4XI3A

Estrogen receptor alpha ligand binding domain in complex with bazedoxifene
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
240
structure length
230
Chain Sequence
LALSLTADQMVSALLDAEPPILYSEYDPSMMGLLTNLADRELVHMINWAKRVPGFVDLTSHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPSYDLLLEMLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biochemical and Structural Basis for Constitutive Activity and Reduced SERM Potency in Acquired SERM/AI Resistant Metastatic Breast Cancers via ESR1 Somatic Mutation
rcsb
molecule keywords Estrogen receptor
molecule tags Signaling protein
source organism Homo sapiens
total genus 82
structure length 230
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4xi3A00
3DZUD 4RZGA 5KRIA 5GICA 2QMVA 1T74A 4IW6A 5E0XA 4HLWA 4LNXA 4Q0AC 2G0HA 2QGWA 2ZNPA 4L98A 5DV8A 2ZLCA 3W0JA 2YHDA 3CS6A 4MG9A 2BJ4B 1PDUA 2FVJA 1G50A 1PK5A 3HVLA 1T76A 2Q59A 3KYTA 1N4HA 1XP9A 3FUGA 2ZKCA 2A3IA 5DU5A 5AZTA 3TKMA 1P93A 3D5FA 1QKMA 5KCEA 4TUZA 3VJTA 4MDDA 5DRJA 5DVCA 3VJIA 1HG4A 5DIEA 4RZFA 3IMYA 2EWPA 4E2JA 1PQ9A 1T7TA 5G45A 5ICKA 3ADWA 3V49A 4FNEA 4G1YA 4TV1B 5KCTA 3KMGA 5KCUA 2ZK3A 3SP6A 3O1DA 1NRLA 4FHHA 1R1KA 5DXQA 3VSOA 1M2ZA 3ILZA 1ILHA 2AA6A 5DK9A 3UUAA 2AX8A 2I0JA 5DWLA 3VTDA 5APHA 3ZR7A 3MNPA 1T5ZA 3OS8A 4ITEA 2ZXMA 4NIEA 1PRGA 5DWJA 3NOAA 1NHZA 4NQAB 3VHWA 1E3GA 4J5XA 4QJRA 2ACLA 5KCCA 3ET0A 3W5TA 2YFEA 4PPSA 2QW4A 4ZNVA 3B3KA 3DT3A 3OSAA 1YP0A 2XYWA 2OVMA 2Q8SA 5DWIA 4APUA 4LTWA 2OCFA 5ACCA 2HBHA 5DUGA 4ZO1B 2YLYA 4NUFA 1T7FA 2QZOA 4WQPA 4XT9A 5L7HA 2ZMJA 1ZUCA 3GWSX 2GPOA 1RKGA 1EXXA 4WHGA 4OILA 4XUMA 3CQVA 4QL8A 3UUDA 3UU7A 2PINA 3CDSA 1G2NA 1XPCA 3A2HA 3FURA 4X1FA 4EMAA 3DZYA 4YNKA 4RAKA 2Q7JA 3VHVA 3WWRA 2ZBSA 1K4WA 1NQ0A 3V9TA 3VTBA 2I4ZA 2ZMIA 5FQSA 4G21A 4ZI1A 3KDUA 1IE8A 2PIPL 2YLOA 2P15A 3CWDA 4WVDA 5HYKA 4NY9A 2AXAA 4MG8B 1XQCA 2HWQA 2POBA 5E14A 5DYBA 2OZ7A 3H0AD 4OEYA 3DZUA 3UP3A 2B23A 3AZ2A 3FLIA 3AZ1A 2YLQA 1Y0XX 5DVSA 3ZRAA 4DM6A 3B1MA 4IVYA 4IV2A 4R2UA 5JJMA 2O4JA 3BC5A 3RLJA 4OEDA 3VRWA 1R20D 5DLRA 2R6WA 2VV4B 5DV3A 3PEQA 1ZKYA 1ILGA 5DZ1A 2HAMA 3P88A 4OKXA 4DM8A 3G8OA 3B66A 1FCXA 3KBAA 2AA2A 3KMRA 1PZLA 4CI5A 1Q4XA 2Q3YA 5DV6A 4J5WC 3B0RA 3D6DA 4ZNWA 1NQ2A 3F7DA 2P54A 1UHLB 3MNEA 3L0EA 4S14A 4E4KA 5E0WA 4A4VA 2HWRA 4RUPA 4MG6A 3R8AA 3L0LA 3VTCA 4K4JA 5DIGA 5G46A 4UDDA 3OZ0A 2AMBA 2NXXE 5IXKA 2Q7LA 5HYRA 5FQPA 1X7RA 2VV1B 5DXRA 1X76A 2Q1HA 1BSXA 1N46A 2P1UA 4JGVA 2ZFXA 4IQRA 4OH5A 4YMQA 5L7GA 3OOFA 4N73A 3AFRA 3OMKA 2AA7A 3ET1A 3MNOA 2VV0A 5GIEA 5DZ0A 5G3JA 3B0WA 3OMQA 1XIUA 1XLSA 4LBDA 1K74D 4YT1A 5DXGA 3JZBA 3CS4A 2Q1VA 5B41A 3IXPD 3WTQA 2H77A 3BQDA 5HJPB 3E00D 4PWLA 4Y29A 4A4WA 5DUEA 3FALB 4IA3A 5FQTA 1FM9D 2FSZA 2ZMHA 1QKUA 2POGA 5G42A 5KRMA 4BCRA 3M7RA 2NV7A 4RMCA 3L0JA 4OHAA 1XNNA 2QE4A 3CLDA 3N00A 5DTVA 5IZ0A 5KRJA 1A28A 5M96A 4REEA 5L7EA 5DX3B 3V3QA 4YPQA 2NW4A 4OK1A 3ADUA 2IHQA 3G8IA 5A86A 1QKTA 1YMTA 3R8DA 1S19A 2Q5SA 5KRLA 5SYZA 4RFWA 3RUTA 3P0UA 1GS4A 3A3ZX 4OJ9A 2P7ZA 4MG7A 1A52A 1X78A 4OZTE 1KKQA 1YY4A 4IWCA 3WJ4A 3X1HA 3H0AA 2HCDA 4M8HA 4RUOX 4ZO1X 1T7RA 4IW8A 4XLDA 1OVLB 2QNVA 3R8IA 1ERRA 2LBDA 4MGDB 4POHA 3TKCA 5HCVA 3ADXA 4CSJA 2QA8A 3P89A 4R06A 1RDTD 3OZJA 4JYIA 3IPQA 2ZXZA 3PCUA 2PIOA 1RK3A 5DVVA 2PIXA 3D24A 3UP0A 5DXBB 3GN8A 2P4YA 2GPPA 1L2JA 2Q5GA 2AX9A 2VV2A 3ET2A 4MGAB 5GT4A 3H52A 3ZQTA 1UOMA 3R29A 4DMAA 5EITA 3OKIA 2XYJA 5APKA 3KPZA 4JYHA 3NSQA 1NUOA 4WLBA 2VSRA 3D90A 2OVHA 4S15A 3OS8C 2Q6SA 5DZIA 2NPAA 5K13A 4N5GA 4QE8A 4J5XC 2Q7IA 4OJ4A 5AVLA 1XDKB 3AZ3A 1NAXA 5G43A 1ZEOA 3HC6A 4MGCA 5G44A 2R6YA 3K22A 5AWKA 2I0GA 2P1TA 2PIWA 3KDTA 1XP1A 3Q95B 1YUCA 2QXSA 4JYGA 5C4SA 2AO6A 4ZJWA 3S9SA 1XVPA 4CI4A 1XOWA 3K6PA 2ZXNA 1OSHA 4OEZA 5EI1A 4OJBA 4RWVA 3AN3A 5AAVA 2P1VA 3AUNA 4LSJA 4OH6A 4OIVA 1GWXA 1K74A 4N8RA 3FEIA 4XUHA 4PVUA 1KNUA 1X7BA 1M13A 2GIUA 4MGBB 4IVWA 3IXPA 4ONIA 4PP6A 1IE9A 5DZ3A 5DY8A 4OKTA 5EC9A 4DK7A 4PRGA 5DWGA 3E00A 1DKFA 4IA2A 3ET3A 3ERDA 4N1YA 4R6SA 5DI7A 3UVVA 1I7IA 5AAUA 1TXIA 2PIUA 5KYJA 2O4RA 2Q6JA 5FQVA 2HC4A 1HJ1A 3B65A 4OZTU 2G5OA 3RLLA 2GL8A 1OSVA 2ZASA 3AURA 3W0GA 4F9MA 3A9EB 1XV9B 3A2IA 1T65A 2AYRA 1H9UA 2JFAA 3K8SA 3NSPA 1S9QA 1WM0X 5DZHA 2AMAA 3WT5A 3F5CA 5DKGA 3B67A 1EXAA 4IU7A 1RJKA 1Z95A 2ZK5A 5AK2A 1ZH7A 3FALA 1R5KA 4G20A 1LBDA 3FXVA 1XB7A 4MG9B 1I7GA 3ADTA 4OLMA 3WT7A 2Q59B 2QH6A 1YYEA 3B0QA 3FC6A 3VT6A 1ZDTA 1XP6A 2V7CA 4S0TA 2J14A 1PCGA 1RDTA 2QGTA 2QR9A 4RUJA 2W8YA 4TUZB 3R2AA 5DP0A 2E2RA 2QA6A 5EHJA 3U9QA 4ZN7A 2REWA 3LBDA 5APJA 3CS8A 3CDPA 5EJVA 4OC7A 3OSIA 4ZJRA 3LMPA 2YLPA 4ZOMA 2BJ4A 3HC5A 3OLFA 5C4TA 4JAZA 3K23A 3WT6A 3ERTA 2JF9A 1NAVA 1MV9A 2XKWA 2Q70A 2Q6RA 1Z5XE 4KZMA 2OM9A 3UUAB 1MVCA 4OKWA 3HLVA 3KMZA 3GWXA 2ACLB 3L3ZA 2PNUA 4QK4A 2HB8A 4IV4A 3X31A 4PPPA 4TV1A 3VT9A 3R5NA 1T73A 4IA1A 2QABA 3V9YA 5KCDA 3VSPA 2GP7A 3PO9A 3W0CA 3WMHA 1FD0A 2QZOB 3QT0A 1N83A 3W5PA 1FBYA 1M7WA 4ZN9A 2ZL9A 2QTUA 1S9PA 2V0VA 4G2IA 2ZK4A 2PIVA 2IOKA 4ZNSA 5KRAA 3UUDB 4PP3A 3UU7B 4ZNHA 3OSWA 1Y0SA 2ZK6A 4B7WA 5JY3A 1X7EA 4PF3A 3GZ9A 2P7AA 4PLDA 4RMDA 4KZIA 5DXEA 2JJ3A 3VT7A 5DSHA 3PRGA 3FS1A 5F9BA 3VJSA 2HVCA 3PLZA 3DCUA 4DQMA 3CTBA 3A78A 1Y9RA 4OIUA 3HODA 4ITFA 5JI0D 2HFPA 3OOKA 3A40X 4KZJA 1RKHA 3OAPA 1U9EA 2OUZA 2AA5A 3DCTA 3DZYD 3WFFA 4IWFA 3X1IA 2PIQA 4XHDA 4K7AA 3G0WA 5JJMB 5DMFA 3SZ1A 1UPWA 1GWRA 4RMEA 2GPUA 3OMMA 3T03A 3EYBA 2PKLA 3UUCA 5KROA 1I37A 1R20A 1X7JA 1NQ7A 5CJ6A 3B5RA 5E1CA 4MG8A 1YJEA 4NB6A 3KWYA 4J26A 4L96A 4WHFA 1Z5XU 3OKHA 3VRTA 4K6IA 4HEEX 5DKSA 2AX7A 3IA6A 2QPYA 4XTAA 2Z4JA 5DXMA 5L11A 4IA7A 2HARA 2AWHA 3OLLA 1R6GA 3HO0A 3OMPA 3VT5A 4RZEA 4WPFA 2HASA 3VN2A 3SP9A 2VSTA 2VV4A 2NXXA 2J4AA 5E7VA 2YJDA 4IUIA 3RY9A 1K7LA 4OZRE 5EGVA 3E7CA 2PJLA 5KR9A 4UDAA 1ZGYA 3P8XA 2ZK1A 5DKBA 3W0AA 2O9IA 1UHLA 2R40D 5DMCA 1NDEA 1MZNA 4J24A 5I4VA 1FCYA 2IOGA 3DY6A 4G2HA 3WJ5A 4MG5A 5KRHA 1P8DA 3VT4A 1NQ1A 1DB1A 3E94A 4OGHA 1LV2A 3W0IA 1TFCA 5AYGA 1XQ3A 1G5YA 2VV1A 3VT3A 2AAXA 1I38A 1U3RA 3D57A 5H1EA 4EM9A 3HM1A 2ATHA 2ZNOA 4DORA 1FM9A 2PRGA 5KRKA 1FM6D 2YATA 2ZNNA 4QM0A 3VRUA 2PIRA 1S0XA 3G9EA 2I4JA 2QSEA 4O8FA 1XLSE 2GPVA 1U3QA 4OKBA 3RUUA 1YINA 4PLEA 4P6XA 3AX8A 1S0ZA 2HB7A 2FAIA 3OS9A 1VJBA 1T79A 1PQ6A 5AWJA 3O1EA 2P7GA 3OGTA 5HJPA 2AM9A 4OFRA 3V9VA 2F4BA 4E4QA 4MG7B 5FQRA 3DR1A 5AVIA 5LGAA 4G1DA 1KV6A 2PITA 1SKXA 5DRMA 3VHUA 5DUHA 5KRFA 2XHSA 3WFGA 2QA8B 4PP5A 4POJA 5IAWA 1GWQA 5DX3A 1E3KA 3V3EA 3IPSA 2ZNQA 5KYAA 1YA3A 1ZAFA 4XAOA 3W0HA 