3OOF A;  4ZO1 B;  5AZT A;  3DCT A;  2G5O A;  1ZEO A;  3AZ1 A;  3WGP A;  4IVY A;  3RVF A;  5KR9 A;  4ITE A;  1XV9 B;  4K4J A;  1M2Z A;  2AA2 A;  3A2I A;  2ZLA A;  5LGA A;  2ACL B;  1YP0 A;  4ZN9 A;  3FUG A;  1K74 A;  4ZI1 A;  2I4J A;  5EGV A;  4EM9 A;  4XT9 A;  1XJ7 A;  3WJ5 A;  2J7X A;  4XI3 A;  3E00 A;  1SQN A;  4POH A;  3GWX A;  1NHZ A;  5DUG A;  3A3Z X;  5GT4 A;  1RJK A;  1DKF A;  4FNE A;  1ZGY A;  4ZNT A;  4XLD A;  5DWI A;  3BC5 A;  5FQR A;  3R8I A;  2BAW A;  3IXP A;  2VV3 A;  5DVV A;  2YLQ A;  4MG8 B;  4KZM A;  4IVW A;  2PNU A;  5DZ3 A;  5IAW A;  3VRT A;  4UDD A;  2XKW A;  1IE8 A;  3B65 A;  3TKM A;  3VSO A;  4JYH A;  5KRC A;  1A52 A;  1Z95 A;  1P8D A;  3K22 A;  1L2I A;  4MGA A;  2P4Y A;  3V4A A;  1EXA A;  3HVL A;  1FM6 D;  1OVL B;  2ZAS A;  2YAT A;  5DSH A;  3B1M A;  3OMQ A;  4M8E A;  2ZK1 A;  4ONI A;  2R40 D;  5DL4 A;  2BJ4 A;  2VST A;  5FQV A;  4MG9 B;  3AN4 A;  5ICK A;  3TX7 B;  3HOD A;  3G8I A;  3AX8 A;  1NYX A;  5AVL A;  3VSP A;  2IHQ A;  2AX6 A;  5DMF A;  2NXX A;  5DVS A;  4RUP A;  2OZ7 A;  3D57 A;  2ZXN A;  3DT3 A;  4F9M A;  5JJM B;  3UUD B;  5DVC A;  2ZY0 A;  4YNK A;  5DKB A;  5DRM A;  3NSP A;  2A3I A;  2JFA B;  3B0T A;  5GIE A;  1RDT A;  3OS8 A;  1VJB A;  3WFF A;  2ZVT A;  2Q7I A;  5GID A;  3AUQ A;  4XTA A;  1SJ0 A;  1UHL A;  3VT8 A;  3B0W A;  4APU A;  5KCE A;  1ILH A;  3CJW A;  1U9E A;  3NOA A;  5DXK A;  4G21 A;  1FM9 D;  2P7A A;  3A9E A;  3OMO A;  4IW8 A;  1NQ7 A;  1IE9 A;  2NV7 A;  1T7R A;  5DXB A;  2HWR A;  4M8H A;  3G8O A;  3VTD A;  1N46 A;  2Q1V A;  4MG6 A;  2PIP L;  4S0T A;  1XQC A;  5IXK A;  1YYE A;  4A4W A;  3L1B A;  3P89 A;  1Y9R A;  3RLL A;  1G2N A;  3VN2 A;  5CJ6 A;  1U3Q A;  5KCD A;  2ATH A;  4ZOM A;  5ETH A;  1GS4 A;  2XYJ A;  5DI7 A;  5E1C A;  1NAV A;  2AXA A;  1G5Y A;  2O4J A;  3HC5 A;  2QW4 A;  4OJB A;  1XV9 A;  3OMK A;  4OZT U;  3ZR7 A;  5G44 A;  5HZC A;  2ACL A;  5DXG A;  2AX9 A;  3CTB A;  1R1K A;  1NQ2 A;  3VHW A;  3HZF A;  3E94 A;  4MGC A;  4OEZ A;  1XLS E;  4ZNS A;  1X7R A;  4OLM A;  4WPF A;  4DOR A;  2GPV A;  1H9U A;  2NPA A;  5LWP A;  3IPQ A;  1T65 A;  2W8Y A;  3O1D A;  4R6S A;  5DK9 A;  5G42 A;  2ZBS A;  3ADT A;  3FLI A;  1UPW A;  5AZV A;  2BJ4 B;  3OLS A;  5G46 A;  4OIV A;  