1U3QA

Crystal structure of estrogen receptor beta complexed with cl-272
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
235
structure length
226
Chain Sequence
LSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYDSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design and synthesis of aryl diphenolic azoles as potent and selective estrogen receptor-beta ligands.
pubmed doi rcsb
molecule keywords Estrogen receptor beta
molecule tags Transcription
source organism Homo sapiens
total genus 83
structure length 226
sequence length 235
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 1u3qA00
5DIDA 3ADWA 4ZNSA 1RJKA 4IVYA 1FM9D 4Q13A 3VJHA 4MGAB 5JJMB 3OLSA 4MGDB 1YOWA 4N1YA 5GIDA 4QK4A 4IWFA 4J5WC 1GWQA 3VN2A 1NAVA 4OH5A 3V9YA 1XAPA 3ZR7A 3DR1A 5DV8A 3E00A 4K4JA 2ZNNA 2PIXA 4DK8A 1S0XA 3GYUA 1I7GA 1XP9A 3ZQTA 4DK7A 3JZCA 3UP0A 2VV4B 4ZO1X 2Q3YA 3X31A 2GPOA 3FEJA 1ZUCA 2ATHA 3WMHA 1VJBA 5DX3A 4TUZA 4PRGA 2HARA 3F5CB 4OKBA 4OK1A 2Q7JA 3ET0A 2HB7A 2J7XA 3ADXA 3CQVA 4OARA 1FM6D 2YLPA 2POGA 3L3ZA 1N4HA 5DI7A 3WT6A 2EWPA 3AN3A 2HFPA 4P6XA 1ZGYA 2NXXA 1XDKB 2NPAA 4OEYA 3WT5A 3FUGA 5EHJA 1SR7A 5JJMA 1T79A 3IXPA 3R2AA 3IPSA 2BJ4B 3OSAA 5HJSA 3WT7A 1Z95A 2Q7LA 1X78A 3OZ0A 2ZK5A 5FQRA 2P1TA 4YNKA 4YPQA 3W0JA 2P4YA 2YATA 5DYDA 3G0WA 2YLYA 5KRHA 4OJBA 3L3XA 2ZBSA 2AO6A 3P8XA 2VSTA 4WPFA 3IMYA 3WTQA 5KRJA 3V49A 1A28A 4L96A 5AK2A 5KYAA 4WHGA 3A9EA 2LBDA 2XYWA 3FS1A 3SP9A 1X7RA 5F9BA 5G3JA 1OVLB 1UHLB 2J14A 4E4KA 1P93A 4G1ZA 4HEEX 1YA3A 2V7CA 4IA7A 5HJPB 3KBAA 3UU7A 3AFRA 3L1BA 4ITEA 5JI0D 4RWVA 1YJEA 4RMDA 3VJTA 3PEQA 3VT5A 2PINA 4TV1A 5GT4A 1FM6A 4ZN9A 1I37A 1DB1A 4RZGA 3CS4A 3VT3A 1TXIA 1R20D 5DZ3A 1KV6A 3V4AA 3ET2A 1T74A 4OEZA 1XQCA 2BAWA 3RVFA 2YFEA 5DUHA 2QSEA 3VSPA 1E3KA 4DORA 5KR9A 3L0EA 1EXXA 1NRLA 5KRCA 5L7GA 3OS8C 1ZAFA 4P6WA 2GPUA 4QE6A 5APKA 2E2RA 3FC6A 2ZK1A 3KMZA 5E0WA 4CI5A 2AA6A 1MZNA 2O9IA 2Z4BA 1K4WA 4LSJA 1PZLA 2GWXA 4XTAA 4JYIA 2QE4A 4PF3A 2YHDA 3ILZA 4J5WA 4RFWA 4BCRA 4OJ9A 4MDDA 5IZ0A 3TKMA 5G43A 1FBYA 5C4OA 4PPPA 1ILGA 5DKBA 4IVWA 1FCXA 4JYGA 2P7GA 4RE8A 1NDEA 4UDBA 4ZNVA 3HQ5A 3W5TA 2Q1HA 5DXQA 4NIEA 2Q5PA 1PRGA 3MNPA 4MGBB 1NAXA 5JY3A 5KCDA 1DKFB 5DV3A 5DMCA 5DX3B 3OGTA 1T73A 1QKUA 1XQ3A 3AUNA 3OMKA 2G5OA 4OZTU 4A4VA 1R20A 3JZBA 3HLVA 3MNEA 5L11A 2JFAB 2Q6SA 3RLJA 3UUDB 3X1HA 1NUOA 2HBHA 3W5QA 4MG5A 1XLSA 5IAWA 2QR9A 1P8DA 2VV1A 3ADVA 5G42A 5C4SA 4OKTA 2OZ7A 3TY0A 5AAUA 1XVPB 5EI1A 2QTUA 3X36A 3G8OA 3R29A 5DK9A 3G9EA 4ONIA 3HC5A 4MG9A 5AAVA 3ERDA 2B1ZA 2J7YA 4LBDA 4S0SA 1SQNA 5ICKA 3UUAB 1N46A 2GL8A 3E94A 3PBAA 3VRWA 3UVVB 1ERRA 1UOMA 3SZ1A 4G20A 2ZK2A 2QXMA 5DUEA 1T63A 4M8HA 1U3SA 4REFA 3LMPA 5DXPA 5KRFA 3KWYA 4LTWA 5KYJA 5KCUA 4IA2A 5KCCA 3VT8A 2R6YA 5CJ6A 3VHUA 4RUJA 4OZRU 2ZMHA 2AM9A 3GWXA 5DKGA 5G5WA 4KZJA 2B1VA 3R5NA 4KZIA 4EM9A 4MG8A 5KD9A 3GWSX 1NQ1A 5ACCA 1XV9B 1YMTA 1YP0A 2HC4A 3LBDA 3WFFA 3AZ2A 4OH6A 4A2JA 3T03A 4S0TA 3VRUA 1MV9A 1X76A 2H79A 1YUCA 2I0GA 3D5FA 2HAMA 2PIPL 4JGVA 2ZXZA 2GIUA 4ZO1B 3SP6A 4WVDA 2ZLCA 3DZUA 4J26A 1L2JA 3ET1A 4IW6A 5DWJA 4EMAA 2HVCA 5DXMA 1YIMA 1XOWA 5C4UA 5APJA 4MG7B 5C4TA 1K74D 5ETHA 2VV2A 1RK3A 4IW8A 3KMRA 2W8YA 2ZK3A 4G1DA 1NYXA 4B7WA 1N83A 1E3GA 1XIUA 2P1UA 3ERTA 4OFUA 3WJ5A 2O4RA 2IOGA 3IA6A 1ZDTA 2QPYA 5SYZA 4UDCA 3FLIA 3ZRAA 1LV2A 3OMOA 4RAKA 4IQRA 2ZXMA 3FXVA 2I0JA 1FM9A 1M13A 3KMGA 1M7WA 2NXXE 4JL4A 4REEA 4X1GA 5DUGA 2AMAA 3P0UA 1LBDA 3FALB 5E19A 2REWA 3AZ1A 4PLDA 4ZJWA 3KFCA 5EGVA 2Z4JA 1G5YA 5DXBA 4R6SA 4OZTE 2ZNPA 5DKSA 2P15A 3Q95B 2QZOB 5DVVA 3CS8A 2V0VA 1FCZA 3BEJA 3VJSA 2XYXA 3B0QA 4PP5A 3RY9A 3VHWA 1Z5XU 1PQ6A 1ZEOA 1HJ1A 2Q59B 1YYEA 1S9QA 4NY9A 4PPSA 2B23A 2ZXNA 2ACLA 4QM0A 2Q5SA 3V3QA 1XJ7A 5KRMA 2OUZA 2ZNOA 5EITA 5DU5A 2AAXA 1K74A 4IWCA 4PP6A 1TFCA 1T5ZA 4NUFA 4MG9B 5E14A 3CDSA 1S0ZA 2YJDA 4MG6A 5KRKA 3OOFA 3KPZA 2PIRA 1ZDUA 2QA8A 5LWPA 5E7VA 3R5MA 3K23A 2OVMA 5FQVA 2H77A 3RUUA 3W0IA 3GN8A 3V3EA 4S15A 1R5KA 2PIQA 2ZNQA 4RUOX 1UPWA 2R40D 4MGDA 3S9SA 1IE8A 3K22A 5DV6A 1NHZA 5K13A 3QT0A 2OVHA 2ZKCA 3B3KA 4OZRE 5DIGA 4NQAB 3A78A 4Y29A 3CJWA 4JYHA 5G44A 3VTCA 1RDTD 1YOKA 2YLOA 4FHIA 4ZI1A 3W0CA 4IU7A 2A3IA 4XLDA 3VRVA 4OIVA 3VTBA 3HVLA 2VV4A 3L0JA 1U9EA 3CLDA 1A52A 3NSPA 4XT9A 1EXAA 1X7BA 2YLQA 2AMBA 4N5GA 4X1FA 2AXAA 3ADUA 2FVJA 3A3ZX 4IUIA 1ZH7A 1GWRA 2OM9A 4WLBA 4TUZB 3F5CA 5DRJA 3TX7B 3U9QA 4FNEA 4ZN7A 3OMMA 1PQCA 1PCGA 3CS6A 4ZOMA 2ZFXA 3OMPA 2HWQA 3IPQA 1G2NA 1G50A 4OKXA 4PWLA 1XDKA 1QKNA 4XUHA 4APUA 3TKCA 2VSRA 4OEAA 5L7EA 4E4QA 4LNXA 2BJ4A 5IXKA 3MNOA 3IPUA 3B0RA 2Q5GA 3VT4A 1PK5A 2QA6A 4ZNHA 3NSQA 2ZK4A 2AB2A 2POBA 4IV2A 4XUMA 1NQ2A 2R40A 4Q0AC 1T7MA 5G46A 4R2UA 4G1YA 1XPCA 3M7RA 2QGTA 2P1VA 3L0LA 1T65A 4QL8A 4A4WA 1PQ9A 2ZMJA 1RDTA 1Y0XX 3A9EB 1RKGA 2Q6RA 3E00D 4WHFA 1OVLA 1UHLA 2ZVTA 3V9VA 4RMCA 3NOAA 4G21A 4N73A 4UDDA 2QABA 1Y0SA 1GWXA 1Y9RA 5HJPA 3GZ9A 1QKMA 1GS4A 5DSHA 4ZNWA 1FCYA 3UU7B 2AX7A 1Z5XE 2QXSA 1X7EA 4MGCA 3O1DA 1XP6A 2AA5A 5I4VA 1H9UA 3K8SA 2ACLB 1OSHA 4TV1B 3DCTA 2OCFA 2XHSA 4FGYA 2GPVA 4OJ4A 1XZXX 3OLLA 4IV4A 4RMEA 3AZ3A 5DL4A 5L7HA 2B50A 2PKLA 2QMVA 4L98A 5HCVA 3A2IA 5DWGA 3D90A 4KZMA 3IXPD 3PRGA 3P89A 3OS8A 4M8EA 5DYBA 3UUCA 2ZLAA 3BQDA 5KCEA 3FC6B 3GYTA 2PJLA 3AN4A 5DVSA 1MVCA 2JJ3A 3AURA 4RUPA 5FQTA 4E2JA 4ZNUA 1HG4A 2AYRA 3OKHA 3PO9A 4K6IA 2QH6A 3V9TA 4CSJA 5KCWA 1XNNA 5AVIA 4PP3A 4QJRA 5DXKA 4UDAA 2FSZA 3KDUA 3N00A 1R1KD 4RZFA 3OMQA 4J5XC 4QE8A 4OILA 2AWHA 3KDTA 5DRMA 4DMAA 1S9PA 4MGBA 1Q4XA 1DKFA 4POHA 4PVUA 4IA3A 5B5BA 2Q8SA 4JAZA 2IHQA 4IS8A 5DP0A 4DQMA 4LNWA 3D6DA 3HC6A 2JF9A 2PIVA 4OEDA 4G2IA 5DIEA 5KROA 3G8IA 1XNXA 5AWJA 5DKEA 1R6GA 2I4PA 2JFAA 1NQ0A 1QKTA 3OS9A 3UUDA 5EJVA 2AA2A 4WQPA 5DMFA 2QNVA 1IE9A 5A86A 3CDPA 5AWKA 2AX8A 4IA1A 5AZVA 3F7DA 3B0WA 2ZMIA 5APHA 3DT3A 2VV1B 3ADTA 1XVPA 1I38A 4NB6A 2I4JA 4J24A 1I7IA 2Q7KA 3HO0A 5DZ0A 5HYKA 3OSIA 2QW4A 2HASA 3AX8A 1T7FA 3CWDA 4OKWA 1RKHA 1T76A 2Q1VA 5AAVB 5DZIA 3DZYD 1EREA 1OT7A 1UPVA 3B65A 3UUAA 2F4BA 1G1UA 2PIOA 2NW4A 3UVVA 4K7AA 1R1KA 3OOKA 2FAIA 4OC7A 3W0AA 5E0XA 2AX9A 3DCUA 5M96A 3HODA 3WFGA 3OLFA 3P88A 3X1IA 2VV0A 1BSXA 3KYTA 5DWEA 4HLWA 1SJ0A 5KCTA 4MGAA 3B1MA 2PIWA 3VTDA 3A2JA 2P7AA 1XP1A 5AYGA 3CTBA 2NV7A 2YJAB 3H0AD 5E1CA 3DY6A 5EC9A 3UP3A 5AZTA 2OAXA 2G0GA 3W5RA 1ILHA 5DY8A 5KCFA 3W0GA 4CI4A 4POJA 4MG8B 1XV9A 3VHVA 2G0HA 4S14A 2GPPA 5KRIA 2ZY0A 3VJIA 3VT9A 3ADSA 1X7JA 2R6WA 4FN9A 4G2HA 3GD2A 3AUQA 3OSWA 2J4AA 3GBKA 3E7CA 4XAOA 2ZK0A 4R06A 3PLZA 3A40X 1PDUA 3WGPA 1U3QA 5KRLA 3W5PA 3EYBA 3B68A 3ZRBA 2QGWA 4MG7A 1K7LA 3BC5A 3OZJA 3OAPA 3VT7A 4YMQA 4OIUA 5B41A 4XHDA 5DXGA 2Q60A 5KRAA 3B5RA 3A2HA 3H52A 2I4ZA 3DZYA 3FURA 1YINA 2ZL9A 4PXMA 4OLMA 2ABIA 4N8RA 1ZKYA 2XYJA 1YY4A 3W0HA 5E15A 3OKIA 5LGAA 4J5XA 4F9MA 1WM0X 3B66A 5DXRA 2P7ZA 3RLLA 2Q70A 4FHHA 2PIUA 5FQSA 5HYRA 4YT1A 4RZEA 1SKXA 2PRGA 1U3RA 2GTKA 2HCDA 3H0AA 3R8AA 3VT6A 3FALA 2PITA 3VI8A 4PLEA 5DXEA 5GICA 1FD0A 2O4JA 2Q61A 5AVLA 3W0YA 4DM8A 4OFRA 3D24A 5DVCA 1XLSE 2ZASA 3HM1A 4Q50A 5DXBB 3WWRA 2Q6JA 3R8DA 1KNUA 2HB8A 1OSVA 2HWRA 2QZOA 3Q95A 2ZK6A 5G45A 5H1EA 4DM6A 2AX6A 1L2IA 3B67A 2VV3A 2GP7A 3ET3A 1M2ZA 1T7RA 5FQPA 5DWLA 2Q59A 3O1EA 3L03A 3K6PA 3PCUA 3DZUD 1KKQA 3R8IA 1XB7A 1T7TA 5DZ1A 4XI3A 5DZHA 3VSOA 4DOSA 3HZFA 2Q7IA 2G44A 4OGHA 3D57A 3FEIA 4ITFA 3VRTA 2XKWA 5DTVA 2PNUA 5GIEA 2IOKA 4O8FA 1S19A 2QA8B 1NQ7A 2P54A 3RUTA 3WJ4A 4ZJRA 4ZNTA 5DWIA 5DLRA 5HZCA 2AA7A 3B0TA 4OHAA