2B1VA 3IPUA 2ZK2A 3GBKA 3ZRBA 2J7YA 3ADSA 5KCWA 2H79A 1SR7A 4Q13A 4OZRU 4OARA 5DXKA 1XZXX 5KRCA 3ADVA 4REFA 1OVLA 3AUQA 2AB2A 4MGDA 5GIDA 2ZY0A 4X1GA 3VT8A 2QXMA 3BEJA 3PBAA 2J7XA 1XAPA 1SQNA 1L2IA 4QE6A 5KD9A 2ZK0A 4UDCA 4Q50A 3V4AA 3A2JA 1XNXA 5E15A 5DXBA 3VI8A 1YIMA 2VV3A 3OMOA 4ZNTA 3TX7B 4PXMA 4MGAA 3VRVA 2OAXA 5E19A 5LWPA 1UPVA 4J5WA 5HZCA 1U3SA 5KCFA 3AN4A 2YJAB 5C4UA 1XVPB 1R1KD 4FN9A 4XI3A 5DL4A 3GYTA 5HJSA 4DK8A 2B1ZA 1YOKA 2R40A 2ZLAA 4DOSA 4RE8A 5DWEA 3L3XA 1YOWA 3RVFA 4A2JA 3X36A 5AAVB 5AZVA 2G0GA 2BAWA 2Q60A 4FGYA 2GTKA 1XDKA 2I4PA 3KFCA 1FCZA 2AX6A 1DKFB 1G1UA 3B0TA 3L03A 3L1BA 3UVVB 2Z4BA 3CJWA 3OLSA 4OFUA 3Q95A 3HQ5A 1PQCA 1FM6A 1XJ7A 1SJ0A 3VJHA 4G1ZA 4S0SA 2JFAB 4FHIA 5DIDA 3JZCA 5DYDA 3W0YA 4ZNUA 5C4OA 5B5BA 3HZFA 1ZDUA 3F5CB 4IS8A 2Q7KA 3FEJA 3WGPA 4MGBA 4JL4A 5DXPA 5DKEA 1T63A 2GWXA 3TY0A 2Q61A 3GD2A 1NYXA 2Q5PA 1OT7A 2B50A 4LNWA 2G44A 3B68A 1T7MA 5G5WA 2ABIA 4M8EA 2XYXA 3GYUA 5ETHA 1QKNA 2ZVTA 3FC6B 3W5QA 1EREA 4OEAA 3W5RA 4UDBA 3R5MA 3A9EA 4P6WA 1XV9A
chains in the Genus database with same CATH superfamily
3DZUD 4RZGA 5KRIA 5GICA 2QMVA 1T74A 4IW6A 5E0XA 4HLWA 4LNXA 4Q0AC 2G0HA 2QGWA 2ZNPA 4L98A 5DV8A 2ZLCA 3W0JA 2YHDA 3CS6A 4MG9A 2BJ4B 1PDUA 2FVJA 1G50A 1PK5A 3HVLA 1T76A 2Q59A 3KYTA 1N4HA 1XP9A 3FUGA 2ZKCA 2A3IA 5DU5A 5AZTA 3TKMA 1P93A 3D5FA 1QKMA 5KCEA 4TUZA 3VJTA 4MDDA 5DRJA 5DVCA 3VJIA 1HG4A 5DIEA 4RZFA 3IMYA 2EWPA 4E2JA 1PQ9A 1T7TA 5G45A 5ICKA 3ADWA 3V49A 4FNEA 4G1YA 4TV1B 5KCTA 3KMGA 5KCUA 2ZK3A 3SP6A 3O1DA 1NRLA 4FHHA 1R1KA 5DXQA 3VSOA 1M2ZA 3ILZA 1ILHA 2AA6A 5DK9A 3UUAA 2AX8A 2I0JA 5DWLA 3VTDA 5APHA 3ZR7A 3MNPA 1T5ZA 3OS8A 4ITEA 2ZXMA 4NIEA 1PRGA 5DWJA 3NOAA 1NHZA 4NQAB 3VHWA 1E3GA 4J5XA 4QJRA 2ACLA 5KCCA 3ET0A 3W5TA 2YFEA 4PPSA 2QW4A 4ZNVA 3B3KA 3DT3A 3OSAA 1YP0A 2XYWA 2OVMA 2Q8SA 5DWIA 4APUA 4LTWA 2OCFA 5ACCA 2HBHA 5DUGA 4ZO1B 2YLYA 4NUFA 1T7FA 2QZOA 4WQPA 4XT9A 5L7HA 2ZMJA 1ZUCA 3GWSX 2GPOA 1RKGA 1EXXA 4WHGA 4OILA 4XUMA 3CQVA 4QL8A 3UUDA 3UU7A 2PINA 3CDSA 1G2NA 1XPCA 3A2HA 3FURA 4X1FA 4EMAA 3DZYA 4YNKA 4RAKA 2Q7JA 3VHVA 3WWRA 2ZBSA 1K4WA 1NQ0A 3V9TA 3VTBA 2I4ZA 2ZMIA 5FQSA 4G21A 4ZI1A 3KDUA 1IE8A 2PIPL 2YLOA 2P15A 3CWDA 4WVDA 5HYKA 4NY9A 2AXAA 4MG8B 1XQCA 2HWQA 2POBA 5E14A 5DYBA 2OZ7A 3H0AD 4OEYA 3DZUA 3UP3A 2B23A 3AZ2A 3FLIA 3AZ1A 2YLQA 1Y0XX 5DVSA 3ZRAA 4DM6A 3B1MA 4IVYA 4IV2A 4R2UA 5JJMA 2O4JA 3BC5A 3RLJA 4OEDA 3VRWA 1R20D 5DLRA 2R6WA 2VV4B 5DV3A 3PEQA 1ZKYA 1ILGA 5DZ1A 2HAMA 3P88A 4OKXA 4DM8A 3G8OA 3B66A 1FCXA 3KBAA 2AA2A 3KMRA 1PZLA 4CI5A 1Q4XA 2Q3YA 5DV6A 4J5WC 3B0RA 3D6DA 4ZNWA 1NQ2A 3F7DA 2P54A 1UHLB 3MNEA 3L0EA 4S14A 4E4KA 5E0WA 4A4VA 2HWRA 4RUPA 4MG6A 3R8AA 3L0LA 3VTCA 4K4JA 5DIGA 5G46A 4UDDA 3OZ0A 2AMBA 2NXXE 5IXKA 2Q7LA 5HYRA 5FQPA 1X7RA 2VV1B 5DXRA 1X76A 2Q1HA 1BSXA 1N46A 2P1UA 4JGVA 2ZFXA 4IQRA 4OH5A 4YMQA 5L7GA 3OOFA 4N73A 3AFRA 3OMKA 2AA7A 3ET1A 3MNOA 2VV0A 5GIEA 5DZ0A 5G3JA 3B0WA 3OMQA 1XIUA 1XLSA 4LBDA 1K74D 4YT1A 5DXGA 3JZBA 3CS4A 2Q1VA 5B41A 3IXPD 3WTQA 2H77A 3BQDA 5HJPB 3E00D 4PWLA 4Y29A 4A4WA 5DUEA 3FALB 4IA3A 5FQTA 1FM9D 2FSZA 2ZMHA 1QKUA 2POGA 5G42A 5KRMA 4BCRA 3M7RA 2NV7A 4RMCA 3L0JA 4OHAA 1XNNA 2QE4A 3CLDA 3N00A 5DTVA 5IZ0A 5KRJA 1A28A 5M96A 4REEA 5L7EA 5DX3B 3V3QA 4YPQA 2NW4A 4OK1A 3ADUA 2IHQA 3G8IA 5A86A 1QKTA 1YMTA 3R8DA 1S19A 2Q5SA 5KRLA 5SYZA 4RFWA 3RUTA 3P0UA 1GS4A 3A3ZX 4OJ9A 2P7ZA 4MG7A 1A52A 1X78A 4OZTE 1KKQA 1YY4A 4IWCA 3WJ4A 3X1HA 3H0AA 2HCDA 4M8HA 4RUOX 4ZO1X 1T7RA 4IW8A 4XLDA 1OVLB 2QNVA 3R8IA 1ERRA 2LBDA 4MGDB 4POHA 3TKCA 5HCVA 3ADXA 4CSJA 2QA8A 3P89A 4R06A 1RDTD 3OZJA 4JYIA 3IPQA 2ZXZA 3PCUA 2PIOA 1RK3A 5DVVA 2PIXA 3D24A 3UP0A 5DXBB 3GN8A 2P4YA 2GPPA 1L2JA 2Q5GA 2AX9A 2VV2A 3ET2A 4MGAB 5GT4A 3H52A 3ZQTA 1UOMA 3R29A 4DMAA 5EITA 3OKIA 2XYJA 5APKA 3KPZA 4JYHA 3NSQA 1NUOA 4WLBA 2VSRA 3D90A 2OVHA 4S15A 3OS8C 2Q6SA 5DZIA 2NPAA 5K13A 4N5GA 4QE8A 4J5XC 2Q7IA 4OJ4A 5AVLA 1XDKB 3AZ3A 1NAXA 5G43A 1ZEOA 3HC6A 4MGCA 5G44A 2R6YA 3K22A 5AWKA 2I0GA 2P1TA 2PIWA 3KDTA 1XP1A 3Q95B 1YUCA 2QXSA 4JYGA 5C4SA 2AO6A 4ZJWA 3S9SA 1XVPA 4CI4A 1XOWA 3K6PA 2ZXNA 1OSHA 4OEZA 5EI1A 4OJBA 4RWVA 3AN3A 5AAVA 2P1VA 3AUNA 4LSJA 4OH6A 4OIVA 1GWXA 1K74A 4N8RA 3FEIA 4XUHA 4PVUA 1KNUA 1X7BA 1M13A 2GIUA 4MGBB 4IVWA 3IXPA 4ONIA 4PP6A 1IE9A 5DZ3A 5DY8A 4OKTA 5EC9A 4DK7A 4PRGA 5DWGA 3E00A 1DKFA 4IA2A 3ET3A 3ERDA 4N1YA 4R6SA 5DI7A 3UVVA 1I7IA 5AAUA 1TXIA 2PIUA 5KYJA 2O4RA 2Q6JA 5FQVA 2HC4A 1HJ1A 3B65A 4OZTU 2G5OA 3RLLA 2GL8A 1OSVA 2ZASA 3AURA 3W0GA 4F9MA 3A9EB 1XV9B 3A2IA 1T65A 2AYRA 1H9UA 2JFAA 3K8SA 3NSPA 1S9QA 1WM0X 5DZHA 2AMAA 3WT5A 3F5CA 5DKGA 3B67A 1EXAA 4IU7A 1RJKA 1Z95A 2ZK5A 5AK2A 1ZH7A 3FALA 1R5KA 4G20A 1LBDA 3FXVA 1XB7A 4MG9B 1I7GA 3ADTA 4OLMA 3WT7A 2Q59B 2QH6A 1YYEA 3B0QA 3FC6A 3VT6A 1ZDTA 1XP6A 2V7CA 4S0TA 2J14A 1PCGA 1RDTA 2QGTA 2QR9A 4RUJA 2W8YA 4TUZB 3R2AA 5DP0A 2E2RA 2QA6A 5EHJA 3U9QA 4ZN7A 2REWA 3LBDA 5APJA 3CS8A 3CDPA 5EJVA 4OC7A 3OSIA 4ZJRA 3LMPA 2YLPA 4ZOMA 2BJ4A 3HC5A 3OLFA 5C4TA 4JAZA 3K23A 3WT6A 3ERTA 2JF9A 1NAVA 1MV9A 2XKWA 2Q70A 2Q6RA 1Z5XE 4KZMA 2OM9A 3UUAB 1MVCA 4OKWA 3HLVA 3KMZA 3GWXA 2ACLB 3L3ZA 2PNUA 4QK4A 2HB8A 4IV4A 3X31A 4PPPA 4TV1A 3VT9A 3R5NA 1T73A 4IA1A 2QABA 3V9YA 5KCDA 3VSPA 2GP7A 3PO9A 3W0CA 3WMHA 1FD0A 2QZOB 3QT0A 1N83A 3W5PA 1FBYA 1M7WA 4ZN9A 2ZL9A 2QTUA 1S9PA 2V0VA 4G2IA 2ZK4A 2PIVA 2IOKA 4ZNSA 5KRAA 3UUDB 4PP3A 3UU7B 4ZNHA 3OSWA 1Y0SA 2ZK6A 4B7WA 5JY3A 1X7EA 4PF3A 3GZ9A 2P7AA 4PLDA 4RMDA 4KZIA 5DXEA 2JJ3A 3VT7A 5DSHA 3PRGA 3FS1A 5F9BA 3VJSA 2HVCA 3PLZA 3DCUA 4DQMA 3CTBA 3A78A 1Y9RA 4OIUA 3HODA 4ITFA 5JI0D 2HFPA 3OOKA 3A40X 4KZJA 1RKHA 3OAPA 1U9EA 2OUZA 2AA5A 3DCTA 3DZYD 3WFFA 4IWFA 3X1IA 2PIQA 4XHDA 4K7AA 3G0WA 5JJMB 5DMFA 3SZ1A 1UPWA 1GWRA 4RMEA 2GPUA 3OMMA 3T03A 3EYBA 2PKLA 3UUCA 5KROA 1I37A 1R20A 1X7JA 1NQ7A 5CJ6A 3B5RA 5E1CA 4MG8A 1YJEA 4NB6A 3KWYA 4J26A 4L96A 4WHFA 1Z5XU 3OKHA 3VRTA 4K6IA 4HEEX 5DKSA 2AX7A 3IA6A 2QPYA 4XTAA 2Z4JA 5DXMA 5L11A 4IA7A 2HARA 2AWHA 3OLLA 1R6GA 3HO0A 3OMPA 3VT5A 4RZEA 4WPFA 2HASA 3VN2A 3SP9A 2VSTA 2VV4A 2NXXA 2J4AA 5E7VA 2YJDA 4IUIA 3RY9A 1K7LA 4OZRE 5EGVA 3E7CA 2PJLA 5KR9A 4UDAA 1ZGYA 3P8XA 2ZK1A 5DKBA 3W0AA 2O9IA 1UHLA 2R40D 5DMCA 1NDEA 1MZNA 4J24A 5I4VA 1FCYA 2IOGA 3DY6A 4G2HA 3WJ5A 4MG5A 5KRHA 1P8DA 3VT4A 1NQ1A 1DB1A 3E94A 4OGHA 1LV2A 3W0IA 1TFCA 5AYGA 1XQ3A 1G5YA 2VV1A 3VT3A 2AAXA 1I38A 1U3RA 3D57A 5H1EA 4EM9A 3HM1A 2ATHA 2ZNOA 4DORA 1FM9A 2PRGA 5KRKA 1FM6D 2YATA 2ZNNA 4QM0A 3VRUA 2PIRA 1S0XA 3G9EA 2I4JA 2QSEA 4O8FA 1XLSE 