3DZU A;  2ZLC A;  1YA3 A;  4JYI A;  2P1U A;  4MG8 A;  5KRK A;  2E2R A;  3IPU A;  4X1F A;  5KCC A;  4Y29 A;  3ZQT A;  1U3R A;  3FUR A;  4RUJ A;  5DXP A;  1PQC A;  1T73 A;  4K7A A;  4MGD B;  4DMA A;  1OVL A;  1GWQ A;  5APH A;  3ZRB A;  3B66 A;  4OFU A;  3UUC A;  1FD0 A;  3CQV A;  5DIE A;  4DM8 A;  1TXI A;  5B5B A;  3OSW A;  2B23 A;  3WT6 A;  2VV1 B;  5HYR A;  3RY9 A;  2QXS A;  1HJ1 A;  1UHL B;  3AUR A;  3UP3 A;  3WMH A;  1EXX A;  5G5W A;  3RUT A;  1FCZ A;  3KYT A;  1E3K A;  4JYG A;  4PLD A;  1XIU A;  1XP6 A;  5JJM A;  3K23 A;  3UUD A;  3V3Q A;  2AX8 A;  3VJH A;  5AK2 A;  4OEY A;  3ET0 A;  5DTV A;  3W5R A;  3Q95 B;  5DIG A;  2Q7K A;  3GWS X;  5GIC A;  2QGW A;  4QE6 A;  4ZNH A;  1G50 A;  1OSV A;  2YJD A;  3ADS A;  4IW6 A;  3FEJ A;  5DYB A;  4QK4 A;  2PIR A;  1XB7 A;  1R5K A;  4ZNW A;  4OZT E;  1I7I A;  2FAI A;  4OKW A;  2HVC A;  2XYW A;  3W5P A;  3M7R A;  3P0U A;  1XNX A;  3FC6 B;  3OKI A;  3BEJ A;  3VHU A;  4LNW A;  4P6W A;  5DLR A;  2AM9 A;  1R20 D;  5DV8 A;  5DUE A;  3CDS A;  4OIU A;  2HAR A;  4J5W C;  4IWC A;  4RE8 A; 
#chains in the Genus database with same CATH homology
 1PCG A;  2VV0 A;  3VJT A;  3ADV A;  1T5Z A;  2Q61 A;  1PRG A;  4E4K A;  3R8D A;  3DZY A;  4UDC A;  2ZK4 A;  4OKB A;  4RUO X;  5DID A;  1Z5X U;  3F5C A;  3ET2 A;  5DWL A;  2R6Y A;  3VTC A;  2Q8S A;  1LBD A;  4E4Q A;  3K6P A;  5G45 A;  2GP7 A;  5EJV A;  2Q70 A;  3LBD A;  4IWF A;  1XAP A;  2HAS A;  3TKC A;  4NQA B;  3W5Q A;  4JAZ A;  3VT5 A;  4DM6 A;  3R5N A;  5KRI A;  3A2J A;  3CDP A;  3UVV B;  3ADX A;  3R2A A;  2J4A A;  1LV2 A;  3O1E A;  1YIM A;  2ZK5 A;  3H0A A;  2GL8 A;  2PJL A;  3PO9 A;  1K7L A;  4OEA A;  3G9E A;  3S9S A;  3R29 A;  3FAL B;  2OVH A;  2P7Z A;  4S15 A;  4OH6 A;  2OUZ A;  2Q59 B;  1RKH A;  3VT3 A;  3BQD A;  1ERE A;  3U9Q A;  4IA2 A;  5DXE A;  5KRF A;  4G1D A;  1K4W A;  3GN8 A;  2ZNO A;  2JF9 A;  1XOW A;  2QA8 A;  2PIW A;  5AWJ A;  4B7W A;  5KD9 A;  3VT4 A;  4G1Z A;  4IS8 A;  1FCY A;  3HLV A;  5APK A;  4MGD A;  2AA5 A;  2AMB A;  3W0G A;  2QZO B;  3V49 A;  3VRW A;  1XQ3 A;  5DWJ A;  4PP6 A;  1YOW A;  5KCU A;  4G20 A;  3FXV A;  2PKL A;  1ZUC A;  3W0Y A;  2POB A;  2VV1 A;  4G2I A;  4JL4 A;  3DR1 A;  3LMP A;  5DV3 A;  4PPS A;  3AZ2 A;  3ERT