chains in the Genus database with same CATH superfamily
5DIDA 3ADWA 4ZNSA 1RJKA 4IVYA 1FM9D 4Q13A 3VJHA 4MGAB 5JJMB 3OLSA 4MGDB 1YOWA 4N1YA 5GIDA 4QK4A 4IWFA 4J5WC 1GWQA 3VN2A 1NAVA 4OH5A 3V9YA 1XAPA 3ZR7A 3DR1A 5DV8A 3E00A 4K4JA 2ZNNA 2PIXA 4DK8A 1S0XA 3GYUA 1I7GA 1XP9A 3ZQTA 4DK7A 3JZCA 3UP0A 2VV4B 4ZO1X 2Q3YA 3X31A 2GPOA 3FEJA 1ZUCA 2ATHA 3WMHA 1VJBA 5DX3A 4TUZA 4PRGA 2HARA 3F5CB 4OKBA 4OK1A 2Q7JA 3ET0A 2HB7A 2J7XA 3ADXA 3CQVA 4OARA 1FM6D 2YLPA 2POGA 3L3ZA 1N4HA 5DI7A 3WT6A 2EWPA 3AN3A 2HFPA 4P6XA 1ZGYA 2NXXA 1XDKB 2NPAA 4OEYA 3WT5A 3FUGA 5EHJA 1SR7A 5JJMA 1T79A 3IXPA 3R2AA 3IPSA 2BJ4B 3OSAA 5HJSA 3WT7A 1Z95A 2Q7LA 1X78A 3OZ0A 2ZK5A 5FQRA 2P1TA 4YNKA 4YPQA 3W0JA 2P4YA 2YATA 5DYDA 3G0WA 2YLYA 5KRHA 4OJBA 3L3XA 2ZBSA 2AO6A 3P8XA 2VSTA 4WPFA 3IMYA 3WTQA 5KRJA 3V49A 1A28A 4L96A 5AK2A 5KYAA 4WHGA 3A9EA 2LBDA 2XYWA 3FS1A 3SP9A 1X7RA 5F9BA 5G3JA 1OVLB 1UHLB 2J14A 4E4KA 1P93A 4G1ZA 4HEEX 1YA3A 2V7CA 4IA7A 5HJPB 3KBAA 3UU7A 3AFRA 3L1BA 4ITEA 5JI0D 4RWVA 1YJEA 4RMDA 3VJTA 3PEQA 3VT5A 2PINA 4TV1A 5GT4A 1FM6A 4ZN9A 1I37A 1DB1A 4RZGA 3CS4A 3VT3A 1TXIA 1R20D 5DZ3A 1KV6A 3V4AA 3ET2A 1T74A 4OEZA 1XQCA 2BAWA 3RVFA 2YFEA 5DUHA 2QSEA 3VSPA 1E3KA 4DORA 5KR9A 3L0EA 1EXXA 1NRLA 5KRCA 5L7GA 3OS8C 1ZAFA 4P6WA 2GPUA 4QE6A 5APKA 2E2RA 3FC6A 2ZK1A 3KMZA 5E0WA 4CI5A 2AA6A 1MZNA 2O9IA 2Z4BA 1K4WA 4LSJA 1PZLA 2GWXA 4XTAA 4JYIA 2QE4A 4PF3A 2YHDA 3ILZA 4J5WA 4RFWA 4BCRA 4OJ9A 4MDDA 5IZ0A 3TKMA 5G43A 1FBYA 5C4OA 4PPPA 1ILGA 5DKBA 4IVWA 1FCXA 4JYGA 2P7GA 4RE8A 1NDEA 4UDBA 4ZNVA 3HQ5A 3W5TA 2Q1HA 5DXQA 4NIEA 2Q5PA 1PRGA 3MNPA 4MGBB 1NAXA 5JY3A 5KCDA 1DKFB 5DV3A 5DMCA 5DX3B 3OGTA 1T73A 1QKUA 1XQ3A 3AUNA 3OMKA 2G5OA 4OZTU 4A4VA 1R20A 3JZBA 3HLVA 3MNEA 5L11A 2JFAB 2Q6SA 3RLJA 3UUDB 3X1HA 1NUOA 2HBHA 3W5QA 4MG5A 1XLSA 5IAWA 2QR9A 1P8DA 2VV1A 3ADVA 5G42A 5C4SA 4OKTA 2OZ7A 3TY0A 5AAUA 1XVPB 5EI1A 2QTUA 3X36A 3G8OA 3R29A 5DK9A 3G9EA 4ONIA 3HC5A 4MG9A 5AAVA 3ERDA 2B1ZA 2J7YA 4LBDA 4S0SA 1SQNA 5ICKA 3UUAB 1N46A 2GL8A 3E94A 3PBAA 3VRWA 3UVVB 1ERRA 1UOMA 3SZ1A 4G20A 2ZK2A 2QXMA 5DUEA 1T63A 4M8HA 1U3SA 4REFA 3LMPA 5DXPA 5KRFA 3KWYA 4LTWA 5KYJA 5KCUA 4IA2A 5KCCA 3VT8A 2R6YA 5CJ6A 3VHUA 4RUJA 4OZRU 2ZMHA 2AM9A 3GWXA 5DKGA 5G5WA 4KZJA 2B1VA 3R5NA 4KZIA 4EM9A 4MG8A 5KD9A 3GWSX 1NQ1A 5ACCA 1XV9B 1YMTA 1YP0A 2HC4A 3LBDA 3WFFA 3AZ2A 4OH6A 4A2JA 3T03A 4S0TA 3VRUA 1MV9A 1X76A 2H79A 1YUCA 2I0GA 3D5FA 2HAMA 2PIPL 4JGVA 2ZXZA 2GIUA 4ZO1B 3SP6A 4WVDA 2ZLCA 3DZUA 4J26A 1L2JA 3ET1A 4IW6A 5DWJA 4EMAA 2HVCA 5DXMA 1YIMA 1XOWA 5C4UA 5APJA 4MG7B 5C4TA 1K74D 5ETHA 2VV2A 1RK3A 4IW8A 3KMRA 2W8YA 2ZK3A 4G1DA 1NYXA 4B7WA 1N83A 1E3GA 1XIUA 2P1UA 3ERTA 4OFUA 3WJ5A 2O4RA 2IOGA 3IA6A 1ZDTA 2QPYA 5SYZA 4UDCA 3FLIA 3ZRAA 1LV2A 3OMOA 4RAKA 4IQRA 2ZXMA 3FXVA 2I0JA 1FM9A 1M13A 3KMGA 1M7WA 2NXXE 4JL4A 4REEA 4X1GA 5DUGA 2AMAA 3P0UA 1LBDA 3FALB 5E19A 2REWA 3AZ1A 4PLDA 4ZJWA 3KFCA 5EGVA 2Z4JA 1G5YA 5DXBA 4R6SA 4OZTE 2ZNPA 5DKSA 2P15A 3Q95B 2QZOB 5DVVA 3CS8A 2V0VA 1FCZA 3BEJA 3VJSA 2XYXA 3B0QA 4PP5A 3RY9A 3VHWA 1Z5XU 1PQ6A 1ZEOA 1HJ1A 2Q59B 1YYEA 1S9QA 4NY9A 4PPSA 2B23A 2ZXNA 2ACLA 4QM0A 2Q5SA 3V3QA 1XJ7A 5KRMA 2OUZA 2ZNOA 5EITA 5DU5A 2AAXA 1K74A 4IWCA 4PP6A 1TFCA 1T5ZA 4NUFA 4MG9B 5E14A 3CDSA 1S0ZA 2YJDA 4MG6A 5KRKA 3OOFA 3KPZA 2PIRA 1ZDUA 2QA8A 5LWPA 5E7VA 3R5MA 3K23A 2OVMA 5FQVA 2H77A 3RUUA 3W0IA 3GN8A 3V3EA 4S15A 1R5KA 2PIQA 2ZNQA 4RUOX 1UPWA 2R40D 4MGDA 3S9SA 1IE8A 3K22A 5DV6A 1NHZA 5K13A 3QT0A 2OVHA 2ZKCA 3B3KA 4OZRE 5DIGA 4NQAB 3A78A 4Y29A 3CJWA 4JYHA 5G44A 3VTCA 1RDTD 1YOKA 2YLOA 4FHIA 4ZI1A 3W0CA 4IU7A 2A3IA 4XLDA 3VRVA 4OIVA 3VTBA 3HVLA 2VV4A 3L0JA 1U9EA 3CLDA 1A52A 3NSPA 4XT9A 1EXAA 1X7BA 2YLQA 2AMBA 4N5GA 4X1FA 2AXAA 3ADUA 2FVJA 3A3ZX 4IUIA 1ZH7A 1GWRA 2OM9A 4WLBA 4TUZB 3F5CA 5DRJA 3TX7B 3U9QA 4FNEA 4ZN7A 3OMMA 1PQCA 1PCGA 3CS6A 4ZOMA 2ZFXA 3OMPA 2HWQA 3IPQA 1G2NA 1G50A 4OKXA 4PWLA 1XDKA 1QKNA 4XUHA 4APUA 3TKCA 2VSRA 4OEAA 5L7EA 4E4QA 4LNXA 2BJ4A 5IXKA 3MNOA 3IPUA 3B0RA 2Q5GA 3VT4A 1PK5A 2QA6A 4ZNHA 3NSQA 2ZK4A 2AB2A 2POBA 4IV2A 4XUMA 1NQ2A 2R40A 4Q0AC 1T7MA 5G46A 4R2UA 4G1YA 1XPCA 3M7RA 2QGTA 2P1VA 3L0LA 1T65A 4QL8A 4A4WA 1PQ9A 2ZMJA 1RDTA 1Y0XX 3A9EB 1RKGA 2Q6RA 3E00D 4WHFA 1OVLA 1UHLA 2ZVTA 3V9VA 4RMCA 3NOAA 4G21A 4N73A 4UDDA 2QABA 1Y0SA 1GWXA 1Y9RA 5HJPA 3GZ9A 1QKMA 1GS4A 5DSHA 4ZNWA 1FCYA 3UU7B 2AX7A 1Z5XE 2QXSA 1X7EA 4MGCA 3O1DA 1XP6A 2AA5A 5I4VA 1H9UA 3K8SA 2ACLB 1OSHA 4TV1B 3DCTA 2OCFA 2XHSA 4FGYA 2GPVA 4OJ4A 1XZXX 3OLLA 4IV4A 4RMEA 3AZ3A 5DL4A 5L7HA 2B50A 2PKLA 2QMVA 4L98A 5HCVA 3A2IA 5DWGA 3D90A 4KZMA 3IXPD 3PRGA 3P89A 3OS8A 4M8EA 5DYBA 3UUCA 2ZLAA 3BQDA 5KCEA 3FC6B 3GYTA 2PJLA 3AN4A 5DVSA 1MVCA 2JJ3A 3AURA 4RUPA 5FQTA 4E2JA 4ZNUA 1HG4A 2AYRA 3OKHA 3PO9A 4K6IA 2QH6A 3V9TA 4CSJA 5KCWA 1XNNA 5AVIA 4PP3A 4QJRA 5DXKA 4UDAA 2FSZA 3KDUA 3N00A 1R1KD 4RZFA 3OMQA 4J5XC 4QE8A 4OILA 2AWHA 3KDTA 5DRMA 4DMAA 1S9PA 4MGBA 1Q4XA 1DKFA 4POHA 4PVUA 4IA3A 5B5BA 2Q8SA 4JAZA 2IHQA 4IS8A 5DP0A 4DQMA 4LNWA 3D6DA 3HC6A 2JF9A 2PIVA 4OEDA 4G2IA 5DIEA 5KROA 3G8IA 1XNXA 5AWJA 5DKEA 1R6GA 2I4PA 2JFAA 1NQ0A 1QKTA 3OS9A 3UUDA 5EJVA 2AA2A 4WQPA 5DMFA 2QNVA 1IE9A 5A86A 3CDPA 5AWKA 2AX8A 4IA1A 5AZVA 3F7DA 3B0WA 2ZMIA 5APHA 3DT3A 2VV1B 3ADTA 1XVPA 1I38A 4NB6A 2I4JA 4J24A 1I7IA 2Q7KA 3HO0A 5DZ0A 5HYKA 3OSIA 2QW4A 2HASA 3AX8A 1T7FA 3CWDA 4OKWA 1RKHA 1T76A 2Q1VA 5AAVB 5DZIA 3DZYD 1EREA 1OT7A 1UPVA 3B65A 3UUAA 2F4BA 1G1UA 2PIOA 2NW4A 3UVVA 4K7AA 1R1KA 3OOKA 2FAIA 4OC7A 3W0AA 5E0XA 2AX9A 3DCUA 5M96A 3HODA 3WFGA 3OLFA 3P88A 3X1IA 2VV0A 1BSXA 