2GPVA 1U3QA 4OKBA 3RUUA 1YINA 4PLEA 4P6XA 3AX8A 1S0ZA 2HB7A 2FAIA 3OS9A 1VJBA 1T79A 1PQ6A 5AWJA 3O1EA 2P7GA 3OGTA 5HJPA 2AM9A 4OFRA 3V9VA 2F4BA 4E4QA 4MG7B 5FQRA 3DR1A 5AVIA 5LGAA 4G1DA 1KV6A 2PITA 1SKXA 5DRMA 3VHUA 5DUHA 5KRFA 2XHSA 3WFGA 2QA8B 4PP5A 4POJA 5IAWA 1GWQA 5DX3A 1E3KA 3V3EA 3IPSA 2ZNQA 5KYAA 1YA3A 1ZAFA 4XAOA 3W0HA 2B1VA 3IPUA 2ZK2A 3GBKA 3ZRBA 2J7YA 3ADSA 5KCWA 2H79A 1SR7A 4Q13A 4OZRU 4OARA 5DXKA 1XZXX 5KRCA 3ADVA 4REFA 1OVLA 3AUQA 2AB2A 4MGDA 5GIDA 2ZY0A 4X1GA 3VT8A 2QXMA 3BEJA 3PBAA 2J7XA 1XAPA 1SQNA 1L2IA 4QE6A 5KD9A 2ZK0A 4UDCA 4Q50A 3V4AA 3A2JA 1XNXA 5E15A 5DXBA 3VI8A 1YIMA 2VV3A 3OMOA 4ZNTA 3TX7B 4PXMA 4MGAA 3VRVA 2OAXA 5E19A 5LWPA 1UPVA 4J5WA 5HZCA 1U3SA 5KCFA 3AN4A 2YJAB 5C4UA 1XVPB 1R1KD 4FN9A 4XI3A 5DL4A 3GYTA 5HJSA 4DK8A 2B1ZA 1YOKA 2R40A 2ZLAA 4DOSA 4RE8A 5DWEA 3L3XA 1YOWA 3RVFA 4A2JA 3X36A 5AAVB 5AZVA 2G0GA 2BAWA 2Q60A 4FGYA 2GTKA 1XDKA 2I4PA 3KFCA 1FCZA 2AX6A 1DKFB 1G1UA 3B0TA 3L03A 3L1BA 3UVVB 2Z4BA 3CJWA 3OLSA 4OFUA 3Q95A 3HQ5A 1PQCA 1FM6A 1XJ7A 1SJ0A 3VJHA 4G1ZA 4S0SA 2JFAB 4FHIA 5DIDA 3JZCA 5DYDA 3W0YA 4ZNUA 5C4OA 5B5BA 3HZFA 1ZDUA 3F5CB 4IS8A 2Q7KA 3FEJA 3WGPA 4MGBA 4JL4A 5DXPA 5DKEA 1T63A 2GWXA 3TY0A 2Q61A 3GD2A 1NYXA 2Q5PA 1OT7A 2B50A 4LNWA 2G44A 3B68A 1T7MA 5G5WA 2ABIA 4M8EA 2XYXA 3GYUA 5ETHA 1QKNA 2ZVTA 3FC6B 3W5QA 1EREA 4OEAA 3W5RA 4UDBA 3R5MA 3A9EA 4P6WA 1XV9A
chains in the Genus database with same CATH topology
3DZUD 4RZGA 5KRIA 5GICA 2QMVA 1T74A 4IW6A 5E0XA 4HLWA 4LNXA 4Q0AC 2G0HA 2QGWA 2ZNPA 4L98A 5DV8A 2ZLCA 3W0JA 2YHDA 3CS6A 4MG9A 2BJ4B 1PDUA 2FVJA 1G50A 1PK5A 3HVLA 1T76A 2Q59A 3KYTA 1N4HA 1XP9A 3FUGA 2ZKCA 2A3IA 5DU5A 5AZTA 3TKMA 1P93A 3D5FA 1QKMA 5KCEA 4TUZA 3VJTA 4MDDA 5DRJA 5DVCA 3VJIA 1HG4A 5DIEA 4RZFA 3IMYA 2EWPA 4E2JA 1PQ9A 1T7TA 5G45A 5ICKA 3ADWA 3V49A 4FNEA 4G1YA 4TV1B 5KCTA 3KMGA 5KCUA 2ZK3A 3SP6A 3O1DA 1NRLA 4FHHA 1R1KA 5DXQA 3VSOA 1M2ZA 3ILZA 1ILHA 2AA6A 5DK9A 3UUAA 2AX8A 2I0JA 5DWLA 3VTDA 5APHA 3ZR7A 3MNPA 1T5ZA 3OS8A 4ITEA 2ZXMA 4NIEA 1PRGA 5DWJA 3NOAA 1NHZA 4NQAB 3VHWA 1E3GA 4J5XA 4QJRA 2ACLA 5KCCA 3ET0A 3W5TA 2YFEA 4PPSA 2QW4A 4ZNVA 3B3KA 3DT3A 3OSAA 1YP0A 2XYWA 2OVMA 2Q8SA 5DWIA 4APUA 4LTWA 2OCFA 5ACCA 2HBHA 5DUGA 4ZO1B 2YLYA 4NUFA 1T7FA 2QZOA 4WQPA 4XT9A 5L7HA 2ZMJA 1ZUCA 3GWSX 2GPOA 1RKGA 1EXXA 4WHGA 4OILA 4XUMA 3CQVA 4QL8A 3UUDA 3UU7A 2PINA 3CDSA 1G2NA 1XPCA 3A2HA 3FURA 4X1FA 4EMAA 3DZYA 4YNKA 4RAKA 2Q7JA 3VHVA 3WWRA 2ZBSA 1K4WA 1NQ0A 3V9TA 3VTBA 2I4ZA 2ZMIA 5FQSA 4G21A 4ZI1A 3KDUA 1IE8A 2PIPL 2YLOA 2P15A 3CWDA 4WVDA 5HYKA 4NY9A 2AXAA 4MG8B 1XQCA 2HWQA 2POBA 5E14A 5DYBA 2OZ7A 3H0AD 4OEYA 3DZUA 3UP3A 2B23A 3AZ2A 3FLIA 3AZ1A 2YLQA 1Y0XX 5DVSA 3ZRAA 4DM6A 3B1MA 4IVYA 4IV2A 4R2UA 5JJMA 2O4JA 3BC5A 3RLJA 4OEDA 3VRWA 1R20D 5DLRA 2R6WA 2VV4B 5DV3A 3PEQA 1ZKYA 1ILGA 5DZ1A 2HAMA 3P88A 4OKXA 4DM8A 3G8OA 3B66A 1FCXA 3KBAA 2AA2A 3KMRA 1PZLA 4CI5A 1Q4XA 2Q3YA 5DV6A 4J5WC 3B0RA 3D6DA 4ZNWA 1NQ2A 3F7DA 2P54A 1UHLB 3MNEA 3L0EA 4S14A 4E4KA 5E0WA 4A4VA 2HWRA 4RUPA 4MG6A 3R8AA 3L0LA 3VTCA 4K4JA 5DIGA 5G46A 4UDDA 3OZ0A 2AMBA 2NXXE 5IXKA 2Q7LA 5HYRA 5FQPA 1X7RA 2VV1B 5DXRA 1X76A 2Q1HA 1BSXA 1N46A 2P1UA 4JGVA 2ZFXA 4IQRA 4OH5A 4YMQA 5L7GA 3OOFA 4N73A 3AFRA 3OMKA 2AA7A 3ET1A 3MNOA 2VV0A 5GIEA 5DZ0A 5G3JA 3B0WA 3OMQA 1XIUA 1XLSA 4LBDA 1K74D 4YT1A 5DXGA 3JZBA 3CS4A 2Q1VA 5B41A 3IXPD 3WTQA 2H77A 3BQDA 5HJPB 3E00D 4PWLA 4Y29A 4A4WA 5DUEA 3FALB 4IA3A 5FQTA 1FM9D 2FSZA 2ZMHA 1QKUA 2POGA 5G42A 5KRMA 4BCRA 3M7RA 2NV7A 4RMCA 3L0JA 4OHAA 1XNNA 2QE4A 3CLDA 3N00A 5DTVA 5IZ0A 5KRJA 1A28A 5M96A 4REEA 5L7EA 5DX3B 3V3QA 4YPQA 2NW4A 4OK1A 3ADUA 2IHQA 3G8IA 5A86A 1QKTA 1YMTA 3R8DA 1S19A 2Q5SA 5KRLA 5SYZA 4RFWA 3RUTA 3P0UA 1GS4A 3A3ZX 4OJ9A 2P7ZA 4MG7A 1A52A 1X78A 4OZTE 1KKQA 1YY4A 4IWCA 3WJ4A 3X1HA 3H0AA 2HCDA 4M8HA 4RUOX 4ZO1X 1T7RA 4IW8A 4XLDA 1OVLB 2QNVA 3R8IA 1ERRA 2LBDA 4MGDB 4POHA 3TKCA 5HCVA 3ADXA 4CSJA 2QA8A 3P89A 4R06A 1RDTD 3OZJA 4JYIA 3IPQA 2ZXZA 3PCUA 2PIOA 1RK3A 5DVVA 2PIXA 3D24A 3UP0A 5DXBB 3GN8A 2P4YA 2GPPA 1L2JA 2Q5GA 2AX9A 2VV2A 3ET2A 4MGAB 5GT4A 3H52A 3ZQTA 1UOMA 3R29A 4DMAA 5EITA 3OKIA 2XYJA 5APKA 3KPZA 4JYHA 3NSQA 1NUOA 4WLBA 2VSRA 3D90A 2OVHA 4S15A 3OS8C 2Q6SA 5DZIA 2NPAA 5K13A 4N5GA 4QE8A 4J5XC 2Q7IA 4OJ4A 5AVLA 1XDKB 3AZ3A 1NAXA 5G43A 1ZEOA 3HC6A 4MGCA 5G44A 2R6YA 3K22A 5AWKA 2I0GA 2P1TA 2PIWA 3KDTA 1XP1A 3Q95B 1YUCA 2QXSA 4JYGA 5C4SA 2AO6A 4ZJWA 3S9SA 1XVPA 4CI4A 1XOWA 3K6PA 2ZXNA 1OSHA 4OEZA 5EI1A 4OJBA 4RWVA 3AN3A 5AAVA 2P1VA 3AUNA 4LSJA 4OH6A 4OIVA 1GWXA 1K74A 4N8RA 3FEIA 4XUHA 4PVUA 1KNUA 1X7BA 1M13A 2GIUA 4MGBB 4IVWA 3IXPA 4ONIA 4PP6A 1IE9A 5DZ3A 5DY8A 4OKTA 5EC9A 4DK7A 4PRGA 5DWGA 3E00A 1DKFA 4IA2A 3ET3A 3ERDA 4N1YA 4R6SA 5DI7A 3UVVA 1I7IA 5AAUA 1TXIA 2PIUA 5KYJA 2O4RA 2Q6JA 5FQVA 2HC4A 1HJ1A 3B65A 4OZTU 2G5OA 3RLLA 2GL8A 1OSVA 2ZASA 3AURA 3W0GA 4F9MA 3A9EB 1XV9B 3A2IA 1T65A 2AYRA 1H9UA 2JFAA 3K8SA 3NSPA 1S9QA 1WM0X 5DZHA 2AMAA 3WT5A 3F5CA 5DKGA 3B67A 1EXAA 4IU7A 1RJKA 1Z95A 2ZK5A 5AK2A 1ZH7A 3FALA 1R5KA 4G20A 1LBDA 3FXVA 1XB7A 4MG9B 1I7GA 3ADTA 4OLMA 3WT7A 2Q59B 2QH6A 1YYEA 3B0QA 3FC6A 3VT6A 1ZDTA 1XP6A 2V7CA 4S0TA 2J14A 1PCGA 1RDTA 2QGTA 2QR9A 4RUJA 2W8YA 4TUZB 3R2AA 5DP0A 2E2RA 2QA6A 5EHJA 3U9QA 4ZN7A 2REWA 3LBDA 5APJA 3CS8A 3CDPA 5EJVA 4OC7A 3OSIA 4ZJRA 3LMPA 2YLPA 4ZOMA 2BJ4A 3HC5A 3OLFA 5C4TA 4JAZA 3K23A 3WT6A 3ERTA 2JF9A 1NAVA 1MV9A 2XKWA 2Q70A 2Q6RA 1Z5XE 4KZMA 2OM9A 3UUAB 1MVCA 4OKWA 3HLVA 3KMZA 3GWXA 2ACLB 3L3ZA 2PNUA 4QK4A 2HB8A 4IV4A 3X31A 4PPPA 4TV1A 3VT9A 3R5NA 1T73A 4IA1A 2QABA 3V9YA 5KCDA 3VSPA 2GP7A 3PO9A 3W0CA 3WMHA 1FD0A 2QZOB 3QT0A 1N83A 3W5PA 1FBYA 1M7WA 4ZN9A 2ZL9A 2QTUA 1S9PA 2V0VA 4G2IA 2ZK4A 2PIVA 2IOKA 4ZNSA 5KRAA 3UUDB 4PP3A 3UU7B 4ZNHA 3OSWA 1Y0SA 2ZK6A 4B7WA 5JY3A 1X7EA 4PF3A 3GZ9A 2P7AA 4PLDA 4RMDA 4KZIA 5DXEA 2JJ3A 3VT7A 5DSHA 3PRGA 3FS1A 5F9BA 3VJSA 2HVCA 3PLZA 3DCUA 4DQMA 3CTBA 3A78A 1Y9RA 4OIUA 3HODA 4ITFA 5JI0D 2HFPA 3OOKA 3A40X 4KZJA 1RKHA 3OAPA 1U9EA 2OUZA 2AA5A 3DCTA 3DZYD 3WFFA 4IWFA 3X1IA 2PIQA 4XHDA 4K7AA 3G0WA 5JJMB 5DMFA 3SZ1A 1UPWA 1GWRA 4RMEA 2GPUA 3OMMA 3T03A 3EYBA 2PKLA 3UUCA 5KROA 1I37A 1R20A 1X7JA 1NQ7A 5CJ6A 3B5RA 5E1CA 4MG8A 1YJEA 4NB6A 3KWYA 4J26A 4L96A 4WHFA 1Z5XU 3OKHA 3VRTA 4K6IA 4HEEX 5DKSA 2AX7A 3IA6A 2QPYA 4XTAA 2Z4JA 5DXMA 5L11A 4IA7A 2HARA 2AWHA 3OLLA 1R6GA 3HO0A 3OMPA 3VT5A 4RZEA 4WPFA 2HASA 3VN2A 3SP9A 2VSTA 2VV4A 2NXXA 2J4AA 5E7VA 2YJDA 4IUIA 3RY9A 1K7LA 4OZRE 5EGVA 3E7CA 2PJLA 5KR9A 4UDAA 1ZGYA 3P8XA 2ZK1A 5DKBA 3W0AA 