A;  3VRV A;  4FHH A;  1GWR A;  2Q6S A;  4IV2 A;  3OMM A;  5KCT A;  1T7F A;  4OED A;  4MGB B;  4WHF A;  2XYX A;  1R6G A;  1E3G A;  1S0X A;  3L03 A;  3AFR A;  2OAX A;  3Q95 A;  5C4S A;  4POJ A;  2Q5G A;  4YMQ A;  3IA6 A;  3UU7 A;  3VRU A;  2HC4 A;  2IOG A;  2Q60 A;  5DKG A;  4LNX A;  1Z5X E;  3HQ5 A;  1FCX A;  4YT1 A;  1A28 A;  5E14 A;  2VV4 B;  2P1T A;  2YFE A;  3WT7 A;  2ZXM A;  1K74 D;  3HM1 A;  4JGV A;  3F5C B;  4NIE A;  3FC6 A;  2XHS A;  3AUN A;  2QNV A;  3E00 D;  4RAK A;  3R8A A;  1X7J A;  3VT6 A;  1PQ6 A;  3JZC A;  1KV6 A;  2QGT A;  3OSA A;  1SKX A;  4DQM A;  3UP0 A;  1MV9 A;  4QJR A;  3B0Q A;  1NUO A;  3IXP D;  2J14 A;  2R6W A;  5DWG A;  5AWK A;  1X7E A;  1XDK B;  1HG4 A;  5DZ0 A;  4IV4 A;  5DV6 A;  2HWQ A;  1NQ0 A;  4UDB A;  1N83 A;  5DMC A;  2QE4 A;  2ZK6 A;  5DP0 A;  3OGT A;  1QKM A;  3L3X A;  4QE8 A;  5L11 A;  4OKX A;  5C4U A;  3CS4 A;  2QSE A;  5E0W A;  4OZR U;  3B3K A;  3OOK A;  2VV2 A;  2QA8 B;  4J5W A;  2QTU A;  3SP6 A;  1MZN A;  1GWX A;  4G2H A;  1S9Q A;  5DXQ A;  4OHA A;  3UVV A;  1L2J A;  2B50 A;  5EIT A;  4IQR A;  5KCW A;  5KRL A;  1G1U A;  2EWP A;  3FAL A;  4L98 A;  2QMV A;  4RMC A;  5KRJ A;  2Q59 A;  4J24 A;  3GYU A;  3KDT A;  3A40 X;  3P8X A;  3GBK A;  5KYJ A;  1ERR A;  2ZMI A;  4N1Y A;  5KRH A;  3AZ3 A;  3W0I A;  1RDT D;  4IA1 A;  4PPP A;  2AA7 A;  1Y0S A;  1FM6 A;  4R2U A;  5HCV A;  4ITF A;  1QKT A;  2R40 A;  5KRA A;  3KWY A;  1T63 A;  5DYD A;  4RZF A;  2QZO A;  3OKH A;  1X7B A;  2B1Z A;  5L7G A;  1RK3 A;  4CSJ A;  2PIX A;  3UU7 B;  2ZXZ A;  3MNP A;  2ZK2 A;  3OS9 A;  2HFP A;  3VT7 A;  4Q50 A;  3MNO A;  3W0J A;  3WWR A;  4CI4 A;  3KMZ A;  3KDU A;  3ILZ A;  4NUF A;  1U3S A;  3PEQ A;  2YLY A;  3QT0 A;  5E15 A;  5IZ0 A;  2HBH A;  3B68 A;  1ILG A;  5FQT A;  3V9Y A;  4OIL A;  1T7T A;  4LBD A;  5AAU A;  4MGB A;  2OVM A;  4WVD A;  5AAV B;  2Q1H A;  3FEI A;  4RWV A;  4N8R A;  1XP9 A;  1Y0X X;  5C4T A;  1WM0 X;  1XLS A;  2YLO A;  1XPC A;  3N00 A;  3L0J A;  3L0L A;  2ZKC A;  3L3Z A;  3SZ1 A;  2NXX E;  5FQS A;  1NRL A;  3W0C A;  3WTQ A;  5DX3 A;  3RLJ A;  4YPQ A;  3UUA B;  1I7G A;  3KPZ A;  1UPV A;  4OKT A;  1T76 A;  5HJP A;  4RFW A;  3CS6 A;  2VV4 A;  3K8S A;  1PQ9 A;  1FM9 A;  2B1V A;  2QAB A;  3E7C