3KYTA 5DWEA 4HLWA 1SJ0A 5KCTA 4MGAA 3B1MA 2PIWA 3VTDA 3A2JA 2P7AA 1XP1A 5AYGA 3CTBA 2NV7A 2YJAB 3H0AD 5E1CA 3DY6A 5EC9A 3UP3A 5AZTA 2OAXA 2G0GA 3W5RA 1ILHA 5DY8A 5KCFA 3W0GA 4CI4A 4POJA 4MG8B 1XV9A 3VHVA 2G0HA 4S14A 2GPPA 5KRIA 2ZY0A 3VJIA 3VT9A 3ADSA 1X7JA 2R6WA 4FN9A 4G2HA 3GD2A 3AUQA 3OSWA 2J4AA 3GBKA 3E7CA 4XAOA 2ZK0A 4R06A 3PLZA 3A40X 1PDUA 3WGPA 1U3QA 5KRLA 3W5PA 3EYBA 3B68A 3ZRBA 2QGWA 4MG7A 1K7LA 3BC5A 3OZJA 3OAPA 3VT7A 4YMQA 4OIUA 5B41A 4XHDA 5DXGA 2Q60A 5KRAA 3B5RA 3A2HA 3H52A 2I4ZA 3DZYA 3FURA 1YINA 2ZL9A 4PXMA 4OLMA 2ABIA 4N8RA 1ZKYA 2XYJA 1YY4A 3W0HA 5E15A 3OKIA 5LGAA 4J5XA 4F9MA 1WM0X 3B66A 5DXRA 2P7ZA 3RLLA 2Q70A 4FHHA 2PIUA 5FQSA 5HYRA 4YT1A 4RZEA 1SKXA 2PRGA 1U3RA 2GTKA 2HCDA 3H0AA 3R8AA 3VT6A 3FALA 2PITA 3VI8A 4PLEA 5DXEA 5GICA 1FD0A 2O4JA 2Q61A 5AVLA 3W0YA 4DM8A 4OFRA 3D24A 5DVCA 1XLSE 2ZASA 3HM1A 4Q50A 5DXBB 3WWRA 2Q6JA 3R8DA 1KNUA 2HB8A 1OSVA 2HWRA 2QZOA 3Q95A 2ZK6A 5G45A 5H1EA 4DM6A 2AX6A 1L2IA 3B67A 2VV3A 2GP7A 3ET3A 1M2ZA 1T7RA 5FQPA 5DWLA 2Q59A 3O1EA 3L03A 3K6PA 3PCUA 3DZUD 1KKQA 3R8IA 1XB7A 1T7TA 5DZ1A 4XI3A 5DZHA 3VSOA 4DOSA 3HZFA 2Q7IA 2G44A 4OGHA 3D57A 3FEIA 4ITFA 3VRTA 2XKWA 5DTVA 2PNUA 5GIEA 2IOKA 4O8FA 1S19A 2QA8B 1NQ7A 2P54A 3RUTA 3WJ4A 4ZJRA 4ZNTA 5DWIA 5DLRA 5HZCA 2AA7A 3B0TA 4OHAA
chains in the Genus database with same CATH topology
5DIDA 3ADWA 4ZNSA 1RJKA 4IVYA 1FM9D 4Q13A 3VJHA 4MGAB 5JJMB 3OLSA 4MGDB 1YOWA 4N1YA 5GIDA 4QK4A 4IWFA 4J5WC 1GWQA 3VN2A 1NAVA 4OH5A 3V9YA 1XAPA 3ZR7A 3DR1A 5DV8A 3E00A 4K4JA 2ZNNA 2PIXA 4DK8A 1S0XA 3GYUA 1I7GA 1XP9A 3ZQTA 4DK7A 3JZCA 3UP0A 2VV4B 4ZO1X 2Q3YA 3X31A 2GPOA 3FEJA 1ZUCA 2ATHA 3WMHA 1VJBA 5DX3A 4TUZA 4PRGA 2HARA 3F5CB 4OKBA 4OK1A 2Q7JA 3ET0A 2HB7A 2J7XA 3ADXA 3CQVA 4OARA 1FM6D 2YLPA 2POGA 3L3ZA 1N4HA 5DI7A 3WT6A 2EWPA 3AN3A 2HFPA 4P6XA 1ZGYA 2NXXA 1XDKB 2NPAA 4OEYA 3WT5A 3FUGA 5EHJA 1SR7A 5JJMA 1T79A 3IXPA 3R2AA 3IPSA 2BJ4B 3OSAA 5HJSA 3WT7A 1Z95A 2Q7LA 1X78A 3OZ0A 2ZK5A 5FQRA 2P1TA 4YNKA 4YPQA 3W0JA 2P4YA 2YATA 5DYDA 3G0WA 2YLYA 5KRHA 4OJBA 3L3XA 2ZBSA 2AO6A 3P8XA 2VSTA 4WPFA 3IMYA 3WTQA 5KRJA 3V49A 1A28A 4L96A 5AK2A 5KYAA 4WHGA 3A9EA 2LBDA 2XYWA 3FS1A 3SP9A 1X7RA 5F9BA 5G3JA 1OVLB 1UHLB 2J14A 4E4KA 1P93A 4G1ZA 4HEEX 1YA3A 2V7CA 4IA7A 5HJPB 3KBAA 3UU7A 3AFRA 3L1BA 4ITEA 5JI0D 4RWVA 1YJEA 4RMDA 3VJTA 3PEQA 3VT5A 2PINA 4TV1A 5GT4A 1FM6A 4ZN9A 1I37A 1DB1A 4RZGA 3CS4A 3VT3A 1TXIA 1R20D 5DZ3A 1KV6A 3V4AA 3ET2A 1T74A 4OEZA 1XQCA 2BAWA 3RVFA 2YFEA 5DUHA 2QSEA 3VSPA 1E3KA 4DORA 5KR9A 3L0EA 1EXXA 1NRLA 5KRCA 5L7GA 3OS8C 1ZAFA 4P6WA 2GPUA 4QE6A 5APKA 2E2RA 3FC6A 2ZK1A 3KMZA 5E0WA 4CI5A 2AA6A 1MZNA 2O9IA 2Z4BA 1K4WA 4LSJA 1PZLA 2GWXA 4XTAA 4JYIA 2QE4A 4PF3A 2YHDA 3ILZA 4J5WA 4RFWA 4BCRA 4OJ9A 4MDDA 5IZ0A 3TKMA 5G43A 1FBYA 5C4OA 4PPPA 1ILGA 5DKBA 4IVWA 1FCXA 4JYGA 2P7GA 4RE8A 1NDEA 4UDBA 4ZNVA 3HQ5A 3W5TA 2Q1HA 5DXQA 4NIEA 2Q5PA 1PRGA 3MNPA 4MGBB 1NAXA 5JY3A 5KCDA 1DKFB 5DV3A 5DMCA 5DX3B 3OGTA 1T73A 1QKUA 1XQ3A 3AUNA 3OMKA 2G5OA 4OZTU 4A4VA 1R20A 3JZBA 3HLVA 3MNEA 5L11A 2JFAB 2Q6SA 3RLJA 3UUDB 3X1HA 1NUOA 2HBHA 3W5QA 4MG5A 1XLSA 5IAWA 2QR9A 1P8DA 2VV1A 3ADVA 5G42A 5C4SA 4OKTA 2OZ7A 3TY0A 5AAUA 1XVPB 5EI1A 2QTUA 3X36A 3G8OA 3R29A 5DK9A 3G9EA 4ONIA 3HC5A 4MG9A 5AAVA 3ERDA 2B1ZA 2J7YA 4LBDA 4S0SA 1SQNA 5ICKA 3UUAB 1N46A 2GL8A 3E94A 3PBAA 3VRWA 3UVVB 1ERRA 1UOMA 3SZ1A 4G20A 2ZK2A 2QXMA 5DUEA 1T63A 4M8HA 1U3SA 4REFA 3LMPA 5DXPA 5KRFA 3KWYA 4LTWA 5KYJA 5KCUA 4IA2A 5KCCA 3VT8A 2R6YA 5CJ6A 3VHUA 4RUJA 4OZRU 2ZMHA 2AM9A 3GWXA 5DKGA 5G5WA 4KZJA 2B1VA 3R5NA 4KZIA 4EM9A 4MG8A 5KD9A 3GWSX 1NQ1A 5ACCA 1XV9B 1YMTA 1YP0A 2HC4A 3LBDA 3WFFA 3AZ2A 4OH6A 4A2JA 3T03A 4S0TA 3VRUA 1MV9A 1X76A 2H79A 1YUCA 2I0GA 3D5FA 2HAMA 2PIPL 4JGVA 2ZXZA 2GIUA 4ZO1B 3SP6A 4WVDA 2ZLCA 3DZUA 4J26A 1L2JA 3ET1A 4IW6A 5DWJA 4EMAA 2HVCA 5DXMA 1YIMA 1XOWA 5C4UA 5APJA 4MG7B 5C4TA 1K74D 5ETHA 2VV2A 1RK3A 4IW8A 3KMRA 2W8YA 2ZK3A 4G1DA 1NYXA 4B7WA 1N83A 1E3GA 1XIUA 2P1UA 3ERTA 4OFUA 3WJ5A 2O4RA 2IOGA 3IA6A 1ZDTA 2QPYA 5SYZA 4UDCA 3FLIA 3ZRAA 1LV2A 3OMOA 4RAKA 4IQRA 2ZXMA 3FXVA 2I0JA 1FM9A 1M13A 3KMGA 1M7WA 2NXXE 4JL4A 4REEA 4X1GA 5DUGA 2AMAA 3P0UA 1LBDA 3FALB 5E19A 2REWA 3AZ1A 4PLDA 4ZJWA 3KFCA 5EGVA 2Z4JA 1G5YA 5DXBA 4R6SA 4OZTE 2ZNPA 5DKSA 2P15A 3Q95B 2QZOB 5DVVA 3CS8A 2V0VA 1FCZA 3BEJA 3VJSA 2XYXA 3B0QA 4PP5A 3RY9A 3VHWA 1Z5XU 1PQ6A 1ZEOA 1HJ1A 2Q59B 1YYEA 1S9QA 4NY9A 4PPSA 2B23A 2ZXNA 2ACLA 4QM0A 2Q5SA 3V3QA 1XJ7A 5KRMA 2OUZA 2ZNOA 5EITA 5DU5A 2AAXA 1K74A 4IWCA 4PP6A 1TFCA 1T5ZA 4NUFA 4MG9B 5E14A 3CDSA 1S0ZA 2YJDA 4MG6A 5KRKA 3OOFA 3KPZA 2PIRA 1ZDUA 2QA8A 5LWPA 5E7VA 3R5MA 3K23A 2OVMA 5FQVA 2H77A 3RUUA 3W0IA 3GN8A 3V3EA 4S15A 1R5KA 2PIQA 2ZNQA 4RUOX 1UPWA 2R40D 4MGDA 3S9SA 1IE8A 3K22A 5DV6A 1NHZA 5K13A 3QT0A 2OVHA 2ZKCA 3B3KA 4OZRE 5DIGA 4NQAB 3A78A 4Y29A 3CJWA 4JYHA 5G44A 3VTCA 1RDTD 1YOKA 2YLOA 4FHIA 4ZI1A 3W0CA 4IU7A 2A3IA 4XLDA 3VRVA 4OIVA 3VTBA 3HVLA 2VV4A 3L0JA 1U9EA 3CLDA 1A52A 3NSPA 4XT9A 1EXAA 1X7BA 2YLQA 2AMBA 4N5GA 4X1FA 2AXAA 3ADUA 2FVJA 3A3ZX 4IUIA 1ZH7A 1GWRA 2OM9A 4WLBA 4TUZB 3F5CA 5DRJA 3TX7B 3U9QA 4FNEA 4ZN7A 3OMMA 1PQCA 1PCGA 3CS6A 4ZOMA 2ZFXA 3OMPA 2HWQA 3IPQA 1G2NA 1G50A 4OKXA 4PWLA 1XDKA 1QKNA 4XUHA 4APUA 3TKCA 2VSRA 4OEAA 5L7EA 4E4QA 4LNXA 2BJ4A 5IXKA 3MNOA 3IPUA 3B0RA 2Q5GA 3VT4A 1PK5A 2QA6A 4ZNHA 3NSQA 2ZK4A 2AB2A 2POBA 4IV2A 4XUMA 1NQ2A 2R40A 4Q0AC 1T7MA 5G46A 4R2UA 4G1YA 1XPCA 3M7RA 2QGTA 2P1VA 3L0LA 1T65A 4QL8A 4A4WA 1PQ9A 2ZMJA 1RDTA 1Y0XX 3A9EB 1RKGA 2Q6RA 3E00D 4WHFA 1OVLA 1UHLA 2ZVTA 3V9VA 4RMCA 3NOAA 4G21A 4N73A 4UDDA 2QABA 1Y0SA 1GWXA 1Y9RA 5HJPA 3GZ9A 1QKMA 1GS4A 5DSHA 4ZNWA 1FCYA 3UU7B 2AX7A 1Z5XE 2QXSA 1X7EA 4MGCA 3O1DA 1XP6A 2AA5A 5I4VA 1H9UA 3K8SA 2ACLB 1OSHA 4TV1B 3DCTA 2OCFA 2XHSA 4FGYA 2GPVA 4OJ4A 1XZXX 3OLLA 4IV4A 4RMEA 3AZ3A 5DL4A 5L7HA 2B50A 2PKLA 2QMVA 4L98A 5HCVA 3A2IA 5DWGA 3D90A 4KZMA 3IXPD 3PRGA 3P89A 3OS8A 4M8EA 5DYBA 3UUCA 2ZLAA 3BQDA 5KCEA 3FC6B 3GYTA 2PJLA 3AN4A 5DVSA 1MVCA 2JJ3A 3AURA 4RUPA 5FQTA 4E2JA 4ZNUA 1HG4A 2AYRA 3OKHA 3PO9A 4K6IA 2QH6A 3V9TA 4CSJA 5KCWA 1XNNA 5AVIA 4PP3A 4QJRA 5DXKA 4UDAA 2FSZA 3KDUA 3N00A 1R1KD 4RZFA 3OMQA 4J5XC 4QE8A 4OILA 2AWHA 3KDTA 5DRMA 4DMAA 1S9PA 4MGBA 1Q4XA 1DKFA 4POHA 4PVUA 4IA3A 5B5BA 2Q8SA 4JAZA 2IHQA 4IS8A 5DP0A 4DQMA 4LNWA 3D6DA 3HC6A 2JF9A 2PIVA 4OEDA 4G2IA 5DIEA 5KROA 3G8IA 1XNXA 5AWJA 5DKEA 1R6GA 2I4PA 2JFAA 1NQ0A 1QKTA 3OS9A 3UUDA 5EJVA 2AA2A 4WQPA 5DMFA 2QNVA 1IE9A 5A86A 3CDPA 5AWKA 2AX8A 4IA1A 5AZVA 