2O9IA 1UHLA 2R40D 5DMCA 1NDEA 1MZNA 4J24A 5I4VA 1FCYA 2IOGA 3DY6A 4G2HA 3WJ5A 4MG5A 5KRHA 1P8DA 3VT4A 1NQ1A 1DB1A 3E94A 4OGHA 1LV2A 3W0IA 1TFCA 5AYGA 1XQ3A 1G5YA 2VV1A 3VT3A 2AAXA 1I38A 1U3RA 3D57A 5H1EA 4EM9A 3HM1A 2ATHA 2ZNOA 4DORA 1FM9A 2PRGA 5KRKA 1FM6D 2YATA 2ZNNA 4QM0A 3VRUA 2PIRA 1S0XA 3G9EA 2I4JA 2QSEA 4O8FA 1XLSE 2GPVA 1U3QA 4OKBA 3RUUA 1YINA 4PLEA 4P6XA 3AX8A 1S0ZA 2HB7A 2FAIA 3OS9A 1VJBA 1T79A 1PQ6A 5AWJA 3O1EA 2P7GA 3OGTA 5HJPA 2AM9A 4OFRA 3V9VA 2F4BA 4E4QA 4MG7B 5FQRA 3DR1A 5AVIA 5LGAA 4G1DA 1KV6A 2PITA 1SKXA 5DRMA 3VHUA 5DUHA 5KRFA 2XHSA 3WFGA 2QA8B 4PP5A 4POJA 5IAWA 1GWQA 5DX3A 1E3KA 3V3EA 3IPSA 2ZNQA 5KYAA 1YA3A 1ZAFA 4XAOA 3W0HA 2B1VA 3IPUA 2ZK2A 3GBKA 3ZRBA 2J7YA 3ADSA 5KCWA 2H79A 1SR7A 4Q13A 4OZRU 4OARA 5DXKA 1XZXX 5KRCA 3ADVA 4REFA 1OVLA 3AUQA 2AB2A 4MGDA 5GIDA 2ZY0A 4X1GA 3VT8A 2QXMA 3BEJA 3PBAA 2J7XA 1XAPA 1SQNA 1L2IA 4QE6A 5KD9A 2ZK0A 4UDCA 4Q50A 3V4AA 3A2JA 1XNXA 5E15A 5DXBA 3VI8A 1YIMA 2VV3A 3OMOA 4ZNTA 3TX7B 4PXMA 4MGAA 3VRVA 2OAXA 5E19A 5LWPA 1UPVA 4J5WA 5HZCA 1U3SA 5KCFA 3AN4A 2YJAB 5C4UA 1XVPB 1R1KD 4FN9A 4XI3A 5DL4A 3GYTA 5HJSA 4DK8A 2B1ZA 1YOKA 2R40A 2ZLAA 4DOSA 4RE8A 5DWEA 3L3XA 1YOWA 3RVFA 4A2JA 3X36A 5AAVB 5AZVA 2G0GA 2BAWA 2Q60A 4FGYA 2GTKA 1XDKA 2I4PA 3KFCA 1FCZA 2AX6A 1DKFB 1G1UA 3B0TA 3L03A 3L1BA 3UVVB 2Z4BA 3CJWA 3OLSA 4OFUA 3Q95A 3HQ5A 1PQCA 1FM6A 1XJ7A 1SJ0A 3VJHA 4G1ZA 4S0SA 2JFAB 4FHIA 5DIDA 3JZCA 5DYDA 3W0YA 4ZNUA 5C4OA 5B5BA 3HZFA 1ZDUA 3F5CB 4IS8A 2Q7KA 3FEJA 3WGPA 4MGBA 4JL4A 5DXPA 5DKEA 1T63A 2GWXA 3TY0A 2Q61A 3GD2A 1NYXA 2Q5PA 1OT7A 2B50A 4LNWA 2G44A 3B68A 1T7MA 5G5WA 2ABIA 4M8EA 2XYXA 3GYUA 5ETHA 1QKNA 2ZVTA 3FC6B 3W5QA 1EREA 4OEAA 3W5RA 4UDBA 3R5MA 3A9EA 4P6WA 1XV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZU D;  4RZG A;  5KRI A;  5GIC A;  2QMV A;  1T74 A;  4IW6 A;  5E0X A;  4HLW A;  4LNX A;  4Q0A C;  2G0H A;  2QGW A;  2ZNP A;  4L98 A;  5DV8 A;  2ZLC A;  3W0J A;  2YHD A;  3CS6 A;  4MG9 A;  2BJ4 B;  1PDU A;  2FVJ A;  1G50 A;  1PK5 A;  3HVL A;  1T76 A;  2Q59 A;  3KYT A;  1N4H A;  1XP9 A;  3FUG A;  2ZKC A;  2A3I A;  5DU5 A;  5AZT A;  3TKM A;  1P93 A;  3D5F A;  1QKM A;  5KCE A;  4TUZ A;  3VJT A;  4MDD A;  5DRJ A;  5DVC A;  3VJI A;  1HG4 A;  5DIE A;  4RZF A;  3IMY A;  2EWP A;  4E2J A;  1PQ9 A;  1T7T A;  5G45 A;  5ICK A;  3ADW A;  3V49 A;  4FNE A;  4G1Y A;  4TV1 B;  5KCT A;  3KMG A;  5KCU A;  2ZK3 A;  3SP6 A;  3O1D A;  1NRL A;  4FHH A;  1R1K A;  5DXQ A;  3VSO A;  1M2Z A;  3ILZ A;  1ILH A;  2AA6 A;  5DK9 A;  3UUA A;  2AX8 A;  2I0J A;  5DWL A;  3VTD A;  5APH A;  3ZR7 A;  3MNP A;  1T5Z A;  3OS8 A;  4ITE A;  2ZXM A;  4NIE A;  1PRG A;  5DWJ A;  3NOA A;  1NHZ A;  4NQA B;  3VHW A;  1E3G A;  4J5X A;  4QJR A;  2ACL A;  5KCC A;  3ET0 A;  3W5T A;  2YFE A;  4PPS A;  2QW4 A;  4ZNV A;  3B3K A;  3DT3 A;  3OSA A;  1YP0 A;  2XYW A;  2OVM A;  2Q8S A;  5DWI A;  4APU A;  4LTW A;  2OCF A;  5ACC A;  2HBH A;  5DUG A;  4ZO1 B;  2YLY A;  4NUF A;  1T7F A;  2QZO A;  4WQP A;  4XT9 A;  5L7H A;  2ZMJ A;  1ZUC A;  3GWS X;  2GPO A;  1RKG A;  1EXX A;  4WHG A;  4OIL A;  4XUM A;  3CQV A;  4QL8 A;  3UUD A;  3UU7 A;  2PIN A;  3CDS A;  1G2N A;  1XPC A;  3A2H A;  3FUR A;  4X1F A;  4EMA A;  3DZY A;  4YNK A;  4RAK A;  2Q7J A;  3VHV A;  3WWR A;  2ZBS A;  1K4W A;  1NQ0 A;  3V9T A;  3VTB A;  2I4Z A;  2ZMI A;  5FQS A;  4G21 A;  4ZI1 A;  3KDU A;  1IE8 A;  2PIP L;  2YLO A;  2P15 A;  3CWD A;  4WVD A;  5HYK A;  4NY9 A;  2AXA A;  4MG8 B;  1XQC A;  2HWQ A;  2POB A;  5E14 A;  5DYB A;  2OZ7 A;  3H0A D;  4OEY A;  3DZU A;  3UP3 A;  2B23 A;  3AZ2 A;  3FLI A;  3AZ1 A;  2YLQ A;  1Y0X X;  5DVS A;  3ZRA A;  4DM6 A;  3B1M A;  4IVY A;  4IV2 A;  4R2U A;  5JJM A;  2O4J A;  3BC5 A;  3RLJ A;  4OED A;  3VRW A;  1R20 D;  5DLR A;  2R6W A;  2VV4 B;  5DV3 A;  3PEQ A;  1ZKY A;  1ILG A;  5DZ1 A;  2HAM A;  3P88 A;  4OKX A;  4DM8 A;  3G8O A;  3B66 A;  1FCX A;  3KBA A;  2AA2 A;  3KMR A;  1PZL A;  4CI5 A;  1Q4X A;  2Q3Y A;  5DV6 A;  4J5W C;  3B0R A;  3D6D A;  4ZNW A;  1NQ2 A;  3F7D A;  2P54 A;  1UHL B;  3MNE A;  3L0E A;  4S14 A;  4E4K A;  5E0W A;  4A4V A;  2HWR A;  4RUP A;  4MG6 A;  3R8A A;  3L0L A;  3VTC A;  4K4J A;  5DIG A;  5G46 A;  4UDD A;  3OZ0 A;  2AMB A;  2NXX E;  5IXK A;  2Q7L A;  5HYR A;  5FQP A;  1X7R A;  2VV1 B;  5DXR A;  1X76 A;  2Q1H A;  1BSX A;  1N46 A;  2P1U A;  4JGV A;  2ZFX A;  4IQR A;  4OH5 A;  4YMQ A;  5L7G A;  3OOF A;  4N73 A;  3AFR A;  3OMK A;  2AA7 A;  3ET1 A;  3MNO A;  2VV0 A;  5GIE A;  5DZ0 A;  5G3J A;  3B0W A;  3OMQ A;  1XIU A;  1XLS A;  4LBD A;  1K74 D;  4YT1 A;  5DXG A;  3JZB A;  3CS4 A;  2Q1V A;  5B41 A;  3IXP D;  3WTQ A;  2H77 A;  3BQD A;  5HJP B;  3E00 D;  4PWL A;  4Y29 A;  4A4W A;  5DUE A;  3FAL B;  4IA3 A;  5FQT A;  1FM9 D;  2FSZ A;  2ZMH A;  1QKU A;  2POG A;  5G42 A;  5KRM A;  4BCR A;  3M7R A;  2NV7 A;  4RMC A;  3L0J A;  4OHA A;  1XNN A;  2QE4 A;  3CLD A;  3N00 A;  5DTV A;  5IZ0 A;  5KRJ A;  1A28 A;  5M96 A;  4REE A;  5L7E A;  5DX3 B;  3V3Q A;  4YPQ A;  2NW4 A;  4OK1 A;  3ADU A;  2IHQ A;  3G8I A;  5A86 A;  1QKT A;  1YMT A;  3R8D A;  1S19 A;  2Q5S A;  5KRL A;  5SYZ A;  4RFW A;  3RUT A;  3P0U A;  1GS4 A;  3A3Z X;  4OJ9 A;  2P7Z A;  4MG7 A;  1A52 A;  1X78 A;  4OZT E;  1KKQ A;  1YY4 A;  4IWC A;  3WJ4 A;  3X1H A;  3H0A A;  2HCD A;  4M8H A;  4RUO X;  4ZO1 X;  1T7R A;  4IW8 A;  4XLD A;  1OVL B;  2QNV A;  3R8I A;  1ERR A;  2LBD A;  4MGD B;  4POH A;  3TKC A;  5HCV A;  3ADX A;  4CSJ A;  2QA8 A;  3P89 A;  4R06 A;  1RDT D;  3OZJ A;  4JYI A;  3IPQ A;  2ZXZ A;  3PCU A;  2PIO A;  1RK3 A;  5DVV A;  2PIX A;  3D24 A;  3UP0 A;  5DXB B;  3GN8 A;  2P4Y A;  2GPP A;  1L2J A;  2Q5G A;  2AX9 A;  2VV2 A;  3ET2 A;  4MGA B;  5GT4 A;  3H52 A;  3ZQT A;  1UOM A;  3R29 A;  4DMA A;  5EIT A;  3OKI A;  2XYJ A;  5APK A;  3KPZ A;  4JYH A;  3NSQ A;  1NUO A;  4WLB A;  2VSR A;  3D90 A;  2OVH A;  4S15 A;  3OS8 C;  2Q6S A;  5DZI A;  2NPA A;  5K13 A;  4N5G A;  4QE8 A;  4J5X C;  2Q7I A;  4OJ4 A;  5AVL A;  1XDK B;  3AZ3 A;  1NAX A;  5G43 A;  1ZEO A;  3HC6 A;  4MGC A;  5G44 A;  2R6Y A;  3K22 A;  5AWK A;  2I0G A;  2P1T A;  2PIW A;  3KDT A;  1XP1 A;  3Q95 B;  1YUC A;  2QXS A;  4JYG A;  5C4S A;  2AO6 A;  4ZJW A;  3S9S A;  1XVP A;  4CI4 A;  1XOW A;  3K6P A;  2ZXN A;  1OSH A;  4OEZ A;  5EI1 A;  4OJB A;  4RWV A;  3AN3 A;  5AAV A;  2P1V A;  3AUN A;  4LSJ A;  4OH6 A;  4OIV A;  1GWX A;  1K74 A;  4N8R A;  3FEI A;  4XUH A;  4PVU A;  1KNU A;  1X7B A;  1M13 A;  2GIU A;  4MGB B;  