A;  1R1K D;  3KMR A;  4HEE X;  3OSI A;  5K13 A;  5M96 A;  1S9P A;  2HAM A;  3PRG A;  4OZR E;  4Q0A C;  1YJE A;  2AB2 A;  4WHG A;  5DZH A;  3WFG A;  4K6I A;  2PIU A;  4FHI A;  2P15 A;  2GPP A;  4L96 A;  3KFC A;  3ERD A;  3CWD A;  3DCU A;  4MDD A;  1YY4 A;  3DZU D;  1PDU A;  4TUZ A;  1XVP B;  2QH6 A;  1XDK A;  3OZJ A;  3FS1 A;  1FBY A;  3RUU A;  4WQP A;  2G0H A;  2PIN A;  4Q13 A;  4ZN7 A;  2AWH A;  2Z4J A;  1I38 A;  4LTW A;  4OK1 A;  3MNE A;  5DRJ A;  4WLB A;  1Q4X A;  3HC6 A;  3ET3 A;  2FSZ A;  5E7V A;  2H77 A;  2AAX A;  4DK7 A;  2JJ3 A;  1DB1 A;  1RKG A;  2Z4B A;  2YJA B;  1M13 A;  2GWX A;  4DK8 A;  4HLW A;  3W5T A;  2G44 A;  5A86 A;  3CS8 A;  2GTK A;  4S14 A;  3OMP A;  4RME A;  2ZK3 A;  4J5X A;  4OGH A;  3NSQ A;  2GIU A;  3HO0 A;  4TV1 B;  4PP5 A;  4N5G A;  4ZJW A;  1P93 A;  3VT9 A;  2AYR A;  2FVJ A;  3L0E A;  2PIT A;  5EI1 A;  1I37 A;  1KKQ A;  5EC9 A;  3W0A A;  1TFC A;  4IA3 A;  3ET1 A;  2ZNQ A;  2QPY A;  4P6X A;  4X1G A;  5C4O A;  1XP1 A;  2HB8 A;  2P7G A;  2V0V A;  4FN9 A;  1NDE A;  4OFR A;  4OJ9 A;  5JI0 D;  2Q6J A;  4E2J A;  1X76 A;  3X36 A;  4OJ4 A;  4PWL A;  3GZ9 A;  4R06 A;  1MVC A;  4S0S A;  5DX3 B;  5DZI A;  2ZNP A;  4NB6 A;  2LBD A;  5HJP B;  4NY9 A;  4PXM A;  4REE A;  2Q5P A;  2PIO A;  2F4B A;  1T74 A;  1YMT A;  2HB7 A;  5EHJ A;  2GPU A;  2PIV A;  3B5R A;  3GD2 A;  4MG7 B;  3KBA A;  4RZE A;  2HCD A;  3DY6 A;  4PLE A;  5AVI A;  5KYA A;  3V9V A;  4DOS A;  3G0W A;  5I4V A;  5AAV A;  3TY0 A;  2GPO A;  4J26 A;  4OC7 A;  2Q7J A;  3VI8 A;  4PRG A;  2QA6 A;  4MG5 A;  5L7E A;  1ZAF A;  4QL8 A;  3F7D A;  4XUH A;  3DZY D;  1KNU A;  2PIQ A;  3A78 A;  3JZB A;  3OZ0 A;  3IPS A;  2Q3Y A;  3PLZ A;  4RZG A;  5JY3 A;  5DXM A;  5FQP A;  3UUA A;  2O9I A;  4PVU A;  4TUZ B;  1T79 A;  1S19 A;  1ZH7 A;  4N73 A;  1ZKY A;  2ZMH A;  3SP9 A;  1YOK A;  4J5X C;  3X1I A;  3B67 A;  2G0G A;  2Q6R A;  2Q7L A;  3B0R A;  4G1Y A;  1R20 A;  5DUH A;  2QXM A;  5DZ1 A;  2I0G A;  3P88 A;  1DKF B;  4XAO A;  3H52 A;  2AA6 A;  3VJI A;  5G43 A;  2I4Z A;  3H0A D;  1M7W A;  4EMA A;  5E19 A;  5AYG A;  5HYK A;  4LSJ A;  4ZNV A;  4BCR A;  2AX7 A;  3PBA A;  5SYZ A;  1OT7 A;  4PP3 A;  5HJS A;  3EYB A;  1XVP A;  1SR7 A;  5DXR A;  2PRG A;  1NQ1 A;  5H1E A;  