3F7DA 3B0WA 2ZMIA 5APHA 3DT3A 2VV1B 3ADTA 1XVPA 1I38A 4NB6A 2I4JA 4J24A 1I7IA 2Q7KA 3HO0A 5DZ0A 5HYKA 3OSIA 2QW4A 2HASA 3AX8A 1T7FA 3CWDA 4OKWA 1RKHA 1T76A 2Q1VA 5AAVB 5DZIA 3DZYD 1EREA 1OT7A 1UPVA 3B65A 3UUAA 2F4BA 1G1UA 2PIOA 2NW4A 3UVVA 4K7AA 1R1KA 3OOKA 2FAIA 4OC7A 3W0AA 5E0XA 2AX9A 3DCUA 5M96A 3HODA 3WFGA 3OLFA 3P88A 3X1IA 2VV0A 1BSXA 3KYTA 5DWEA 4HLWA 1SJ0A 5KCTA 4MGAA 3B1MA 2PIWA 3VTDA 3A2JA 2P7AA 1XP1A 5AYGA 3CTBA 2NV7A 2YJAB 3H0AD 5E1CA 3DY6A 5EC9A 3UP3A 5AZTA 2OAXA 2G0GA 3W5RA 1ILHA 5DY8A 5KCFA 3W0GA 4CI4A 4POJA 4MG8B 1XV9A 3VHVA 2G0HA 4S14A 2GPPA 5KRIA 2ZY0A 3VJIA 3VT9A 3ADSA 1X7JA 2R6WA 4FN9A 4G2HA 3GD2A 3AUQA 3OSWA 2J4AA 3GBKA 3E7CA 4XAOA 2ZK0A 4R06A 3PLZA 3A40X 1PDUA 3WGPA 1U3QA 5KRLA 3W5PA 3EYBA 3B68A 3ZRBA 2QGWA 4MG7A 1K7LA 3BC5A 3OZJA 3OAPA 3VT7A 4YMQA 4OIUA 5B41A 4XHDA 5DXGA 2Q60A 5KRAA 3B5RA 3A2HA 3H52A 2I4ZA 3DZYA 3FURA 1YINA 2ZL9A 4PXMA 4OLMA 2ABIA 4N8RA 1ZKYA 2XYJA 1YY4A 3W0HA 5E15A 3OKIA 5LGAA 4J5XA 4F9MA 1WM0X 3B66A 5DXRA 2P7ZA 3RLLA 2Q70A 4FHHA 2PIUA 5FQSA 5HYRA 4YT1A 4RZEA 1SKXA 2PRGA 1U3RA 2GTKA 2HCDA 3H0AA 3R8AA 3VT6A 3FALA 2PITA 3VI8A 4PLEA 5DXEA 5GICA 1FD0A 2O4JA 2Q61A 5AVLA 3W0YA 4DM8A 4OFRA 3D24A 5DVCA 1XLSE 2ZASA 3HM1A 4Q50A 5DXBB 3WWRA 2Q6JA 3R8DA 1KNUA 2HB8A 1OSVA 2HWRA 2QZOA 3Q95A 2ZK6A 5G45A 5H1EA 4DM6A 2AX6A 1L2IA 3B67A 2VV3A 2GP7A 3ET3A 1M2ZA 1T7RA 5FQPA 5DWLA 2Q59A 3O1EA 3L03A 3K6PA 3PCUA 3DZUD 1KKQA 3R8IA 1XB7A 1T7TA 5DZ1A 4XI3A 5DZHA 3VSOA 4DOSA 3HZFA 2Q7IA 2G44A 4OGHA 3D57A 3FEIA 4ITFA 3VRTA 2XKWA 5DTVA 2PNUA 5GIEA 2IOKA 4O8FA 1S19A 2QA8B 1NQ7A 2P54A 3RUTA 3WJ4A 4ZJRA 4ZNTA 5DWIA 5DLRA 5HZCA 2AA7A 3B0TA 4OHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DID A;  3ADW A;  4ZNS A;  1RJK A;  4IVY A;  1FM9 D;  4Q13 A;  3VJH A;  4MGA B;  5JJM B;  3OLS A;  4MGD B;  1YOW A;  4N1Y A;  5GID A;  4QK4 A;  4IWF A;  4J5W C;  1GWQ A;  3VN2 A;  1NAV A;  4OH5 A;  3V9Y A;  1XAP A;  3ZR7 A;  3DR1 A;  5DV8 A;  3E00 A;  4K4J A;  2ZNN A;  2PIX A;  4DK8 A;  1S0X A;  3GYU A;  1I7G A;  1XP9 A;  3ZQT A;  4DK7 A;  3JZC A;  3UP0 A;  2VV4 B;  4ZO1 X;  2Q3Y A;  3X31 A;  2GPO A;  3FEJ A;  1ZUC A;  2ATH A;  3WMH A;  1VJB A;  5DX3 A;  4TUZ A;  4PRG A;  2HAR A;  3F5C B;  4OKB A;  4OK1 A;  2Q7J A;  3ET0 A;  2HB7 A;  2J7X A;  3ADX A;  3CQV A;  4OAR A;  1FM6 D;  2YLP A;  2POG A;  3L3Z A;  1N4H A;  5DI7 A;  3WT6 A;  2EWP A;  3AN3 A;  2HFP A;  4P6X A;  1ZGY A;  2NXX A;  1XDK B;  2NPA A;  4OEY A;  3WT5 A;  3FUG A;  5EHJ A;  1SR7 A;  5JJM A;  1T79 A;  3IXP A;  3R2A A;  3IPS A;  2BJ4 B;  3OSA A;  5HJS A;  3WT7 A;  1Z95 A;  2Q7L A;  1X78 A;  3OZ0 A;  2ZK5 A;  5FQR A;  2P1T A;  4YNK A;  4YPQ A;  3W0J A;  2P4Y A;  2YAT A;  5DYD A;  3G0W A;  2YLY A;  5KRH A;  4OJB A;  3L3X A;  2ZBS A;  2AO6 A;  3P8X A;  2VST A;  4WPF A;  3IMY A;  3WTQ A;  5KRJ A;  3V49 A;  1A28 A;  4L96 A;  5AK2 A;  5KYA A;  4WHG A;  3A9E A;  2LBD A;  2XYW A;  3FS1 A;  3SP9 A;  1X7R A;  5F9B A;  5G3J A;  1OVL B;  1UHL B;  2J14 A;  4E4K A;  1P93 A;  4G1Z A;  4HEE X;  1YA3 A;  2V7C A;  4IA7 A;  5HJP B;  3KBA A;  3UU7 A;  3AFR A;  3L1B A;  4ITE A;  5JI0 D;  4RWV A;  1YJE A;  4RMD A;  3VJT A;  3PEQ A;  3VT5 A;  2PIN A;  4TV1 A;  5GT4 A;  1FM6 A;  4ZN9 A;  1I37 A;  1DB1 A;  4RZG A;  3CS4 A;  3VT3 A;  1TXI A;  1R20 D;  5DZ3 A;  1KV6 A;  3V4A A;  3ET2 A;  1T74 A;  4OEZ A;  1XQC A;  2BAW A;  3RVF A;  2YFE A;  5DUH A;  2QSE A;  3VSP A;  1E3K A;  4DOR A;  5KR9 A;  3L0E A;  1EXX A;  1NRL A;  5KRC A;  5L7G A;  3OS8 C;  1ZAF A;  4P6W A;  2GPU A;  4QE6 A;  5APK A;  2E2R A;  3FC6 A;  2ZK1 A;  3KMZ A;  5E0W A;  4CI5 A;  2AA6 A;  1MZN A;  2O9I A;  2Z4B A;  1K4W A;  4LSJ A;  1PZL A;  2GWX A;  4XTA A;  4JYI A;  2QE4 A;  4PF3 A;  2YHD A;  3ILZ A;  4J5W A;  4RFW A;  4BCR A;  4OJ9 A;  4MDD A;  5IZ0 A;  3TKM A;  5G43 A;  1FBY A;  5C4O A;  4PPP A;  1ILG A;  5DKB A;  4IVW A;  1FCX A;  4JYG A;  2P7G A;  4RE8 A;  1NDE A;  4UDB A;  4ZNV A;  3HQ5 A;  3W5T A;  2Q1H A;  5DXQ A;  4NIE A;  2Q5P A;  1PRG A;  3MNP A;  4MGB B;  1NAX A;  5JY3 A;  5KCD A;  1DKF B;  5DV3 A;  5DMC A;  5DX3 B;  3OGT A;  1T73 A;  1QKU A;  1XQ3 A;  3AUN A;  3OMK A;  2G5O A;  4OZT U;  4A4V A;  1R20 A;  3JZB A;  3HLV A;  3MNE A;  5L11 A;  2JFA B;  2Q6S A;  3RLJ A;  3UUD B;  3X1H A;  1NUO A;  2HBH A;  3W5Q A;  4MG5 A;  1XLS A;  5IAW A;  2QR9 A;  1P8D A;  2VV1 A;  3ADV A;  5G42 A;  5C4S A;  4OKT A;  2OZ7 A;  3TY0 A;  5AAU A;  1XVP B;  5EI1 A;  2QTU A;  3X36 A;  3G8O A;  3R29 A;  5DK9 A;  3G9E A;  4ONI A;  3HC5 A;  4MG9 A;  5AAV A;  3ERD A;  2B1Z A;  2J7Y A;  4LBD A;  4S0S A;  1SQN A;  5ICK A;  3UUA B;  1N46 A;  2GL8 A;  3E94 A;  3PBA A;  3VRW A;  3UVV B;  1ERR A;  1UOM A;  3SZ1 A;  4G20 A;  2ZK2 A;  2QXM A;  5DUE A;  1T63 A;  4M8H A;  1U3S A;  4REF A;  3LMP A;  5DXP A;  5KRF A;  3KWY A;  4LTW A;  5KYJ A;  5KCU A;  4IA2 A;  5KCC A;  3VT8 A;  2R6Y A;  5CJ6 A;  3VHU A;  4RUJ A;  4OZR U;  2ZMH A;  2AM9 A;  3GWX A;  5DKG A;  5G5W A;  4KZJ A;  2B1V A;  3R5N A;  4KZI A;  4EM9 A;  4MG8 A;  5KD9 A;  3GWS X;  1NQ1 A;  5ACC A;  1XV9 B;  1YMT A;  1YP0 A;  2HC4 A;  3LBD A;  3WFF A;  3AZ2 A;  4OH6 A;  4A2J A;  3T03 A;  4S0T A;  3VRU A;  1MV9 A;  1X76 A;  2H79 A;  1YUC A;  2I0G A;  3D5F A;  2HAM A;  2PIP L;  4JGV A;  2ZXZ A;  2GIU A;  4ZO1 B;  3SP6 A;  4WVD A;  2ZLC A;  3DZU A;  4J26 A;  1L2J A;  3ET1 A;  4IW6 A;  5DWJ A;  4EMA A;  2HVC A;  5DXM A;  1YIM A;  1XOW A;  5C4U A;  5APJ A;  4MG7 B;  5C4T A;  1K74 D;  5ETH A;  2VV2 A;  1RK3 A;  4IW8 A;  3KMR A;  2W8Y A;  2ZK3 A;  4G1D A;  1NYX A;  4B7W A;  1N83 A;  1E3G A;  1XIU A;  2P1U A;  3ERT A;  4OFU A;  3WJ5 A;  2O4R A;  2IOG A;  3IA6 A;  1ZDT A;  2QPY A;  5SYZ A;  4UDC A;  3FLI A;  3ZRA A;  1LV2 A;  3OMO A;  4RAK A;  4IQR A;  2ZXM A;  3FXV A;  2I0J A;  1FM9 A;  1M13 A;  3KMG A;  1M7W A;  2NXX E;  4JL4 A;  4REE A;  4X1G A;  5DUG A;  2AMA A;  3P0U A;  1LBD A;  3FAL B;  5E19 A;  2REW A;  3AZ1 A;  4PLD A;  4ZJW A;  3KFC A;  5EGV A;  2Z4J A;  1G5Y A;  5DXB A;  4R6S A;  4OZT E;  2ZNP A;  5DKS A;  2P15 A;  3Q95 B;  2QZO B;  5DVV A;  3CS8 A;  2V0V A;  1FCZ A;  3BEJ A;  3VJS A;  2XYX A;  3B0Q A;  4PP5 A;  3RY9 A;  3VHW A;  1Z5X U;  1PQ6 A;  1ZEO A;  1HJ1 A;  2Q59 B;  1YYE A;  1S9Q A;  4NY9 A;  4PPS A;  2B23 A;  2ZXN A;  2ACL A;  4QM0 A;  2Q5S A;  3V3Q A;  1XJ7 A;  5KRM A;  2OUZ A;  2ZNO A;  5EIT A;  5DU5 A;  2AAX A;  1K74 A;  4IWC A;  4PP6 A;  1TFC A;  1T5Z A;  4NUF A;  4MG9 B;  5E14 A;  