4IVW A;  3IXP A;  4ONI A;  4PP6 A;  1IE9 A;  5DZ3 A;  5DY8 A;  4OKT A;  5EC9 A;  4DK7 A;  4PRG A;  5DWG A;  3E00 A;  1DKF A;  4IA2 A;  3ET3 A;  3ERD A;  4N1Y A;  4R6S A;  5DI7 A;  3UVV A;  1I7I A;  5AAU A;  1TXI A;  2PIU A;  5KYJ A;  2O4R A;  2Q6J A;  5FQV A;  2HC4 A;  1HJ1 A;  3B65 A;  4OZT U;  2G5O A;  3RLL A;  2GL8 A;  1OSV A;  2ZAS A;  3AUR A;  3W0G A;  4F9M A;  3A9E B;  1XV9 B;  3A2I A;  1T65 A;  2AYR A;  1H9U A;  2JFA A;  3K8S A;  3NSP A;  1S9Q A;  1WM0 X;  5DZH A;  2AMA A;  3WT5 A;  3F5C A;  5DKG A;  3B67 A;  1EXA A;  4IU7 A;  1RJK A;  1Z95 A;  2ZK5 A;  5AK2 A;  1ZH7 A;  3FAL A;  1R5K A;  4G20 A;  1LBD A;  3FXV A;  1XB7 A;  4MG9 B;  1I7G A;  3ADT A;  4OLM A;  3WT7 A;  2Q59 B;  2QH6 A;  1YYE A;  3B0Q A;  3FC6 A;  3VT6 A;  1ZDT A;  1XP6 A;  2V7C A;  4S0T A;  2J14 A;  1PCG A;  1RDT A;  2QGT A;  2QR9 A;  4RUJ A;  2W8Y A;  4TUZ B;  3R2A A;  5DP0 A;  2E2R A;  2QA6 A;  5EHJ A;  3U9Q A;  4ZN7 A;  2REW A;  3LBD A;  5APJ A;  3CS8 A;  3CDP A;  5EJV A;  4OC7 A;  3OSI A;  4ZJR A;  3LMP A;  2YLP A;  4ZOM A;  2BJ4 A;  3HC5 A;  3OLF A;  5C4T A;  4JAZ A;  3K23 A;  3WT6 A;  3ERT A;  2JF9 A;  1NAV A;  1MV9 A;  2XKW A;  2Q70 A;  2Q6R A;  1Z5X E;  4KZM A;  2OM9 A;  3UUA B;  1MVC A;  4OKW A;  3HLV A;  3KMZ A;  3GWX A;  2ACL B;  3L3Z A;  2PNU A;  4QK4 A;  2HB8 A;  4IV4 A;  3X31 A;  4PPP A;  4TV1 A;  3VT9 A;  3R5N A;  1T73 A;  4IA1 A;  2QAB A;  3V9Y A;  5KCD A;  3VSP A;  2GP7 A;  3PO9 A;  3W0C A;  3WMH A;  1FD0 A;  2QZO B;  3QT0 A;  1N83 A;  3W5P A;  1FBY A;  1M7W A;  4ZN9 A;  2ZL9 A;  2QTU A;  1S9P A;  2V0V A;  4G2I A;  2ZK4 A;  2PIV A;  2IOK A;  4ZNS A;  5KRA A;  3UUD B;  4PP3 A;  3UU7 B;  4ZNH A;  3OSW A;  1Y0S A;  2ZK6 A;  4B7W A;  5JY3 A;  1X7E A;  4PF3 A;  3GZ9 A;  2P7A A;  4PLD A;  4RMD A;  4KZI A;  5DXE A;  2JJ3 A;  3VT7 A;  5DSH A;  3PRG A;  3FS1 A;  5F9B A;  3VJS A;  2HVC A;  3PLZ A;  3DCU A;  4DQM A;  3CTB A;  3A78 A;  1Y9R A;  4OIU A;  3HOD A;  4ITF A;  5JI0 D;  2HFP A;  3OOK A;  3A40 X;  4KZJ A;  1RKH A;  3OAP A;  1U9E A;  2OUZ A;  2AA5 A;  3DCT A;  3DZY D;  3WFF A;  4IWF A;  3X1I A;  2PIQ A;  4XHD A;  4K7A A;  3G0W A;  5JJM B;  5DMF A;  3SZ1 A;  1UPW A;  1GWR A;  4RME A;  2GPU A;  3OMM A;  3T03 A;  3EYB A;  2PKL A;  3UUC A;  5KRO A;  1I37 A;  1R20 A;  1X7J A;  1NQ7 A;  5CJ6 A;  3B5R A;  5E1C A;  4MG8 A;  1YJE A;  4NB6 A;  3KWY A;  4J26 A;  4L96 A;  4WHF A;  1Z5X U;  3OKH A;  3VRT A;  4K6I A;  4HEE X;  5DKS A;  2AX7 A;  3IA6 A;  2QPY A;  4XTA A;  2Z4J A;  5DXM A;  5L11 A;  4IA7 A;  2HAR A;  2AWH A;  3OLL A;  1R6G A;  3HO0 A;  3OMP A;  3VT5 A;  4RZE A;  4WPF A;  2HAS A;  3VN2 A;  3SP9 A;  2VST A;  2VV4 A;  2NXX A;  2J4A A;  5E7V A;  2YJD A;  4IUI A;  3RY9 A;  1K7L A;  4OZR E;  5EGV A;  3E7C A;  2PJL A;  5KR9 A;  4UDA A;  1ZGY A;  3P8X A;  2ZK1 A;  5DKB A;  3W0A A;  2O9I A;  1UHL A;  2R40 D;  5DMC A;  1NDE A;  1MZN A;  4J24 A;  5I4V A;  1FCY A;  2IOG A;  3DY6 A;  4G2H A;  3WJ5 A;  4MG5 A;  5KRH A;  1P8D A;  3VT4 A;  1NQ1 A;  1DB1 A;  3E94 A;  4OGH A;  1LV2 A;  3W0I A;  1TFC A;  5AYG A;  1XQ3 A;  1G5Y A;  2VV1 A;  3VT3 A;  2AAX A;  1I38 A;  1U3R A;  3D57 A;  5H1E A;  4EM9 A;  3HM1 A;  2ATH A;  2ZNO A;  4DOR A;  1FM9 A;  2PRG A;  5KRK A;  1FM6 D;  2YAT A;  2ZNN A;  4QM0 A;  3VRU A;  2PIR A;  1S0X A;  3G9E A;  2I4J A;  2QSE A;  4O8F A;  1XLS E;  2GPV A;  1U3Q A;  4OKB A;  3RUU A;  1YIN A;  4PLE A;  4P6X A;  3AX8 A;  1S0Z A;  2HB7 A;  2FAI A;  3OS9 A;  1VJB A;  1T79 A;  1PQ6 A;  5AWJ A;  3O1E A;  2P7G A;  3OGT A;  5HJP A;  2AM9 A;  4OFR A;  3V9V A;  2F4B A;  4E4Q A;  4MG7 B;  5FQR A;  3DR1 A;  5AVI A;  5LGA A;  4G1D A;  1KV6 A;  2PIT A;  1SKX A;  5DRM A;  3VHU A;  5DUH A;  5KRF A;  2XHS A;  3WFG A;  2QA8 B;  4PP5 A;  4POJ A;  5IAW A;  1GWQ A;  5DX3 A;  1E3K A;  3V3E A;  3IPS A;  2ZNQ A;  5KYA A;  1YA3 A;  1ZAF A;  4XAO A;  3W0H A;  2B1V A;  3IPU A;  2ZK2 A;  3GBK A;  3ZRB A;  2J7Y A;  3ADS A;  5KCW A;  2H79 A;  1SR7 A;  4Q13 A;  4OZR U;  4OAR A;  5DXK A;  1XZX X;  5KRC A;  3ADV A;  4REF A;  1OVL A;  3AUQ A;  2AB2 A;  4MGD A;  5GID A;  2ZY0 A;  4X1G A;  3VT8 A;  2QXM A;  3BEJ A;  3PBA A;  2J7X A;  1XAP A;  1SQN A;  1L2I A;  4QE6 A;  5KD9 A;  2ZK0 A;  4UDC A;  4Q50 A;  3V4A A;  3A2J A;  1XNX A;  5E15 A;  5DXB A;  3VI8 A;  1YIM A;  2VV3 A;  3OMO A;  4ZNT A;  3TX7 B;  4PXM A;  4MGA A;  3VRV A;  2OAX A;  5E19 A;  5LWP A;  1UPV A;  4J5W A;  5HZC A;  1U3S A;  5KCF A;  3AN4 A;  2YJA B;  5C4U A;  1XVP B;  1R1K D;  4FN9 A;  4XI3 A;  5DL4 A;  3GYT A;  5HJS A;  4DK8 A;  2B1Z A;  1YOK A;  2R40 A;  2ZLA A;  4DOS A;  4RE8 A;  5DWE A;  3L3X A;  1YOW A;  3RVF A;  4A2J A;  3X36 A;  5AAV B;  5AZV A;  2G0G A;  2BAW A;  2Q60 A;  4FGY A;  2GTK A;  1XDK A;  2I4P A;  3KFC A;  1FCZ A;  2AX6 A;  1DKF B;  1G1U A;  3B0T A;  3L03 A;  3L1B A;  3UVV B;  2Z4B A;  3CJW A;  3OLS A;  4OFU A;  3Q95 A;  3HQ5 A;  1PQC A;  1FM6 A;  1XJ7 A;  1SJ0 A;  3VJH A;  4G1Z A;  4S0S A;  2JFA B;  4FHI A;  5DID A;  3JZC A;  5DYD A;  3W0Y A;  4ZNU A;  5C4O A;  5B5B A;  3HZF A;  1ZDU A;  3F5C B;  4IS8 A;  2Q7K A;  3FEJ A;  3WGP A;  4MGB A;  4JL4 A;  5DXP A;  5DKE A;  1T63 A;  2GWX A;  3TY0 A;  2Q61 A;  3GD2 A;  1NYX A;  2Q5P A;  1OT7 A;  2B50 A;  4LNW A;  2G44 A;  3B68 A;  1T7M A;  5G5W A;  2ABI A;  4M8E A;  2XYX A;  3GYU A;  5ETH A;  1QKN A;  2ZVT A;  3FC6 B;  3W5Q A;  1ERE A;  4OEA A;  3W5R A;  4UDB A;  3R5M A;  3A9E A;  4P6W A;  1XV9 A; 
#chains in the Genus database with same CATH topology