3D24 A;  4QM0 A;  3D90 A;  3D5F A;  2ZFX A;  4MGA B;  5DKS A;  1ZDT A;  5DY8 A;  2O4R A;  2ZK0 A;  4ZJR A;  4XHD A;  4IA7 A;  3WJ4 A;  3W0H A;  2P1V A;  2P54 A;  3KMG A;  3OS8 C;  2OCF A;  3OAP A;  3R5M A;  5L7H A;  3AN3 A;  5DWE A;  1YIN A;  3VJS A;  5E0X A;  1S0Z A;  1ZDU A;  2Q5S A;  4IUI A;  3V3E A;  5DU5 A;  5KRO A;  4OH5 A;  5KRM A;  3D6D A;  2NW4 A;  2ZMJ A;  4KZJ A;  4RMD A;  4TV1 A;  5B41 A;  1BSX A;  1T7M A;  3PCU A;  4FGY A;  4ZO1 X;  1QKN A;  2H79 A;  2AMA A;  3ZRA A;  4PF3 A;  1PK5 A;  5APJ A;  1NAX A;  2I4P A;  4KZI A;  3X1H A;  2ZL9 A;  1XNN A;  4MG9 A;  3ADW A;  3VHV A;  3CLD A;  4XUM A;  2ABI A;  2VSR A;  2YLP A;  4ZNU A;  1QKU A;  2I0J A;  1N4H A;  2QR9 A;  2REW A;  2V7C A;  4O8F A;  4A4V A;  3X31 A;  1OSH A;  4UDA A;  4OAR A;  3GYT A;  1XZX X;  3A2H A;  4IU7 A;  4REF A;  3A9E B;  1PZL A;  1YUC A;  3IMY A;  5DXB B;  5G3J A;  3OLF A;  3VTB A;  2POG A;  3V9T A;  3WT5 A;  2JFA A;  2ZNN A;  5KCF A;  5ACC A;  3ADU A;  1X78 A;  2YHD A;  3OLL A;  4CI5 A;  2IOK A;  1UOM A;  4MG7 A;  4A2J A;  2J7Y A;  5F9B A;  2OM9 A;  3T03 A;  2AO6 A;  5DKE A;  3OOF A;  4ZO1 B;  5AZT A;  3DCT A;  2G5O A;  1ZEO A;  3AZ1 A;  3WGP A;  4IVY A;  3RVF A;  5KR9 A;  4ITE A;  1XV9 B;  4K4J A;  1M2Z A;  2AA2 A;  3A2I A;  2ZLA A;  5LGA A;  2ACL B;  1YP0 A;  4ZN9 A;  3FUG A;  1K74 A;  4ZI1 A;  2I4J A;  5EGV A;  4EM9 A;  4XT9 A;  1XJ7 A;  3WJ5 A;  2J7X A;  4XI3 A;  3E00 A;  1SQN A;  4POH A;  3GWX A;  1NHZ A;  5DUG A;  3A3Z X;  5GT4 A;  1RJK A;  1DKF A;  4FNE A;  1ZGY A;  4ZNT A;  4XLD A;  5DWI A;  3BC5 A;  5FQR A;  3R8I A;  2BAW A;  3IXP A;  2VV3 A;  5DVV A;  2YLQ A;  4MG8 B;  4KZM A;  4IVW A;  2PNU A;  5DZ3 A;  5IAW A;  3VRT A;  4UDD A;  2XKW A;  1IE8 A;  3B65 A;  3TKM A;  3VSO A;  4JYH A;  5KRC A;  1A52 A;  1Z95 A;  1P8D A;  3K22 A;  1L2I A;  4MGA A;  2P4Y A;  3V4A A;  1EXA A;  3HVL A;  1FM6 D;  1OVL B;  2ZAS A;  2YAT A;  5DSH A;  3B1M A;  3OMQ A;  4M8E A;  2ZK1 A;  4ONI A;  2R40 D;  5DL4 A;  2BJ4 A;  2VST A;  5FQV A;  4MG9 B;  3AN4 A;  5ICK A;  3TX7 B;  3HOD A;  3G8I A;  3AX8 A;  1NYX A;  5AVL A;  3VSP A;  2IHQ A;  2AX6 A;  5DMF A;  2NXX A;  5DVS A;  4RUP A;  2OZ7 A;  3D57 A;  2ZXN A;  3DT3 A;  4F9M A;  5JJM B;  3UUD B;  5DVC A;  