3CDS A;  1S0Z A;  2YJD A;  4MG6 A;  5KRK A;  3OOF A;  3KPZ A;  2PIR A;  1ZDU A;  2QA8 A;  5LWP A;  5E7V A;  3R5M A;  3K23 A;  2OVM A;  5FQV A;  2H77 A;  3RUU A;  3W0I A;  3GN8 A;  3V3E A;  4S15 A;  1R5K A;  2PIQ A;  2ZNQ A;  4RUO X;  1UPW A;  2R40 D;  4MGD A;  3S9S A;  1IE8 A;  3K22 A;  5DV6 A;  1NHZ A;  5K13 A;  3QT0 A;  2OVH A;  2ZKC A;  3B3K A;  4OZR E;  5DIG A;  4NQA B;  3A78 A;  4Y29 A;  3CJW A;  4JYH A;  5G44 A;  3VTC A;  1RDT D;  1YOK A;  2YLO A;  4FHI A;  4ZI1 A;  3W0C A;  4IU7 A;  2A3I A;  4XLD A;  3VRV A;  4OIV A;  3VTB A;  3HVL A;  2VV4 A;  3L0J A;  1U9E A;  3CLD A;  1A52 A;  3NSP A;  4XT9 A;  1EXA A;  1X7B A;  2YLQ A;  2AMB A;  4N5G A;  4X1F A;  2AXA A;  3ADU A;  2FVJ A;  3A3Z X;  4IUI A;  1ZH7 A;  1GWR A;  2OM9 A;  4WLB A;  4TUZ B;  3F5C A;  5DRJ A;  3TX7 B;  3U9Q A;  4FNE A;  4ZN7 A;  3OMM A;  1PQC A;  1PCG A;  3CS6 A;  4ZOM A;  2ZFX A;  3OMP A;  2HWQ A;  3IPQ A;  1G2N A;  1G50 A;  4OKX A;  4PWL A;  1XDK A;  1QKN A;  4XUH A;  4APU A;  3TKC A;  2VSR A;  4OEA A;  5L7E A;  4E4Q A;  4LNX A;  2BJ4 A;  5IXK A;  3MNO A;  3IPU A;  3B0R A;  2Q5G A;  3VT4 A;  1PK5 A;  2QA6 A;  4ZNH A;  3NSQ A;  2ZK4 A;  2AB2 A;  2POB A;  4IV2 A;  4XUM A;  1NQ2 A;  2R40 A;  4Q0A C;  1T7M A;  5G46 A;  4R2U A;  4G1Y A;  1XPC A;  3M7R A;  2QGT A;  2P1V A;  3L0L A;  1T65 A;  4QL8 A;  4A4W A;  1PQ9 A;  2ZMJ A;  1RDT A;  1Y0X X;  3A9E B;  1RKG A;  2Q6R A;  3E00 D;  4WHF A;  1OVL A;  1UHL A;  2ZVT A;  3V9V A;  4RMC A;  3NOA A;  4G21 A;  4N73 A;  4UDD A;  2QAB A;  1Y0S A;  1GWX A;  1Y9R A;  5HJP A;  3GZ9 A;  1QKM A;  1GS4 A;  5DSH A;  4ZNW A;  1FCY A;  3UU7 B;  2AX7 A;  1Z5X E;  2QXS A;  1X7E A;  4MGC A;  3O1D A;  1XP6 A;  2AA5 A;  5I4V A;  1H9U A;  3K8S A;  2ACL B;  1OSH A;  4TV1 B;  3DCT A;  2OCF A;  2XHS A;  4FGY A;  2GPV A;  4OJ4 A;  1XZX X;  3OLL A;  4IV4 A;  4RME A;  3AZ3 A;  5DL4 A;  5L7H A;  2B50 A;  2PKL A;  2QMV A;  4L98 A;  5HCV A;  3A2I A;  5DWG A;  3D90 A;  4KZM A;  3IXP D;  3PRG A;  3P89 A;  3OS8 A;  4M8E A;  5DYB A;  3UUC A;  2ZLA A;  3BQD A;  5KCE A;  3FC6 B;  3GYT A;  2PJL A;  3AN4 A;  5DVS A;  1MVC A;  2JJ3 A;  3AUR A;  4RUP A;  5FQT A;  4E2J A;  4ZNU A;  1HG4 A;  2AYR A;  3OKH A;  3PO9 A;  4K6I A;  2QH6 A;  3V9T A;  4CSJ A;  5KCW A;  1XNN A;  5AVI A;  4PP3 A;  4QJR A;  5DXK A;  4UDA A;  2FSZ A;  3KDU A;  3N00 A;  1R1K D;  4RZF A;  3OMQ A;  4J5X C;  4QE8 A;  4OIL A;  2AWH A;  3KDT A;  5DRM A;  4DMA A;  1S9P A;  4MGB A;  1Q4X A;  1DKF A;  4POH A;  4PVU A;  4IA3 A;  5B5B A;  2Q8S A;  4JAZ A;  2IHQ A;  4IS8 A;  5DP0 A;  4DQM A;  4LNW A;  3D6D A;  3HC6 A;  2JF9 A;  2PIV A;  4OED A;  4G2I A;  5DIE A;  5KRO A;  3G8I A;  1XNX A;  5AWJ A;  5DKE A;  1R6G A;  2I4P A;  2JFA A;  1NQ0 A;  1QKT A;  3OS9 A;  3UUD A;  5EJV A;  2AA2 A;  4WQP A;  5DMF A;  2QNV A;  1IE9 A;  5A86 A;  3CDP A;  5AWK A;  2AX8 A;  4IA1 A;  5AZV A;  3F7D A;  3B0W A;  2ZMI A;  5APH A;  3DT3 A;  2VV1 B;  3ADT A;  1XVP A;  1I38 A;  4NB6 A;  2I4J A;  4J24 A;  1I7I A;  2Q7K A;  3HO0 A;  5DZ0 A;  5HYK A;  3OSI A;  2QW4 A;  2HAS A;  3AX8 A;  1T7F A;  3CWD A;  4OKW A;  1RKH A;  1T76 A;  2Q1V A;  5AAV B;  5DZI A;  3DZY D;  1ERE A;  1OT7 A;  1UPV A;  3B65 A;  3UUA A;  2F4B A;  1G1U A;  2PIO A;  2NW4 A;  3UVV A;  4K7A A;  1R1K A;  3OOK A;  2FAI A;  4OC7 A;  3W0A A;  5E0X A;  2AX9 A;  3DCU A;  5M96 A;  3HOD A;  3WFG A;  3OLF A;  3P88 A;  3X1I A;  2VV0 A;  1BSX A;  3KYT A;  5DWE A;  4HLW A;  1SJ0 A;  5KCT A;  4MGA A;  3B1M A;  2PIW A;  3VTD A;  3A2J A;  2P7A A;  1XP1 A;  5AYG A;  3CTB A;  2NV7 A;  2YJA B;  3H0A D;  5E1C A;  3DY6 A;  5EC9 A;  3UP3 A;  5AZT A;  2OAX A;  2G0G A;  3W5R A;  1ILH A;  5DY8 A;  5KCF A;  3W0G A;  4CI4 A;  4POJ A;  4MG8 B;  1XV9 A;  3VHV A;  2G0H A;  4S14 A;  2GPP A;  5KRI A;  2ZY0 A;  3VJI A;  3VT9 A;  3ADS A;  1X7J A;  2R6W A;  4FN9 A;  4G2H A;  3GD2 A;  3AUQ A;  3OSW A;  2J4A A;  3GBK A;  3E7C A;  4XAO A;  2ZK0 A;  4R06 A;  3PLZ A;  3A40 X;  1PDU A;  3WGP A;  1U3Q A;  5KRL A;  3W5P A;  3EYB A;  3B68 A;  3ZRB A;  2QGW A;  4MG7 A;  1K7L A;  3BC5 A;  3OZJ A;  3OAP A;  3VT7 A;  4YMQ A;  4OIU A;  5B41 A;  4XHD A;  5DXG A;  2Q60 A;  5KRA A;  3B5R A;  3A2H A;  3H52 A;  2I4Z A;  3DZY A;  3FUR A;  1YIN A;  2ZL9 A;  4PXM A;  4OLM A;  2ABI A;  4N8R A;  1ZKY A;  2XYJ A;  1YY4 A;  3W0H A;  5E15 A;  3OKI A;  5LGA A;  4J5X A;  4F9M A;  1WM0 X;  3B66 A;  5DXR A;  2P7Z A;  3RLL A;  2Q70 A;  4FHH A;  2PIU A;  5FQS A;  5HYR A;  4YT1 A;  4RZE A;  1SKX A;  2PRG A;  1U3R A;  2GTK A;  2HCD A;  3H0A A;  3R8A A;  3VT6 A;  3FAL A;  2PIT A;  3VI8 A;  4PLE A;  5DXE A;  5GIC A;  1FD0 A;  2O4J A;  2Q61 A;  5AVL A;  3W0Y A;  4DM8 A;  4OFR A;  3D24 A;  5DVC A;  1XLS E;  2ZAS A;  3HM1 A;  4Q50 A;  5DXB B;  3WWR A;  2Q6J A;  3R8D A;  1KNU A;  2HB8 A;  1OSV A;  2HWR A;  2QZO A;  3Q95 A;  2ZK6 A;  5G45 A;  5H1E A;  4DM6 A;  2AX6 A;  1L2I A;  3B67 A;  2VV3 A;  2GP7 A;  3ET3 A;  1M2Z A;  1T7R A;  5FQP A;  5DWL A;  2Q59 A;  3O1E A;  3L03 A;  3K6P A;  3PCU A;  3DZU D;  1KKQ A;  3R8I A;  1XB7 A;  1T7T A;  5DZ1 A;  4XI3 A;  5DZH A;  3VSO A;  4DOS A;  3HZF A;  2Q7I A;  2G44 A;  4OGH A;  3D57 A;  3FEI A;  4ITF A;  3VRT A;  2XKW A;  5DTV A;  2PNU A;  5GIE A;  2IOK A;  4O8F A;  1S19 A;  2QA8 B;  1NQ7 A;  2P54 A;  3RUT A;  3WJ4 A;  4ZJR A;  4ZNT A;  5DWI A;  5DLR A;  5HZC A;  2AA7 A;  3B0T A;  4OHA A; 
#chains in the Genus database with same CATH topology
 5DID A;  3ADW A;  4ZNS A;  1RJK A;  4IVY A;  1FM9 D;  4Q13 A;  3VJH A;  4MGA B;  5JJM B;  3OLS A;  4MGD B;  1YOW A;  4N1Y A;  5GID A;  4QK4 A;  4IWF A;  4J5W C;  1GWQ A;  3VN2 A;  1NAV A;  4OH5 A;  3V9Y A;  1XAP A;  3ZR7 A;  3DR1 A;  5DV8 A;  3E00 A;  4K4J A;  2ZNN A;  2PIX A;  4DK8 A;  1S0X A;  3GYU A;  1I7G A;  1XP9 A;  3ZQT A;  4DK7 A;  3JZC A;  3UP0 A;  2VV4 B;  4ZO1 X;  2Q3Y A;  3X31 A;  2GPO A;  3FEJ A;  1ZUC A;  2ATH A;  3WMH A;  1VJB A;  5DX3 A;  4TUZ A;  4PRG A;  2HAR A;  3F5C B;  4OKB A;  4OK1 A;  2Q7J A;  3ET0 A;  2HB7 A;  2J7X A;  3ADX A;  3CQV A;  4OAR A;  1FM6 D;  2YLP A;  2POG A;  3L3Z A;  1N4H A;  5DI7 A;  3WT6 A;  2EWP A;  3AN3 A;  2HFP A;  4P6X A;  1ZGY A;  2NXX A;  1XDK B;  2NPA A;  4OEY A;  3WT5 A;  3FUG A;  5EHJ A;  1SR7 A;  5JJM A;  1T79 A;  3IXP A;  3R2A A;  3IPS A;  2BJ4 B;  3OSA A;  5HJS A;  3WT7 A;  1Z95 A;  2Q7L A;  1X78 A;  3OZ0 A;  2ZK5 A;  5FQR A;  2P1T A;  4YNK A;  4YPQ A;  3W0J A;  2P4Y A;  2YAT A;  5DYD A;  3G0W