 3DZU D;  4RZG A;  5KRI A;  5GIC A;  2QMV A;  1T74 A;  4IW6 A;  5E0X A;  4HLW A;  4LNX A;  4Q0A C;  2G0H A;  2QGW A;  2ZNP A;  4L98 A;  5DV8 A;  2ZLC A;  3W0J A;  2YHD A;  3CS6 A;  4MG9 A;  2BJ4 B;  1PDU A;  2FVJ A;  1G50 A;  1PK5 A;  3HVL A;  1T76 A;  2Q59 A;  3KYT A;  1N4H A;  1XP9 A;  3FUG A;  2ZKC A;  2A3I A;  5DU5 A;  5AZT A;  3TKM A;  1P93 A;  3D5F A;  1QKM A;  5KCE A;  4TUZ A;  3VJT A;  4MDD A;  5DRJ A;  5DVC A;  3VJI A;  1HG4 A;  5DIE A;  4RZF A;  3IMY A;  2EWP A;  4E2J A;  1PQ9 A;  1T7T A;  5G45 A;  5ICK A;  3ADW A;  3V49 A;  4FNE A;  4G1Y A;  4TV1 B;  5KCT A;  3KMG A;  5KCU A;  2ZK3 A;  3SP6 A;  3O1D A;  1NRL A;  4FHH A;  1R1K A;  5DXQ A;  3VSO A;  1M2Z A;  3ILZ A;  1ILH A;  2AA6 A;  5DK9 A;  3UUA A;  2AX8 A;  2I0J A;  5DWL A;  3VTD A;  5APH A;  3ZR7 A;  3MNP A;  1T5Z A;  3OS8 A;  4ITE A;  2ZXM A;  4NIE A;  1PRG A;  5DWJ A;  3NOA A;  1NHZ A;  4NQA B;  3VHW A;  1E3G A;  4J5X A;  4QJR A;  2ACL A;  5KCC A;  3ET0 A;  3W5T A;  2YFE A;  4PPS A;  2QW4 A;  4ZNV A;  3B3K A;  3DT3 A;  3OSA A;  1YP0 A;  2XYW A;  2OVM A;  2Q8S A;  5DWI A;  4APU A;  4LTW A;  2OCF A;  5ACC A;  2HBH A;  5DUG A;  4ZO1 B;  2YLY A;  4NUF A;  1T7F A;  2QZO A;  4WQP A;  4XT9 A;  5L7H A;  2ZMJ A;  1ZUC A;  3GWS X;  2GPO A;  1RKG A;  1EXX A;  4WHG A;  4OIL A;  4XUM A;  3CQV A;  4QL8 A;  3UUD A;  3UU7 A;  2PIN A;  3CDS A;  1G2N A;  1XPC A;  3A2H A;  3FUR A;  4X1F A;  4EMA A;  3DZY A;  4YNK A;  4RAK A;  2Q7J A;  3VHV A;  3WWR A;  2ZBS A;  1K4W A;  1NQ0 A;  3V9T A;  3VTB A;  2I4Z A;  2ZMI A;  5FQS A;  4G21 A;  4ZI1 A;  3KDU A;  1IE8 A;  2PIP L;  2YLO A;  2P15 A;  3CWD A;  4WVD A;  5HYK A;  4NY9 A;  2AXA A;  4MG8 B;  1XQC A;  2HWQ A;  2POB A;  5E14 A;  5DYB A;  2OZ7 A;  3H0A D;  4OEY A;  3DZU A;  3UP3 A;  2B23 A;  3AZ2 A;  3FLI A;  3AZ1 A;  2YLQ A;  1Y0X X;  5DVS A;  3ZRA A;  4DM6 A;  3B1M A;  4IVY A;  4IV2 A;  4R2U A;  5JJM A;  2O4J A;  3BC5 A;  3RLJ A;  4OED A;  3VRW A;  1R20 D;  5DLR A;  2R6W A;  2VV4 B;  5DV3 A;  3PEQ A;  1ZKY A;  1ILG A;  5DZ1 A;  2HAM A;  3P88 A;  4OKX A;  4DM8 A;  3G8O A;  3B66 A;  1FCX A;  3KBA A;  2AA2 A;  3KMR A;  1PZL A;  4CI5 A;  1Q4X A;  2Q3Y A;  5DV6 A;  4J5W C;  3B0R A;  3D6D A;  4ZNW A;  1NQ2 A;  3F7D A;  2P54 A;  1UHL B;  3MNE A;  3L0E A;  4S14 A;  4E4K A;  5E0W A;  4A4V A;  2HWR A;  4RUP A;  4MG6 A;  3R8A A;  3L0L A;  3VTC A;  4K4J A;  5DIG A;  5G46 A;  4UDD A;  3OZ0 A;  2AMB A;  2NXX E;  5IXK A;  2Q7L A;  5HYR A;  5FQP A;  1X7R A;  2VV1 B;  5DXR A;  1X76 A;  2Q1H A;  1BSX A;  1N46 A;  2P1U A;  4JGV A;  2ZFX A;  4IQR A;  4OH5 A;  4YMQ A;  5L7G A;  3OOF A;  4N73 A;  3AFR A;  3OMK A;  2AA7 A;  3ET1 A;  3MNO A;  2VV0 A;  5GIE A;  5DZ0 A;  5G3J A;  3B0W A;  3OMQ A;  1XIU A;  1XLS A;  4LBD A;  1K74 D;  4YT1 A;  5DXG A;  3JZB A;  3CS4 A;  2Q1V A;  5B41 A;  3IXP D;  3WTQ A;  2H77 A;  3BQD A;  5HJP B;  3E00 D;  4PWL A;  4Y29 A;  4A4W A;  5DUE A;  3FAL B;  4IA3 A;  5FQT A;  1FM9 D;  2FSZ A;  2ZMH A;  1QKU A;  2POG A;  5G42 A;  5KRM A;  4BCR A;  3M7R A;  2NV7 A;  4RMC A;  3L0J A;  4OHA A;  1XNN A;  2QE4 A;  3CLD A;  3N00 A;  5DTV A;  5IZ0 A;  5KRJ A;  1A28 A;  5M96 A;  4REE A;  5L7E A;  5DX3 B;  3V3Q A;  4YPQ A;  2NW4 A;  4OK1 A;  3ADU A;  2IHQ A;  3G8I A;  5A86 A;  1QKT A;  1YMT A;  3R8D A;  1S19 A;  2Q5S A;  5KRL A;  5SYZ A;  4RFW A;  3RUT A;  3P0U A;  1GS4 A;  3A3Z X;  4OJ9 A;  2P7Z A;  4MG7 A;  1A52 A;  1X78 A;  4OZT E;  1KKQ A;  1YY4 A;  4IWC A;  3WJ4 A;  3X1H A;  3H0A A;  2HCD A;  4M8H A;  4RUO X;  4ZO1 X;  1T7R A;  4IW8 A;  4XLD A;  1OVL B;  2QNV A;  3R8I A;  1ERR A;  2LBD A;  4MGD B;  4POH A;  3TKC A;  5HCV A;  3ADX A;  4CSJ A;  2QA8 A;  3P89 A;  4R06 A;  1RDT D;  3OZJ A;  4JYI A;  3IPQ A;  2ZXZ A;  3PCU A;  2PIO A;  1RK3 A;  5DVV A;  2PIX A;  3D24 A;  3UP0 A;  5DXB B;  3GN8 A;  2P4Y A;  2GPP A;  1L2J A;  2Q5G A;  2AX9 A;  2VV2 A;  3ET2 A;  4MGA B;  5GT4 A;  3H52 A;  3ZQT A;  1UOM A;  3R29 A;  4DMA A;  5EIT A;  3OKI A;  2XYJ A;  5APK A;  3KPZ A;  4JYH A;  3NSQ A;  1NUO A;  4WLB A;  2VSR A;  3D90 A;  2OVH A;  4S15 A;  3OS8 C;  2Q6S A;  5DZI A;  2NPA A;  5K13 A;  4N5G A;  4QE8 A;  4J5X C;  2Q7I A;  4OJ4 A;  5AVL A;  1XDK B;  3AZ3 A;  1NAX A;  5G43 A;  1ZEO A;  3HC6 A;  4MGC A;  5G44 A;  2R6Y A;  3K22 A;  5AWK A;  2I0G A;  2P1T A;  2PIW A;  3KDT A;  1XP1 A;  3Q95 B;  1YUC A;  2QXS A;  4JYG A;  5C4S A;  2AO6 A;  4ZJW A;  3S9S A;  1XVP A;  4CI4 A;  1XOW A;  3K6P A;  2ZXN A;  1OSH A;  4OEZ A;  5EI1 A;  4OJB A;  4RWV A;  3AN3 A;  5AAV A;  2P1V A;  3AUN A;  4LSJ A;  4OH6 A;  4OIV A;  1GWX A;  1K74 A;  4N8R A;  3FEI A;  4XUH A;  4PVU A;  1KNU A;  1X7B A;  1M13 A;  2GIU A;  4MGB B;  4IVW A;  3IXP A;  4ONI A;  4PP6 A;  1IE9 A;  5DZ3 A;  5DY8 A;  4OKT A;  5EC9 A;  4DK7 A;  4PRG A;  5DWG A;  3E00 A;  1DKF A;  4IA2 A;  3ET3 A;  3ERD A;  4N1Y A;  4R6S A;  5DI7 A;  3UVV A;  1I7I A;  5AAU A;  1TXI A;  2PIU A;  5KYJ A;  2O4R A;  2Q6J A;  5FQV A;  2HC4 A;  1HJ1 A;  3B65 A;  4OZT U;  2G5O A;  3RLL A;  2GL8 A;  1OSV A;  2ZAS A;  3AUR A;  3W0G A;  4F9M A;  3A9E B;  1XV9 B;  3A2I A;  1T65 A;  2AYR A;  1H9U A;  2JFA A;  3K8S A;  3NSP A;  1S9Q A;  1WM0 X;  5DZH A;  2AMA A;  3WT5 A;  3F5C A;  5DKG A;  3B67 A;  1EXA A;  4IU7 A;  1RJK A;  1Z95 A;  2ZK5 A;  5AK2 A;  1ZH7 A;  3FAL A;  1R5K A;  4G20 A;  1LBD A;  3FXV A;  1XB7 A;  4MG9 B;  1I7G A;  3ADT A;  4OLM A;  3WT7 A;  2Q59 B;  2QH6 A;  1YYE A;  3B0Q A;  3FC6 A;  3VT6 A;  1ZDT A;  1XP6 A;  2V7C A;  4S0T A;  2J14 A;  1PCG A;  1RDT A;  2QGT A;  2QR9 A;  4RUJ A;  2W8Y A;  4TUZ B;  3R2A A;  5DP0 A;  2E2R A;  2QA6 A;  5EHJ A;  3U9Q A;  4ZN7 A;  2REW A;  3LBD A;  5APJ A;  3CS8 A;  3CDP A;  5EJV A;  4OC7 A;  3OSI A;  4ZJR A;  3LMP A;  2YLP A;  4ZOM A;  2BJ4 A;  3HC5 A;  3OLF A;  5C4T A;  4JAZ A;  3K23 A;  3WT6 A;  3ERT A;  2JF9 A;  1NAV A;  1MV9 A;  2XKW A;  2Q70 A;  2Q6R A;  1Z5X E;  4KZM A;  2OM9 A;  3UUA B;  1MVC A;  4OKW A;  3HLV A;  3KMZ A;  3GWX A;  2ACL B;  3L3Z A;  2PNU A;  4QK4 A;  2HB8 A;  4IV4 A;  3X31 A;  4PPP A;  4TV1 A;  3VT9 A;  3R5N A;  1T73 A;  4IA1 A;  2QAB A;  3V9Y A;  5KCD A;  3VSP A;  2GP7 A;  3PO9 A;  3W0C A;  3WMH A;  1FD0 A;  2QZO B;  3QT0 A;  1N83 A;  3W5P A;  1FBY A;  1M7W A;  4ZN9 A;  2ZL9 A;  2QTU A;  1S9P A;  2V0V A;  4G2I A;  2ZK4 A;  2PIV A;  2IOK A;  4ZNS A;  5KRA A;  3UUD B;  4PP3 A;  3UU7 B;  4ZNH A;  3OSW A;  1Y0S A;  2ZK6 A;  4B7W A;  5JY3 A;  1X7E A;  4PF3 A;  3GZ9 A;  2P7A A;  4PLD A;  4RMD A;  4KZI A;  5DXE A;  2JJ3 A;  3VT7 A;  5DSH A;  3PRG A;  3FS1 A;  5F9B A;  3VJS A;  2HVC A;  3PLZ A;  3DCU A;  4DQM A;  3CTB A;  3A78 A;  1Y9R A;  4OIU A;  3HOD A;  4ITF A;  5JI0 D;  2HFP A;  3OOK A;  3A40 X;  4KZJ A;  1RKH A;  3OAP A;  1U9E A;  2OUZ A;  2AA5 A;  3DCT A;  3DZY D;  3WFF A;  4IWF A;  3X1I A;  2PIQ A;  4XHD A;  4K7A A;  3G0W A;  5JJM B;  5DMF A;  3SZ1 A;  1UPW A;  1GWR A;  4RME A;  2GPU A;  3OMM A;  3T03 A;  3EYB A;  2PKL A;  3UUC A;  5KRO A;  1I37 A;  1R20 A;  1X7J A;  1NQ7 A;  5CJ6 A;  3B5R A;  5E1C A;  4MG8 A;  1YJE A;  4NB6 A;  3KWY A;  4J26 A;  4L96 A;  4WHF A;  1Z5X U;  3OKH A;  3VRT A;  4K6I A;  4HEE X;  5DKS A;  2AX7 A;  3IA6 A;  2QPY A;  4XTA A;  2Z4J A;  5DXM A;  5L11 A;  4IA7 A;  2HAR A;  2AWH A;  3OLL A;  1R6G A;  3HO0 A;  3OMP A;  3VT5 A;  4RZE A;  4WPF A;  2HAS A;  3VN2 A;  3SP9 A;  2VST A;  2VV4 A;  2NXX A;  2J4A A;  5E7V A;  2YJD A;  4IUI A;  3RY9 A;  1K7L A;  4OZR