2ZY0 A;  4YNK A;  5DKB A;  5DRM A;  3NSP A;  2A3I A;  2JFA B;  3B0T A;  5GIE A;  1RDT A;  3OS8 A;  1VJB A;  3WFF A;  2ZVT A;  2Q7I A;  5GID A;  3AUQ A;  4XTA A;  1SJ0 A;  1UHL A;  3VT8 A;  3B0W A;  4APU A;  5KCE A;  1ILH A;  3CJW A;  1U9E A;  3NOA A;  5DXK A;  4G21 A;  1FM9 D;  2P7A A;  3A9E A;  3OMO A;  4IW8 A;  1NQ7 A;  1IE9 A;  2NV7 A;  1T7R A;  5DXB A;  2HWR A;  4M8H A;  3G8O A;  3VTD A;  1N46 A;  2Q1V A;  4MG6 A;  2PIP L;  4S0T A;  1XQC A;  5IXK A;  1YYE A;  4A4W A;  3L1B A;  3P89 A;  1Y9R A;  3RLL A;  1G2N A;  3VN2 A;  5CJ6 A;  1U3Q A;  5KCD A;  2ATH A;  4ZOM A;  5ETH A;  1GS4 A;  2XYJ A;  5DI7 A;  5E1C A;  1NAV A;  2AXA A;  1G5Y A;  2O4J A;  3HC5 A;  2QW4 A;  4OJB A;  1XV9 A;  3OMK A;  4OZT U;  3ZR7 A;  5G44 A;  5HZC A;  2ACL A;  5DXG A;  2AX9 A;  3CTB A;  1R1K A;  1NQ2 A;  3VHW A;  3HZF A;  3E94 A;  4MGC A;  4OEZ A;  1XLS E;  4ZNS A;  1X7R A;  4OLM A;  4WPF A;  4DOR A;  2GPV A;  1H9U A;  2NPA A;  5LWP A;  3IPQ A;  1T65 A;  2W8Y A;  3O1D A;  4R6S A;  5DK9 A;  5G42 A;  2ZBS A;  3ADT A;  3FLI A;  1UPW A;  5AZV A;  2BJ4 B;  3OLS A;  5G46 A;  4OIV A;  3DZU A;  2ZLC A;  1YA3 A;  4JYI A;  2P1U A;  4MG8 A;  5KRK A;  2E2R A;  3IPU A;  4X1F A;  5KCC A;  4Y29 A;  3ZQT A;  1U3R A;  3FUR A;  4RUJ A;  5DXP A;  1PQC A;  1T73 A;  4K7A A;  4MGD B;  4DMA A;  1OVL A;  1GWQ A;  5APH A;  3ZRB A;  3B66 A;  4OFU A;  3UUC A;  1FD0 A;  3CQV A;  5DIE A;  4DM8 A;  1TXI A;  5B5B A;  3OSW A;  2B23 A;  3WT6 A;  2VV1 B;  5HYR A;  3RY9 A;  2QXS A;  1HJ1 A;  1UHL B;  3AUR A;  3UP3 A;  3WMH A;  1EXX A;  5G5W A;  3RUT A;  1FCZ A;  3KYT A;  1E3K A;  4JYG A;  4PLD A;  1XIU A;  1XP6 A;  5JJM A;  3K23 A;  3UUD A;  3V3Q A;  2AX8 A;  3VJH A;  5AK2 A;  4OEY A;  3ET0 A;  5DTV A;  3W5R A;  3Q95 B;  5DIG A;  2Q7K A;  3GWS X;  5GIC A;  2QGW A;  4QE6 A;  4ZNH A;  1G50 A;  1OSV A;  2YJD A;  3ADS A;  4IW6 A;  3FEJ A;  5DYB A;  4QK4 A;  2PIR A;  1XB7 A;  1R5K A;  4ZNW A;  4OZT E;  1I7I A;  2FAI A;  4OKW A;  2HVC A;  2XYW A;  3W5P A;  3M7R A;  3P0U A;  1XNX A;  3FC6 B;  3OKI A;  3BEJ A;  3VHU A;  4LNW A;  4P6W A;  5DLR A;  2AM9 A;  1R20 D;  5DV8 A;  5DUE A;  3CDS A;  4OIU A;  2HAR A;  4J5W C;  4IWC A;  4RE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...