A;  2YLY A;  5KRH A;  4OJB A;  3L3X A;  2ZBS A;  2AO6 A;  3P8X A;  2VST A;  4WPF A;  3IMY A;  3WTQ A;  5KRJ A;  3V49 A;  1A28 A;  4L96 A;  5AK2 A;  5KYA A;  4WHG A;  3A9E A;  2LBD A;  2XYW A;  3FS1 A;  3SP9 A;  1X7R A;  5F9B A;  5G3J A;  1OVL B;  1UHL B;  2J14 A;  4E4K A;  1P93 A;  4G1Z A;  4HEE X;  1YA3 A;  2V7C A;  4IA7 A;  5HJP B;  3KBA A;  3UU7 A;  3AFR A;  3L1B A;  4ITE A;  5JI0 D;  4RWV A;  1YJE A;  4RMD A;  3VJT A;  3PEQ A;  3VT5 A;  2PIN A;  4TV1 A;  5GT4 A;  1FM6 A;  4ZN9 A;  1I37 A;  1DB1 A;  4RZG A;  3CS4 A;  3VT3 A;  1TXI A;  1R20 D;  5DZ3 A;  1KV6 A;  3V4A A;  3ET2 A;  1T74 A;  4OEZ A;  1XQC A;  2BAW A;  3RVF A;  2YFE A;  5DUH A;  2QSE A;  3VSP A;  1E3K A;  4DOR A;  5KR9 A;  3L0E A;  1EXX A;  1NRL A;  5KRC A;  5L7G A;  3OS8 C;  1ZAF A;  4P6W A;  2GPU A;  4QE6 A;  5APK A;  2E2R A;  3FC6 A;  2ZK1 A;  3KMZ A;  5E0W A;  4CI5 A;  2AA6 A;  1MZN A;  2O9I A;  2Z4B A;  1K4W A;  4LSJ A;  1PZL A;  2GWX A;  4XTA A;  4JYI A;  2QE4 A;  4PF3 A;  2YHD A;  3ILZ A;  4J5W A;  4RFW A;  4BCR A;  4OJ9 A;  4MDD A;  5IZ0 A;  3TKM A;  5G43 A;  1FBY A;  5C4O A;  4PPP A;  1ILG A;  5DKB A;  4IVW A;  1FCX A;  4JYG A;  2P7G A;  4RE8 A;  1NDE A;  4UDB A;  4ZNV A;  3HQ5 A;  3W5T A;  2Q1H A;  5DXQ A;  4NIE A;  2Q5P A;  1PRG A;  3MNP A;  4MGB B;  1NAX A;  5JY3 A;  5KCD A;  1DKF B;  5DV3 A;  5DMC A;  5DX3 B;  3OGT A;  1T73 A;  1QKU A;  1XQ3 A;  3AUN A;  3OMK A;  2G5O A;  4OZT U;  4A4V A;  1R20 A;  3JZB A;  3HLV A;  3MNE A;  5L11 A;  2JFA B;  2Q6S A;  3RLJ A;  3UUD B;  3X1H A;  1NUO A;  2HBH A;  3W5Q A;  4MG5 A;  1XLS A;  5IAW A;  2QR9 A;  1P8D A;  2VV1 A;  3ADV A;  5G42 A;  5C4S A;  4OKT A;  2OZ7 A;  3TY0 A;  5AAU A;  1XVP B;  5EI1 A;  2QTU A;  3X36 A;  3G8O A;  3R29 A;  5DK9 A;  3G9E A;  4ONI A;  3HC5 A;  4MG9 A;  5AAV A;  3ERD A;  2B1Z A;  2J7Y A;  4LBD A;  4S0S A;  1SQN A;  5ICK A;  3UUA B;  1N46 A;  2GL8 A;  3E94 A;  3PBA A;  3VRW A;  3UVV B;  1ERR A;  1UOM A;  3SZ1 A;  4G20 A;  2ZK2 A;  2QXM A;  5DUE A;  1T63 A;  4M8H A;  1U3S A;  4REF A;  3LMP A;  5DXP A;  5KRF A;  3KWY A;  4LTW A;  5KYJ A;  5KCU A;  4IA2 A;  5KCC A;  3VT8 A;  2R6Y A;  5CJ6 A;  3VHU A;  4RUJ A;  4OZR U;  2ZMH A;  2AM9 A;  3GWX A;  5DKG A;  5G5W A;  4KZJ A;  2B1V A;  3R5N A;  4KZI A;  4EM9 A;  4MG8 A;  5KD9 A;  3GWS X;  1NQ1 A;  5ACC A;  1XV9 B;  1YMT A;  1YP0 A;  2HC4 A;  3LBD A;  3WFF A;  3AZ2 A;  4OH6 A;  4A2J A;  3T03 A;  4S0T A;  3VRU A;  1MV9 A;  1X76 A;  2H79 A;  1YUC A;  2I0G A;  3D5F A;  2HAM A;  2PIP L;  4JGV A;  2ZXZ A;  2GIU A;  4ZO1 B;  3SP6 A;  4WVD A;  2ZLC A;  3DZU A;  4J26 A;  1L2J A;  3ET1 A;  4IW6 A;  5DWJ A;  4EMA A;  2HVC A;  5DXM A;  1YIM A;  1XOW A;  5C4U A;  5APJ A;  4MG7 B;  5C4T A;  1K74 D;  5ETH A;  2VV2 A;  1RK3 A;  4IW8 A;  3KMR A;  2W8Y A;  2ZK3 A;  4G1D A;  1NYX A;  4B7W A;  1N83 A;  1E3G A;  1XIU A;  2P1U A;  3ERT A;  4OFU A;  3WJ5 A;  2O4R A;  2IOG A;  3IA6 A;  1ZDT A;  2QPY A;  5SYZ A;  4UDC A;  3FLI A;  3ZRA A;  1LV2 A;  3OMO A;  4RAK A;  4IQR A;  2ZXM A;  3FXV A;  2I0J A;  1FM9 A;  1M13 A;  3KMG A;  1M7W A;  2NXX E;  4JL4 A;  4REE A;  4X1G A;  5DUG A;  2AMA A;  3P0U A;  1LBD A;  3FAL B;  5E19 A;  2REW A;  3AZ1 A;  4PLD A;  4ZJW A;  3KFC A;  5EGV A;  2Z4J A;  1G5Y A;  5DXB A;  4R6S A;  4OZT E;  2ZNP A;  5DKS A;  2P15 A;  3Q95 B;  2QZO B;  5DVV A;  3CS8 A;  2V0V A;  1FCZ A;  3BEJ A;  3VJS A;  2XYX A;  3B0Q A;  4PP5 A;  3RY9 A;  3VHW A;  1Z5X U;  1PQ6 A;  1ZEO A;  1HJ1 A;  2Q59 B;  1YYE A;  1S9Q A;  4NY9 A;  4PPS A;  2B23 A;  2ZXN A;  2ACL A;  4QM0 A;  2Q5S A;  3V3Q A;  1XJ7 A;  5KRM A;  2OUZ A;  2ZNO A;  5EIT A;  5DU5 A;  2AAX A;  1K74 A;  4IWC A;  4PP6 A;  1TFC A;  1T5Z A;  4NUF A;  4MG9 B;  5E14 A;  3CDS A;  1S0Z A;  2YJD A;  4MG6 A;  5KRK A;  3OOF A;  3KPZ A;  2PIR A;  1ZDU A;  2QA8 A;  5LWP A;  5E7V A;  3R5M A;  3K23 A;  2OVM A;  5FQV A;  2H77 A;  3RUU A;  3W0I A;  3GN8 A;  3V3E A;  4S15 A;  1R5K A;  2PIQ A;  2ZNQ A;  4RUO X;  1UPW A;  2R40 D;  4MGD A;  3S9S A;  1IE8 A;  3K22 A;  5DV6 A;  1NHZ A;  5K13 A;  3QT0 A;  2OVH A;  2ZKC A;  3B3K A;  4OZR E;  5DIG A;  4NQA B;  3A78 A;  4Y29 A;  3CJW A;  4JYH A;  5G44 A;  3VTC A;  1RDT D;  1YOK A;  2YLO A;  4FHI A;  4ZI1 A;  3W0C A;  4IU7 A;  2A3I A;  4XLD A;  3VRV A;  4OIV A;  3VTB A;  3HVL A;  2VV4 A;  3L0J A;  1U9E A;  3CLD A;  1A52 A;  3NSP A;  4XT9 A;  1EXA A;  1X7B A;  2YLQ A;  2AMB A;  4N5G A;  4X1F A;  2AXA A;  3ADU A;  2FVJ A;  3A3Z X;  4IUI A;  1ZH7 A;  1GWR A;  2OM9 A;  4WLB A;  4TUZ B;  3F5C A;  5DRJ A;  3TX7 B;  3U9Q A;  4FNE A;  4ZN7 A;  3OMM A;  1PQC A;  1PCG A;  3CS6 A;  4ZOM A;  2ZFX A;  3OMP A;  2HWQ A;  3IPQ A;  1G2N A;  1G50 A;  4OKX A;  4PWL A;  1XDK A;  1QKN A;  4XUH A;  4APU A;  3TKC A;  2VSR A;  4OEA A;  5L7E A;  4E4Q A;  4LNX A;  2BJ4 A;  5IXK A;  3MNO A;  3IPU A;  3B0R A;  2Q5G A;  3VT4 A;  1PK5 A;  2QA6 A;  4ZNH A;  3NSQ A;  2ZK4 A;  2AB2 A;  2POB A;  4IV2 A;  4XUM A;  1NQ2 A;  2R40 A;  4Q0A C;  1T7M A;  5G46 A;  4R2U A;  4G1Y A;  1XPC A;  3M7R A;  2QGT A;  2P1V A;  3L0L A;  1T65 A;  4QL8 A;  4A4W A;  1PQ9 A;  2ZMJ A;  1RDT A;  1Y0X X;  3A9E B;  1RKG A;  2Q6R A;  3E00 D;  4WHF A;  1OVL A;  1UHL A;  2ZVT A;  3V9V A;  4RMC A;  3NOA A;  4G21 A;  4N73 A;  4UDD A;  2QAB A;  1Y0S A;  1GWX A;  1Y9R A;  5HJP A;  3GZ9 A;  1QKM A;  1GS4 A;  5DSH A;  4ZNW A;  1FCY A;  3UU7 B;  2AX7 A;  1Z5X E;  2QXS A;  1X7E A;  4MGC A;  3O1D A;  1XP6 A;  2AA5 A;  5I4V A;  1H9U A;  3K8S A;  2ACL B;  1OSH A;  4TV1 B;  3DCT A;  2OCF A;  2XHS A;  4FGY A;  2GPV A;  4OJ4 A;  1XZX X;  3OLL A;  4IV4 A;  4RME A;  3AZ3 A;  5DL4 A;  5L7H A;  2B50 A;  2PKL A;  2QMV A;  4L98 A;  5HCV A;  3A2I A;  5DWG A;  3D90 A;  4KZM A;  3IXP D;  3PRG A;  3P89 A;  3OS8 A;  4M8E A;  5DYB A;  3UUC A;  2ZLA A;  3BQD A;  5KCE A;  3FC6 B;  3GYT A;  2PJL A;  3AN4 A;  5DVS A;  1MVC A;  2JJ3 A;  3AUR A;  4RUP A;  5FQT A;  4E2J A;  4ZNU A;  1HG4 A;  2AYR A;  3OKH A;  3PO9 A;  4K6I A;  2QH6 A;  3V9T A;  4CSJ A;  5KCW A;  1XNN A;  5AVI A;  4PP3 A;  4QJR A;  5DXK A;  4UDA A;  2FSZ A;  3KDU A;  3N00 A;  1R1K D;  4RZF A;  3OMQ A;  4J5X C;  4QE8 A;  4OIL A;  2AWH A;  3KDT A;  5DRM A;  4DMA A;  1S9P A;  4MGB A;  1Q4X A;  1DKF A;  4POH A;  4PVU A;  4IA3 A;  5B5B A;  2Q8S A;  4JAZ A;  2IHQ A;  4IS8 A;  5DP0 A;  4DQM A;  4LNW A;  3D6D A;  3HC6 A;  2JF9 A;  2PIV A;  4OED A;  4G2I A;  5DIE A;  5KRO A;  3G8I A;  1XNX A;  5AWJ A;  5DKE A;  1R6G A;  2I4P A;  2JFA A;  1NQ0 A;  1QKT A;  3OS9 A;  3UUD A;  5EJV A;  2AA2 A;  4WQP A;  5DMF A;  2QNV A;  1IE9 A;  5A86 A;  3CDP A;  5AWK A;  2AX8 A;  4IA1 A;  5AZV A;  3F7D A;  3B0W A;  2ZMI A;  5APH A;  3DT3 A;  2VV1 B;  3ADT A;  1XVP A;  1I38 A;  4NB6 A;  2I4J A;  4J24 A;  1I7I A;  2Q7K A;  3HO0 A;  5DZ0 A;  5HYK A;  3OSI A;  2QW4 A;  2HAS A;  3AX8 A;  1T7F A;  3CWD A;  4OKW A;  1RKH A;  1T76 A;  2Q1V A;  5AAV B;  5DZI A;  3DZY D;  1ERE A;  1OT7 A;  1UPV A;  3B65 A;  3UUA A;  2F4B A;  1G1U A;  2PIO A;  2NW4 A;  3UVV A;  4K7A A;  1R1K A;  3OOK A;  2FAI A;  4OC7 A;  3W0A A;  5E0X A;  2AX9 A;  3DCU A;  5M96 A;  3HOD A;  3WFG A;  3OLF A;  3P88 A;  3X1I A;  2VV0 A;  1BSX A;  3KYT A;  5DWE A;  4HLW A;  1SJ0 A;  5KCT A;  4MGA A;  3B1M A;  2PIW A;  3VTD A;  3A2J A;  2P7A A;  1XP1 A;  5AYG A;  3CTB A;  2NV7 A;  2YJA B;  3H0A D;  5E1C A;  3DY6 A;  5EC9 A;  3UP3 A;  5AZT A;  2OAX A;  2G0G A;  3W5R A;  1ILH A;  5DY8 A;  5KCF A;  3W0G A;  4CI4 A;  4POJ A;  4MG8 B;  1XV9 A;  3VHV A;  2G0H A;  4S14 A;  2GPP A;  5KRI A;  2ZY0 A;  3VJI A;  3VT9 A;  3ADS A;  1X7J A;  2R6W A;  4FN9 A;  4G2H A;  3GD2 A;  3AUQ A;  3OSW A;  2J4A A;  3GBK A;  3E7C A;  4XAO A;  2ZK0 A;  4R06 A;  3PLZ A;  3A40 X;  1PDU A;  3WGP A;  1U3Q A;  5KRL A;  3W5P A;  3EYB A;  3B68 A;  3ZRB A;  2QGW A;  4MG7 A;  1K7L A;  3BC5 A;  3OZJ A;  3OAP A;  3VT7 A;  4YMQ A;  4OIU A;  5B41 A;  4XHD A;  5DXG A;  2Q60 A;  5KRA A;  3B5R A;  3A2H A;  3H52 A;  2I4Z A;  3DZY A;  3FUR A;  1YIN A;  2ZL9 A;  4PXM A;  4OLM A;  2ABI A;  4N8R A;  1ZKY A;  2XYJ A;  1YY4 A;  3W0H A;  5E15 A;  3OKI A;  5LGA A;  4J5X A;  4F9M A;  1WM0 X;  3B66 A;  5DXR A;  2P7Z A;  3RLL A;  2Q70 A;  4FHH A;  2PIU A;  5FQS A;  5HYR A;  4YT1 A;  4RZE A;  1SKX A;  2PRG A;  1U3R A;  2GTK A;  2HCD A;  3H0A A;  3R8A A;  3VT6 A;  3FAL A;  2PIT A;  3VI8 A;  4PLE A;  5DXE A;  5GIC A;  1FD0 A;  2O4J A;  2Q61 A;  5AVL A;  3W0Y A;  4DM8 A;  4OFR A;  3D24 A;  5DVC A;  1XLS E;  2ZAS A;  3HM1 A;  4Q50 A;  5DXB B;  3WWR A;  2Q6J A;  3R8D A;  1KNU A;  2HB8 A;  1OSV A;  2HWR A;  2QZO A;  3Q95 A;  2ZK6 A;  5G45 A;  5H1E A;  4DM6 A;  2AX6 A;  1L2I A;  3B67 A;  2VV3 A;  2GP7 A;  3ET3 A;  1M2Z A;  1T7R A;  5FQP A;  5DWL A;  2Q59 A;  3O1E A;  3L03 A;  3K6P A;  3PCU A;  3DZU D;  1KKQ A;  3R8I A;  1XB7 A;  1T7T A;  5DZ1 A;  4XI3 A;  5DZH A;  3VSO A;  4DOS A;  3HZF A;  2Q7I A;  2G44 A;  4OGH A;  3D57 A;  3FEI A;  4ITF A;  3VRT A;  2XKW A;  5DTV A;  2PNU A;  5GIE A;  2IOK A;  4O8F A;  1S19 A;  2QA8 B;  1NQ7 A;  2P54 A;  3RUT A;  3WJ4 A;  4ZJR A;  4ZNT A;  5DWI A;  5DLR A;  5HZC A;  2AA7 A;  3B0T A;  4OHA A; 
#chains in the Genus database with same CATH homology
 5DID A;  3ADW A;  4ZNS A;  1RJK A;  4IVY A;  1FM9 D;  4Q13 A;  3VJH A;  4MGA B;  5JJM B;  3OLS A;  4MGD B;  1YOW A;  4N1Y A;  5GID A;  4QK4 A;  4IWF A;  4J5W C;  1GWQ A;  3VN2 A;  1NAV A;  4OH5 A;  3V9Y A;  1XAP A;  3ZR7 A;  3DR1 A;  5DV8 A;  3E00 A;  4K4J A;  2ZNN A;  2PIX A;  4DK8 A;  1S0X A;  3GYU A;  1I7G A;  1XP9 A;  3ZQT A;  4DK7 A;  3JZC A;  3UP0 A;  2VV4 B;  4ZO1 X;  2Q3Y A;  3X31 A;  2GPO A;  3FEJ A;  1ZUC A;  2ATH A;  3WMH A;  1VJB A;  5DX3 A;  4TUZ A;  4PRG A;  2HAR A;  3F5C B;  4OKB A;  4OK1 A;  2Q7J A;  3ET0 A;  2HB7 A;  2J7X A;  3ADX A;  3CQV A;  4OAR A;  1FM6 D;  2YLP A;  2POG A;  3L3Z A;  1N4H A;  5DI7 A;  3WT6 A;  2EWP A;  3AN3 A;  2HFP A;  4P6X A;  1ZGY A;  2NXX A;  1XDK B;  2NPA A;  4OEY A;  3WT5 A;  3FUG A;  5EHJ A;  1SR7 A;  5JJM A;  1T79 A;  3IXP A;  3R2A A;  3IPS A;  2BJ4 B;  3OSA A;  5HJS A;  3WT7 A;  1Z95 A;  2Q7L A;  1X78 A;  3OZ0 A;  2ZK5 A;  5FQR A;  2P1T A;  4YNK A;  4YPQ A;  3W0J A;  2P4Y A;  2YAT A;  5DYD A;  3G0W A;  2YLY A;  5KRH A;  4OJB A;  3L3X A;  2ZBS A;  2AO6 A;  3P8X A;  2VST A;  4WPF A;  3IMY A;  3WTQ A;  5KRJ A;  3V49 A;  1A28 A;  4L96 A;  5AK2 A;  5KYA A;  4WHG A;  3A9E A;  2LBD A;  2XYW A;  3FS1 A;  3SP9 A;  1X7R A;  5F9B A;  5G3J A;  1OVL B;  1UHL B;  2J14 A;  4E4K A;  1P93 A;  4G1Z A;  4HEE X;  1YA3 A;  2V7C A;  4IA7 A;  5HJP B;  3KBA A;  3UU7 A;  3AFR A;  3L1B A;  4ITE A;  5JI0 D;  4RWV A;  1YJE A;  4RMD A;  3VJT A;  3PEQ A;  3VT5 A;  2PIN A;  4TV1 A;  5GT4 A;  1FM6 A;  4ZN9 A;  1I37 A;  1DB1 A;  4RZG A;  3CS4 A;  3VT3 A;  1TXI A;  1R20 D;  5DZ3 A;  1KV6 A;  3V4A A;  3ET2 A;  1T74 A;  4OEZ A;  1XQC A;  2BAW A;  3RVF A;  2YFE A;  5DUH A;  2QSE A;  3VSP A;  1E3K A;  4DOR A;  5KR9 A;  3L0E A;  1EXX A;  1NRL A;  5KRC A;  5L7G A;  3OS8 C;  1ZAF A;  4P6W A;  2GPU A;  4QE6 A;  5APK A;  2E2R A;  3FC6 A;  2ZK1 A;  3KMZ A;  5E0W A;  4CI5 A;  2AA6 A;  1MZN A;  2O9I A;  2Z4B A;  1K4W A;  4LSJ A;  1PZL A;  2GWX A;  4XTA A;  4JYI A;  2QE4 A;  4PF3 A;  2YHD A;  3ILZ A;  4J5W A;  4RFW A;  4BCR A;  4OJ9 A;  4MDD A;  5IZ0 A;  3TKM A;  5G43 A;  1FBY A;  5C4O A;  4PPP A;  1ILG A;  5DKB A;  4IVW A;  1FCX A;  4JYG A;  2P7G A;  4RE8 A;  1NDE A;  4UDB A;  4ZNV A;  3HQ5 A;  3W5T A;  2Q1H A;  5DXQ A;  4NIE A;  2Q5P A;  1PRG A;  3MNP A;  4MGB B;  1NAX A;  5JY3 A;  5KCD A;  1DKF B;  5DV3 A;  5DMC A;  5DX3 B;  3OGT A;  1T73 A;  1QKU A;  1XQ3 A;  3AUN A;  3OMK A;  2G5O A;  4OZT U;  4A4V A;  1R20 A;  3JZB A;  3HLV A;  3MNE A;  5L11 A;  2JFA B;  2Q6S A;  3RLJ A;  3UUD B;  3X1H A;  1NUO A;  2HBH A;  3W5Q A;  4MG5 A;  1XLS A;  5IAW A;  2QR9 A;  1P8D A;  2VV1 A;  3ADV A;  5G42 A;  5C4S A;  4OKT A;  2OZ7 A;  3TY0 A;  5AAU A;  1XVP B;  5EI1 A;  2QTU A;  3X36 A;  3G8O A;  3R29 A;  5DK9 A;  3G9E A;  4ONI A;  3HC5 A;  4MG9 A;  5AAV A;  3ERD A;  2B1Z A;  2J7Y A;  4LBD A;  4S0S A;  1SQN A;  5ICK A;  3UUA B;  1N46 A;  2GL8 A;  3E94 A;  3PBA A;  3VRW A;  3UVV B;  1ERR A;  1UOM A;  3SZ1 A;  4G20 A;  2ZK2 A;  2QXM A;  5DUE A;  1T63 A;  4M8H A;  1U3S A;  4REF A;  3LMP A;  5DXP A;  5KRF A;  3KWY A;  4LTW A;  5KYJ A;  5KCU A;  4IA2 A;  5KCC A;  3VT8 A;  2R6Y A;  5CJ6 A;  3VHU A;  4RUJ A;  4OZR U;  2ZMH A;  2AM9 A;  3GWX A;  5DKG A;  5G5W A;  4KZJ A;  2B1V A;  3R5N A;  4KZI A;  4EM9 A;  4MG8 A;  5KD9 A;  3GWS X;  1NQ1 A;  5ACC A;  1XV9 B;  1YMT A;  1YP0 A;  2HC4 A;  3LBD A;  3WFF A;  3AZ2 A;  4OH6 A;  4A2J A;  3T03 A;  4S0T A;  3VRU A;  1MV9 A;  1X76 A;  2H79 A;  1YUC A;  2I0G A;  3D5F A;  2HAM A;  2PIP L;  4JGV A;  2ZXZ A;  2GIU A;  4ZO1 B;  3SP6 A;  4WVD A;  2ZLC A;  3DZU A;  4J26 A;  1L2J A;  3ET1 A;  4IW6 A;  5DWJ A;  4EMA A;  2HVC A;  5DXM A;  1YIM A;  1XOW A;  5C4U A;  5APJ A;  