E;  5EGV A;  3E7C A;  2PJL A;  5KR9 A;  4UDA A;  1ZGY A;  3P8X A;  2ZK1 A;  5DKB A;  3W0A A;  2O9I A;  1UHL A;  2R40 D;  5DMC A;  1NDE A;  1MZN A;  4J24 A;  5I4V A;  1FCY A;  2IOG A;  3DY6 A;  4G2H A;  3WJ5 A;  4MG5 A;  5KRH A;  1P8D A;  3VT4 A;  1NQ1 A;  1DB1 A;  3E94 A;  4OGH A;  1LV2 A;  3W0I A;  1TFC A;  5AYG A;  1XQ3 A;  1G5Y A;  2VV1 A;  3VT3 A;  2AAX A;  1I38 A;  1U3R A;  3D57 A;  5H1E A;  4EM9 A;  3HM1 A;  2ATH A;  2ZNO A;  4DOR A;  1FM9 A;  2PRG A;  5KRK A;  1FM6 D;  2YAT A;  2ZNN A;  4QM0 A;  3VRU A;  2PIR A;  1S0X A;  3G9E A;  2I4J A;  2QSE A;  4O8F A;  1XLS E;  2GPV A;  1U3Q A;  4OKB A;  3RUU A;  1YIN A;  4PLE A;  4P6X A;  3AX8 A;  1S0Z A;  2HB7 A;  2FAI A;  3OS9 A;  1VJB A;  1T79 A;  1PQ6 A;  5AWJ A;  3O1E A;  2P7G A;  3OGT A;  5HJP A;  2AM9 A;  4OFR A;  3V9V A;  2F4B A;  4E4Q A;  4MG7 B;  5FQR A;  3DR1 A;  5AVI A;  5LGA A;  4G1D A;  1KV6 A;  2PIT A;  1SKX A;  5DRM A;  3VHU A;  5DUH A;  5KRF A;  2XHS A;  3WFG A;  2QA8 B;  4PP5 A;  4POJ A;  5IAW A;  1GWQ A;  5DX3 A;  1E3K A;  3V3E A;  3IPS A;  2ZNQ A;  5KYA A;  1YA3 A;  1ZAF A;  4XAO A;  3W0H A;  2B1V A;  3IPU A;  2ZK2 A;  3GBK A;  3ZRB A;  2J7Y A;  3ADS A;  5KCW A;  2H79 A;  1SR7 A;  4Q13 A;  4OZR U;  4OAR A;  5DXK A;  1XZX X;  5KRC A;  3ADV A;  4REF A;  1OVL A;  3AUQ A;  2AB2 A;  4MGD A;  5GID A;  2ZY0 A;  4X1G A;  3VT8 A;  2QXM A;  3BEJ A;  3PBA A;  2J7X A;  1XAP A;  1SQN A;  1L2I A;  4QE6 A;  5KD9 A;  2ZK0 A;  4UDC A;  4Q50 A;  3V4A A;  3A2J A;  1XNX A;  5E15 A;  5DXB A;  3VI8 A;  1YIM A;  2VV3 A;  3OMO A;  4ZNT A;  3TX7 B;  4PXM A;  4MGA A;  3VRV A;  2OAX A;  5E19 A;  5LWP A;  1UPV A;  4J5W A;  5HZC A;  1U3S A;  5KCF A;  3AN4 A;  2YJA B;  5C4U A;  1XVP B;  1R1K D;  4FN9 A;  4XI3 A;  5DL4 A;  3GYT A;  5HJS A;  4DK8 A;  2B1Z A;  1YOK A;  2R40 A;  2ZLA A;  4DOS A;  4RE8 A;  5DWE A;  3L3X A;  1YOW A;  3RVF A;  4A2J A;  3X36 A;  5AAV B;  5AZV A;  2G0G A;  2BAW A;  2Q60 A;  4FGY A;  2GTK A;  1XDK A;  2I4P A;  3KFC A;  1FCZ A;  2AX6 A;  1DKF B;  1G1U A;  3B0T A;  3L03 A;  3L1B A;  3UVV B;  2Z4B A;  3CJW A;  3OLS A;  4OFU A;  3Q95 A;  3HQ5 A;  1PQC A;  1FM6 A;  1XJ7 A;  1SJ0 A;  3VJH A;  4G1Z A;  4S0S A;  2JFA B;  4FHI A;  5DID A;  3JZC A;  5DYD A;  3W0Y A;  4ZNU A;  5C4O A;  5B5B A;  3HZF A;  1ZDU A;  3F5C B;  4IS8 A;  2Q7K A;  3FEJ A;  3WGP A;  4MGB A;  4JL4 A;  5DXP A;  5DKE A;  1T63 A;  2GWX A;  3TY0 A;  2Q61 A;  3GD2 A;  1NYX A;  2Q5P A;  1OT7 A;  2B50 A;  4LNW A;  2G44 A;  3B68 A;  1T7M A;  5G5W A;  2ABI A;  4M8E A;  2XYX A;  3GYU A;  5ETH A;  1QKN A;  2ZVT A;  3FC6 B;  3W5Q A;  1ERE A;  4OEA A;  3W5R A;  4UDB A;  3R5M A;  3A9E A;  4P6W A;  1XV9 A; 
#chains in the Genus database with same CATH homology
 3DZU D;  4RZG A;  5KRI A;  5GIC A;  2QMV A;  1T74 A;  4IW6 A;  5E0X A;  4HLW A;  4LNX A;  4Q0A C;  2G0H A;  2QGW A;  2ZNP A;  4L98 A;  5DV8 A;  2ZLC A;  3W0J A;  2YHD A;  3CS6 A;  4MG9 A;  2BJ4 B;  1PDU A;  2FVJ A;  1G50 A;  1PK5 A;  3HVL A;  1T76 A;  2Q59 A;  3KYT A;  1N4H A;  1XP9 A;  3FUG A;  2ZKC A;  2A3I A;  5DU5 A;  5AZT A;  3TKM A;  1P93 A;  3D5F A;  1QKM A;  5KCE A;  4TUZ A;  3VJT A;  4MDD A;  5DRJ A;  5DVC A;  3VJI A;  1HG4 A;  5DIE A;  4RZF A;  3IMY A;  2EWP A;  4E2J A;  1PQ9 A;  1T7T A;  5G45 A;  5ICK A;  3ADW A;  3V49 A;  4FNE A;  4G1Y A;  4TV1 B;  5KCT A;  3KMG A;  5KCU A;  2ZK3 A;  3SP6 A;  3O1D A;  1NRL A;  4FHH A;  1R1K A;  5DXQ A;  3VSO A;  1M2Z A;  3ILZ A;  1ILH A;  2AA6 A;  5DK9 A;  3UUA A;  2AX8 A;  2I0J A;  5DWL A;  3VTD A;  5APH A;  3ZR7 A;  3MNP A;  1T5Z A;  3OS8 A;  4ITE A;  2ZXM A;  4NIE A;  1PRG A;  5DWJ A;  3NOA A;  1NHZ A;  4NQA B;  3VHW A;  1E3G A;  4J5X A;  4QJR A;  2ACL A;  5KCC A;  3ET0 A;  3W5T A;  2YFE A;  4PPS A;  2QW4 A;  4ZNV A;  3B3K A;  3DT3 A;  3OSA A;  1YP0 A;  2XYW A;  2OVM A;  2Q8S A;  5DWI A;  4APU A;  4LTW A;  2OCF A;  5ACC A;  2HBH A;  5DUG A;  4ZO1 B;  2YLY A;  4NUF A;  1T7F A;  2QZO A;  4WQP A;  4XT9 A;  5L7H A;  2ZMJ A;  1ZUC A;  3GWS X;  2GPO A;  1RKG A;  1EXX A;  4WHG A;  4OIL A;  4XUM A;  3CQV A;  4QL8 A;  3UUD A;  3UU7 A;  2PIN A;  3CDS A;  1G2N A;  1XPC A;  3A2H A;  3FUR A;  4X1F A;  4EMA A;  3DZY A;  4YNK A;  4RAK A;  2Q7J A;  3VHV A;  3WWR A;  2ZBS A;  1K4W A;  1NQ0 A;  3V9T A;  3VTB A;  2I4Z A;  2ZMI A;  5FQS A;  4G21 A;  4ZI1 A;  3KDU A;  1IE8 A;  2PIP L;  2YLO A;  2P15 A;  3CWD A;  4WVD A;  5HYK A;  4NY9 A;  2AXA A;  4MG8 B;  1XQC A;  2HWQ A;  2POB A;  5E14 A;  5DYB A;  2OZ7 A;  3H0A D;  4OEY A;  3DZU A;  3UP3 A;  2B23 A;  3AZ2 A;  3FLI A;  3AZ1 A;  2YLQ A;  1Y0X X;  5DVS A;  3ZRA A;  4DM6 A;  3B1M A;  4IVY A;  4IV2 A;  4R2U A;  5JJM A;  2O4J A;  3BC5 A;  3RLJ A;  4OED A;  3VRW A;  1R20 D;  5DLR A;  2R6W A;  2VV4 B;  5DV3 A;  3PEQ A;  1ZKY A;  1ILG A;  5DZ1 A;  2HAM A;  3P88 A;  4OKX A;  4DM8 A;  3G8O A;  3B66 A;  1FCX A;  3KBA A;  2AA2 A;  3KMR A;  1PZL A;  4CI5 A;  1Q4X A;  2Q3Y A;  5DV6 A;  4J5W C;  3B0R A;  3D6D A;  4ZNW A;  1NQ2 A;  3F7D A;  2P54 A;  1UHL B;  3MNE A;  3L0E A;  4S14 A;  4E4K A;  5E0W A;  4A4V A;  2HWR A;  4RUP A;  4MG6 A;  3R8A A;  3L0L A;  3VTC A;  4K4J A;  5DIG A;  5G46 A;  4UDD A;  3OZ0 A;  2AMB A;  2NXX E;  5IXK A;  2Q7L A;  5HYR A;  5FQP A;  1X7R A;  2VV1 B;  5DXR A;  1X76 A;  2Q1H A;  1BSX A;  1N46 A;  2P1U A;  4JGV A;  2ZFX A;  4IQR A;  4OH5 A;  4YMQ A;  5L7G A;  3OOF A;  4N73 A;  3AFR A;  3OMK A;  2AA7 A;  3ET1 A;  3MNO A;  2VV0 A;  5GIE A;  5DZ0 A;  5G3J A;  3B0W A;  3OMQ A;  1XIU A;  1XLS A;  4LBD A;  1K74 D;  4YT1 A;  5DXG A;  3JZB A;  3CS4 A;  2Q1V A;  5B41 A;  3IXP D;  3WTQ A;  2H77 A;  3BQD A;  5HJP B;  3E00 D;  4PWL A;  4Y29 A;  4A4W A;  5DUE A;  3FAL B;  4IA3 A;  5FQT A;  1FM9 D;  2FSZ A;  2ZMH A;  1QKU A;  2POG A;  5G42 A;  5KRM A;  4BCR A;  3M7R A;  2NV7 A;  4RMC A;  3L0J A;  4OHA A;  1XNN A;  2QE4 A;  3CLD A;  3N00 A;  5DTV A;  5IZ0 A;  5KRJ A;  1A28 A;  5M96 A;  4REE A;  5L7E A;  5DX3 B;  3V3Q A;  4YPQ A;  2NW4 A;  4OK1 A;  3ADU A;  2IHQ A;  3G8I A;  5A86 A;  1QKT A;  1YMT A;  3R8D A;  1S19 A;  2Q5S A;  5KRL A;  5SYZ A;  4RFW A;  3RUT A;  3P0U A;  1GS4 A;  3A3Z X;  4OJ9 A;  2P7Z A;  4MG7 A;  1A52 A;  1X78 A;  4OZT E;  1KKQ A;  1YY4 A;  4IWC A;  3WJ4 A;  3X1H A;  3H0A A;  2HCD A;  4M8H A;  4RUO X;  4ZO1 X;  1T7R A;  4IW8 A;  4XLD A;  1OVL B;  2QNV A;  3R8I A;  1ERR A;  2LBD A;  4MGD B;  4POH A;  3TKC A;  5HCV A;  3ADX A;  4CSJ A;  2QA8 A;  3P89 A;  4R06 A;  1RDT D;  3OZJ A;  4JYI A;  3IPQ A;  2ZXZ A;  3PCU A;  2PIO A;  1RK3 A;  5DVV A;  2PIX A;  3D24 A;  3UP0 A;  5DXB B;  3GN8 A;  2P4Y A;  2GPP A;  1L2J A;  2Q5G A;  2AX9 A;  2VV2 A;  3ET2 A;  4MGA B;  5GT4 A;  3H52 A;  3ZQT A;  1UOM A;  3R29 A;  4DMA A;  5EIT A;  3OKI A;  2XYJ A;  5APK A;  3KPZ A;  4JYH A;  3NSQ A;  1NUO A;  4WLB A;  2VSR A;  3D90 A;  2OVH A;  4S15 A;  3OS8 C;  2Q6S A;  5DZI A;  2NPA A;  5K13 A;  4N5G A;  4QE8 A;  4J5X C;  2Q7I A;  4OJ4 A;  5AVL A;  1XDK B;  3AZ3 A;  1NAX A;  5G43 A;  1ZEO A;  3HC6 A;  4MGC A;  5G44 A;  2R6Y A;  3K22 A;  5AWK A;  2I0G A;  2P1T A;  2PIW A;  3KDT A;  1XP1 A;  3Q95 B;  1YUC A;  2QXS A;  4JYG A;  5C4S A;  2AO6 A;  4ZJW A;  3S9S A;  1XVP A;  4CI4 A;  1XOW A;  3K6P A;  2ZXN A;  1OSH A;  4OEZ A;  5EI1 A;  4OJB A;  4RWV A;  3AN3 A;  5AAV A;  2P1V A;  3AUN A;  4LSJ A;  4OH6 A;  4OIV A;  1GWX A;  1K74 A;  4N8R A;  3FEI A;  4XUH A;  4PVU A;  1KNU A;  1X7B A;  1M13 A;  2GIU A;  4MGB B;  4IVW A;  3IXP A;  4ONI A;  4PP6 A;  1IE9 A;  5DZ3 A;  5DY8 A;  4OKT A;  5EC9 A;  4DK7 A;  4PRG A;  5DWG A;  3E00 A;  1DKF A;  4IA2 A;  3ET3 A;  3ERD A;  4N1Y A;  4R6S A;  5DI7 A;  3UVV A;  1I7I A;  5AAU A;  1TXI A;  2PIU A;  5KYJ A;  2O4R A;  2Q6J A;  5FQV A;  2HC4 A;  1HJ1 A;  3B65 A;  4OZT U;  2G5O A;  3RLL A;  2GL8 A;  1OSV A;  2ZAS A;  3AUR A;  3W0G A;  4F9M A;  3A9E B;  1XV9 B;  3A2I A;  1T65 A;  2AYR A;  1H9U A;  2JFA A;  3K8S A;  3NSP A;  1S9Q A;  1WM0 X;  5DZH A;  2AMA A;  3WT5 A;  3F5C A;  5DKG A;  3B67 A;  1EXA A;  4IU7 A;  1RJK A;  1Z95 A;  2ZK5 A;  5AK2 A;  1ZH7 A;  3FAL A;  1R5K A;  4G20 A;  1LBD A;  3FXV A;  1XB7 A;  4MG9 B;  1I7G A;  3ADT A;  4OLM A;  3WT7 A;  2Q59 B;  2QH6 A;  1YYE A;  3B0Q A;  3FC6 A;  3VT6 A;  1ZDT A;  1XP6 A;  2V7C A;  4S0T A;  2J14 A;  1PCG A;  1RDT A;  2QGT A;  2QR9 A;  4RUJ A;  2W8Y A;  4TUZ B;  3R2A A;  5DP0 A;  2E2R A;  2QA6 A;  5EHJ A;  3U9Q A;  4ZN7 A;  2REW A;  3LBD A;  5APJ A;  3CS8 A;  3CDP A;  5EJV A;  4OC7 A;  3OSI A;  4ZJR A;  3LMP A;  2YLP A;  4ZOM A;  2BJ4 A;  3HC5 A;  3OLF A;  5C4T A;  4JAZ A;  3K23 A;  3WT6 A;  3ERT A;  2JF9 A;  1NAV A;  1MV9 A;  2XKW A;  2Q70 A;  2Q6R A;  1Z5X E;  4KZM A;  2OM9 A;  3UUA B;  1MVC A;  4OKW A;  3HLV A;  3KMZ A;  3GWX A;  2ACL B;  3L3Z A;  2PNU A;  4QK4 A;  2HB8 A;  4IV4 A;  3X31 A;  4PPP A;  4TV1 A;  3VT9 A;  3R5N A;  1T73 A;  4IA1 A;  2QAB A;  3V9Y A;  5KCD A;  3VSP A;  2GP7 A;  3PO9 A;  3W0C A;  3WMH A;  1FD0 A;  2QZO B;  3QT0 A;  1N83 A;  3W5P A;  1FBY A;  1M7W A;  4ZN9 A;  2ZL9 A;  2QTU A;  1S9P A;  2V0V A;  4G2I A;  2ZK4 A;  2PIV A;  2IOK A;  4ZNS A;  5KRA A;  3UUD B;  4PP3 A;  3UU7 B;  4ZNH A;  3OSW A;  1Y0S A;  2ZK6 A;  4B7W A;  5JY3 A;  1X7E A;  4PF3 A;  3GZ9 A;  2P7A A;  4PLD A;  4RMD A;  4KZI A;  5DXE A;  2JJ3 A;  3VT7 A;  5DSH A;  3PRG A;  3FS1 A;  5F9B A;  3VJS A;  2HVC A;  3PLZ A;  3DCU A;  4DQM A;  3CTB A;  3A78 A;  1Y9R A;  4OIU A;  3HOD A;  4ITF A;  5JI0 D;  2HFP A;  3OOK A;  3A40 X;  4KZJ A;  1RKH A;  3OAP A;  1U9E A;  2OUZ A;  2AA5 A;  3DCT A;  3DZY D;  3WFF A;  4IWF A;  3X1I A;  2PIQ A;  4XHD A;  4K7A A;  3G0W A;  5JJM B;  5DMF A;  3SZ1 A;  1UPW A;  1GWR A;  4RME A;  2GPU A;  3OMM A;  3T03 A;  3EYB A;  2PKL A;  3UUC A;  5KRO A;  1I37 A;  1R20 A;  1X7J A;  1NQ7 A;  5CJ6 A;  3B5R A;  5E1C A;  4MG8 A;  1YJE A;  4NB6 A;  3KWY A;  4J26 A;  4L96 A;  4WHF A;  1Z5X U;  3OKH A;  3VRT A;  4K6I A;  4HEE X;  5DKS A;  2AX7 A;  3IA6 A;  2QPY A;  4XTA A;  2Z4J A;  5DXM A;  5L11 A;  4IA7 A;  2HAR A;  2AWH A;  3OLL A;  1R6G A;  3HO0 A;  3OMP A;  3VT5 A;  4RZE A;  4WPF A;  2HAS A;  3VN2 A;  3SP9 A;  2VST A;  2VV4 A;  2NXX A;  2J4A A;  5E7V A;  2YJD A;  4IUI A;  3RY9 A;  1K7L A;  4OZR E;  5EGV A;  3E7C A;  2PJL A;  5KR9 A;  4UDA A;  1ZGY A;  3P8X A;  2ZK1 A;  5DKB A;  3W0A A;  2O9I A;  1UHL A;  2R40 D;  5DMC A;  1NDE A;  1MZN A;  4J24 A;  5I4V A;  1FCY A;  2IOG A;  3DY6 A;  4G2H A;  3WJ5 A;  4MG5 A;  5KRH A;  1P8D A;  3VT4 A;  1NQ1 A;  1DB1 A;  3E94 A;  4OGH A;  1LV2 A;  3W0I A;  1TFC A;  5AYG A;  1XQ3 A;  1G5Y A;  2VV1 A;  3VT3 A;  2AAX A;  1I38 A;  1U3R A;  3D57 A;  5H1E A;  4EM9 A;  3HM1 A;  2ATH A;  2ZNO A;  4DOR A;  1FM9 A;  2PRG A;  5KRK A;  1FM6 D;  2YAT A;  2ZNN A;  4QM0 A;  3VRU A;  2PIR A;  1S0X A;  3G9E A;  2I4J A;  2QSE A;  4O8F A;  1XLS E;  2GPV A;  1U3Q A;  4OKB A;  3RUU A;  1YIN A;  4PLE A;  4P6X A;  3AX8 A;  1S0Z A;  2HB7 A;  2FAI A;  3OS9 A;  1VJB A;  1T79 A;  1PQ6 A;  5AWJ A;  3O1E A;  2P7G A;  3OGT A;  5HJP A;  2AM9 A;  4OFR A;  3V9V A;  2F4B A;  4E4Q A;  4MG7 B;  5FQR A;  3DR1 A;  5AVI A;  5LGA A;  4G1D A;  1KV6 A;  2PIT A;  1SKX A;  5DRM A;  3VHU A;  5DUH A;  5KRF A;  2XHS A;  3WFG A;  2QA8 B;  4PP5 A;  4POJ A;  5IAW A;  1GWQ A;  5DX3 A;  1E3K A;  3V3E A;  3IPS A;  2ZNQ A;  5KYA A;  1YA3 A;  1ZAF A;  4XAO A;  3W0H A;  2B1V A;  3IPU A;  2ZK2 A;  3GBK A;  3ZRB A;  2J7Y A;  3ADS A;  5KCW A;  2H79 A;  1SR7 A;  4Q13 A;  4OZR U;  4OAR A;  5DXK A;  1XZX X;  5KRC A;  3ADV A;  4REF A;  1OVL A;  3AUQ A;  2AB2 A;  4MGD A;  5GID A;  2ZY0 A;  4X1G A;  3VT8 A;  2QXM A;  3BEJ A;  3PBA A;  2J7X A;  1XAP A;  1SQN A;  1L2I A;  4QE6 A;  5KD9 A;  2ZK0 A;  4UDC A;  4Q50 A;  3V4A A;  3A2J A;  1XNX A;  5E15 A;  5DXB A;  3VI8 A;  1YIM A;  2VV3 A;  3OMO A;  4ZNT A;  3TX7 B;  4PXM A;  4MGA A;  3VRV A;  2OAX A;  5E19 A;  5LWP A;  1UPV A;  4J5W A;  5HZC A;  1U3S A;  5KCF A;  3AN4 A;  2YJA B;  5C4U A;  1XVP B;  1R1K D;  4FN9 A;  4XI3 A;  5DL4 A;  3GYT A;  5HJS A;  4DK8 A;  2B1Z A;  1YOK A;  2R40 A;  2ZLA A;  4DOS A;  4RE8 A;  5DWE A;  3L3X A;  1YOW A;  3RVF A;  4A2J A;  3X36 A;  5AAV B;  5AZV A;  2G0G A;  2BAW A;  2Q60 A;  4FGY A;  2GTK A;  1XDK A;  2I4P A;  3KFC A;  1FCZ A;  2AX6 A;  1DKF B;  1G1U A;  3B0T A;  3L03 A;  3L1B A;  3UVV B;  2Z4B A;  3CJW A;  3OLS A;  4OFU A;  3Q95 A;  3HQ5 A;  1PQC A;  1FM6 A;  1XJ7 A;  1SJ0 A;  3VJH A;  4G1Z A;  4S0S A;  2JFA B;  4FHI A;  5DID A;  3JZC A;  5DYD A;  3W0Y A;  4ZNU A;  5C4O A;  5B5B A;  3HZF A;  1ZDU A;  3F5C B;  4IS8 A;  2Q7K A;  3FEJ A;  3WGP A;  4MGB A;  4JL4 A;  5DXP A;  5DKE A;  1T63 A;  2GWX A;  3TY0 A;  2Q61 A;  3GD2 A;  1NYX A;  2Q5P A;  1OT7 A;  2B50 A;  4LNW A;  2G44 A;  3B68 A;  1T7M A;  5G5W A;  2ABI A;  4M8E A;  2XYX A;  3GYU A;  5ETH A;  1QKN A;  2ZVT A;  3FC6 B;  3W5Q A;  1ERE A;  4OEA A;  3W5R A;  4UDB A;  3R5M A;  3A9E A;  4P6W A;  1XV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...