4MG7 B;  5C4T A;  1K74 D;  5ETH A;  2VV2 A;  1RK3 A;  4IW8 A;  3KMR A;  2W8Y A;  2ZK3 A;  4G1D A;  1NYX A;  4B7W A;  1N83 A;  1E3G A;  1XIU A;  2P1U A;  3ERT A;  4OFU A;  3WJ5 A;  2O4R A;  2IOG A;  3IA6 A;  1ZDT A;  2QPY A;  5SYZ A;  4UDC A;  3FLI A;  3ZRA A;  1LV2 A;  3OMO A;  4RAK A;  4IQR A;  2ZXM A;  3FXV A;  2I0J A;  1FM9 A;  1M13 A;  3KMG A;  1M7W A;  2NXX E;  4JL4 A;  4REE A;  4X1G A;  5DUG A;  2AMA A;  3P0U A;  1LBD A;  3FAL B;  5E19 A;  2REW A;  3AZ1 A;  4PLD A;  4ZJW A;  3KFC A;  5EGV A;  2Z4J A;  1G5Y A;  5DXB A;  4R6S A;  4OZT E;  2ZNP A;  5DKS A;  2P15 A;  3Q95 B;  2QZO B;  5DVV A;  3CS8 A;  2V0V A;  1FCZ A;  3BEJ A;  3VJS A;  2XYX A;  3B0Q A;  4PP5 A;  3RY9 A;  3VHW A;  1Z5X U;  1PQ6 A;  1ZEO A;  1HJ1 A;  2Q59 B;  1YYE A;  1S9Q A;  4NY9 A;  4PPS A;  2B23 A;  2ZXN A;  2ACL A;  4QM0 A;  2Q5S A;  3V3Q A;  1XJ7 A;  5KRM A;  2OUZ A;  2ZNO A;  5EIT A;  5DU5 A;  2AAX A;  1K74 A;  4IWC A;  4PP6 A;  1TFC A;  1T5Z A;  4NUF A;  4MG9 B;  5E14 A;  3CDS A;  1S0Z A;  2YJD A;  4MG6 A;  5KRK A;  3OOF A;  3KPZ A;  2PIR A;  1ZDU A;  2QA8 A;  5LWP A;  5E7V A;  3R5M A;  3K23 A;  2OVM A;  5FQV A;  2H77 A;  3RUU A;  3W0I A;  3GN8 A;  3V3E A;  4S15 A;  1R5K A;  2PIQ A;  2ZNQ A;  4RUO X;  1UPW A;  2R40 D;  4MGD A;  3S9S A;  1IE8 A;  3K22 A;  5DV6 A;  1NHZ A;  5K13 A;  3QT0 A;  2OVH A;  2ZKC A;  3B3K A;  4OZR E;  5DIG A;  4NQA B;  3A78 A;  4Y29 A;  3CJW A;  4JYH A;  5G44 A;  3VTC A;  1RDT D;  1YOK A;  2YLO A;  4FHI A;  4ZI1 A;  3W0C A;  4IU7 A;  2A3I A;  4XLD A;  3VRV A;  4OIV A;  3VTB A;  3HVL A;  2VV4 A;  3L0J A;  1U9E A;  3CLD A;  1A52 A;  3NSP A;  4XT9 A;  1EXA A;  1X7B A;  2YLQ A;  2AMB A;  4N5G A;  4X1F A;  2AXA A;  3ADU A;  2FVJ A;  3A3Z X;  4IUI A;  1ZH7 A;  1GWR A;  2OM9 A;  4WLB A;  4TUZ B;  3F5C A;  5DRJ A;  3TX7 B;  3U9Q A;  4FNE A;  4ZN7 A;  3OMM A;  1PQC A;  1PCG A;  3CS6 A;  4ZOM A;  2ZFX A;  3OMP A;  2HWQ A;  3IPQ A;  1G2N A;  1G50 A;  4OKX A;  4PWL A;  1XDK A;  1QKN A;  4XUH A;  4APU A;  3TKC A;  2VSR A;  4OEA A;  5L7E A;  4E4Q A;  4LNX A;  2BJ4 A;  5IXK A;  3MNO A;  3IPU A;  3B0R A;  2Q5G A;  3VT4 A;  1PK5 A;  2QA6 A;  4ZNH A;  3NSQ A;  2ZK4 A;  2AB2 A;  2POB A;  4IV2 A;  4XUM A;  1NQ2 A;  2R40 A;  4Q0A C;  1T7M A;  5G46 A;  4R2U A;  4G1Y A;  1XPC A;  3M7R A;  2QGT A;  2P1V A;  3L0L A;  1T65 A;  4QL8 A;  4A4W A;  1PQ9 A;  2ZMJ A;  1RDT A;  1Y0X X;  3A9E B;  1RKG A;  2Q6R A;  3E00 D;  4WHF A;  1OVL A;  1UHL A;  2ZVT A;  3V9V A;  4RMC A;  3NOA A;  4G21 A;  4N73 A;  4UDD A;  2QAB A;  1Y0S A;  1GWX A;  1Y9R A;  5HJP A;  3GZ9 A;  1QKM A;  1GS4 A;  5DSH A;  4ZNW A;  1FCY A;  3UU7 B;  2AX7 A;  1Z5X E;  2QXS A;  1X7E A;  4MGC A;  3O1D A;  1XP6 A;  2AA5 A;  5I4V A;  1H9U A;  3K8S A;  2ACL B;  1OSH A;  4TV1 B;  3DCT A;  2OCF A;  2XHS A;  4FGY A;  2GPV A;  4OJ4 A;  1XZX X;  3OLL A;  4IV4 A;  4RME A;  3AZ3 A;  5DL4 A;  5L7H A;  2B50 A;  2PKL A;  2QMV A;  4L98 A;  5HCV A;  3A2I A;  5DWG A;  3D90 A;  4KZM A;  3IXP D;  3PRG A;  3P89 A;  3OS8 A;  4M8E A;  5DYB A;  3UUC A;  2ZLA A;  3BQD A;  5KCE A;  3FC6 B;  3GYT A;  2PJL A;  3AN4 A;  5DVS A;  1MVC A;  2JJ3 A;  3AUR A;  4RUP A;  5FQT A;  4E2J A;  4ZNU A;  1HG4 A;  2AYR A;  3OKH A;  3PO9 A;  4K6I A;  2QH6 A;  3V9T A;  4CSJ A;  5KCW A;  1XNN A;  5AVI A;  4PP3 A;  4QJR A;  5DXK A;  4UDA A;  2FSZ A;  3KDU A;  3N00 A;  1R1K D;  4RZF A;  3OMQ A;  4J5X C;  4QE8 A;  4OIL A;  2AWH A;  3KDT A;  5DRM A;  4DMA A;  1S9P A;  4MGB A;  1Q4X A;  1DKF A;  4POH A;  4PVU A;  4IA3 A;  5B5B A;  2Q8S A;  4JAZ A;  2IHQ A;  4IS8 A;  5DP0 A;  4DQM A;  4LNW A;  3D6D A;  3HC6 A;  2JF9 A;  2PIV A;  4OED A;  4G2I A;  5DIE A;  5KRO A;  3G8I A;  1XNX A;  5AWJ A;  5DKE A;  1R6G A;  2I4P A;  2JFA A;  1NQ0 A;  1QKT A;  3OS9 A;  3UUD A;  5EJV A;  2AA2 A;  4WQP A;  5DMF A;  2QNV A;  1IE9 A;  5A86 A;  3CDP A;  5AWK A;  2AX8 A;  4IA1 A;  5AZV A;  3F7D A;  3B0W A;  2ZMI A;  5APH A;  3DT3 A;  2VV1 B;  3ADT A;  1XVP A;  1I38 A;  4NB6 A;  2I4J A;  4J24 A;  1I7I A;  2Q7K A;  3HO0 A;  5DZ0 A;  5HYK A;  3OSI A;  2QW4 A;  2HAS A;  3AX8 A;  1T7F A;  3CWD A;  4OKW A;  1RKH A;  1T76 A;  2Q1V A;  5AAV B;  5DZI A;  3DZY D;  1ERE A;  1OT7 A;  1UPV A;  3B65 A;  3UUA A;  2F4B A;  1G1U A;  2PIO A;  2NW4 A;  3UVV A;  4K7A A;  1R1K A;  3OOK A;  2FAI A;  4OC7 A;  3W0A A;  5E0X A;  2AX9 A;  3DCU A;  5M96 A;  3HOD A;  3WFG A;  3OLF A;  3P88 A;  3X1I A;  2VV0 A;  1BSX A;  3KYT A;  5DWE A;  4HLW A;  1SJ0 A;  5KCT A;  4MGA A;  3B1M A;  2PIW A;  3VTD A;  3A2J A;  2P7A A;  1XP1 A;  5AYG A;  3CTB A;  2NV7 A;  2YJA B;  3H0A D;  5E1C A;  3DY6 A;  5EC9 A;  3UP3 A;  5AZT A;  2OAX A;  2G0G A;  3W5R A;  1ILH A;  5DY8 A;  5KCF A;  3W0G A;  4CI4 A;  4POJ A;  4MG8 B;  1XV9 A;  3VHV A;  2G0H A;  4S14 A;  2GPP A;  5KRI A;  2ZY0 A;  3VJI A;  3VT9 A;  3ADS A;  1X7J A;  2R6W A;  4FN9 A;  4G2H A;  3GD2 A;  3AUQ A;  3OSW A;  2J4A A;  3GBK A;  3E7C A;  4XAO A;  2ZK0 A;  4R06 A;  3PLZ A;  3A40 X;  1PDU A;  3WGP A;  1U3Q A;  5KRL A;  3W5P A;  3EYB A;  3B68 A;  3ZRB A;  2QGW A;  4MG7 A;  1K7L A;  3BC5 A;  3OZJ A;  3OAP A;  3VT7 A;  4YMQ A;  4OIU A;  5B41 A;  4XHD A;  5DXG A;  2Q60 A;  5KRA A;  3B5R A;  3A2H A;  3H52 A;  2I4Z A;  3DZY A;  3FUR A;  1YIN A;  2ZL9 A;  4PXM A;  4OLM A;  2ABI A;  4N8R A;  1ZKY A;  2XYJ A;  1YY4 A;  3W0H A;  5E15 A;  3OKI A;  5LGA A;  4J5X A;  4F9M A;  1WM0 X;  3B66 A;  5DXR A;  2P7Z A;  3RLL A;  2Q70 A;  4FHH A;  2PIU A;  5FQS A;  5HYR A;  4YT1 A;  4RZE A;  1SKX A;  2PRG A;  1U3R A;  2GTK A;  2HCD A;  3H0A A;  3R8A A;  3VT6 A;  3FAL A;  2PIT A;  3VI8 A;  4PLE A;  5DXE A;  5GIC A;  1FD0 A;  2O4J A;  2Q61 A;  5AVL A;  3W0Y A;  4DM8 A;  4OFR A;  3D24 A;  5DVC A;  1XLS E;  2ZAS A;  3HM1 A;  4Q50 A;  5DXB B;  3WWR A;  2Q6J A;  3R8D A;  1KNU A;  2HB8 A;  1OSV A;  2HWR A;  2QZO A;  3Q95 A;  2ZK6 A;  5G45 A;  5H1E A;  4DM6 A;  2AX6 A;  1L2I A;  3B67 A;  2VV3 A;  2GP7 A;  3ET3 A;  1M2Z A;  1T7R A;  5FQP A;  5DWL A;  2Q59 A;  3O1E A;  3L03 A;  3K6P A;  3PCU A;  3DZU D;  1KKQ A;  3R8I A;  1XB7 A;  1T7T A;  5DZ1 A;  4XI3 A;  5DZH A;  3VSO A;  4DOS A;  3HZF A;  2Q7I A;  2G44 A;  4OGH A;  3D57 A;  3FEI A;  4ITF A;  3VRT A;  2XKW A;  5DTV A;  2PNU A;  5GIE A;  2IOK A;  4O8F A;  1S19 A;  2QA8 B;  1NQ7 A;  2P54 A;  3RUT A;  3WJ4 A;  4ZJR A;  4ZNT A;  5DWI A;  5DLR A;  5HZC A;  2AA7 A;  3B0T A;  4OHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...