3X31A

Crystal structure of the human vitamin d receptor ligand binding domain complexed with 7,8-cis-14-epi-1a,25-dihydroxy-19-norvitamin d3
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
255
structure length
254
Chain Sequence
DSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Revisiting the 7,8-cis-vitamin D3 derivatives: synthesis, evaluating the biological activity, and study of the binding configuration
rcsb
molecule keywords Vitamin D3 receptor
molecule tags Transcription
source organism Homo sapiens
total genus 106
structure length 254
sequence length 255
ec nomenclature
pdb deposition date 2015-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3x31A00
1VJBA 2ZY0A 1FD0A 1RDTA 3AN3A 4PPPA 2W8YA 4S0TA 3V3QA 2AX9A 3V4AA 5KRFA 5KRCA 1XZXX 3MNOA 2VV2A 1IE9A 3AN4A 1XLSA 3G8IA 4REEA 5AK2A 2JF9A 1M13A 3G0WA 4WHFA 4XLDA 5B5BA 4DM8A 3S9SA 1H9UA 2PIWA 5DK9A 3X1IA 2POBA 5G42A 3W0IA 3X36A 4IWFA 1XNXA 2H79A 3OSAA 4LBDA 4M8HA 1PCGA 2FAIA 4IW8A 4N5GA 3KMGA 2Z4BA 5KCFA 1XAPA 1QKNA 3K23A 3VT9A 4JGVA 1XV9A 5DRMA 3GBKA 3OMKA 1M2ZA 2ACLA 2AX6A 3BEJA 4F9MA 3WJ4A 2G5OA 2PIOA 3CTBA 2Q7LA 2ZK3A 4QE6A 4RAKA 5KCWA 4PP6A 2OUZA 5DWGA 1XPCA 2ZNPA 3OS8A 4P6WA 5HJSA 5G5WA 4E2JA 2Q59B 1YOKA 5KYAA 5DV3A 1ZDUA 1X78A 5HYKA 4L96A 2JFAA 2PITA 4REFA 3FEIA 2GWXA 4G1DA 5APHA 1PK5A 2YLOA 5DXMA 2AO6A 5DKGA 2AB2A 5FQPA 1RDTD 5DIDA 3VJIA 5DKSA 4TV1A 2AX8A 3VTBA 3JZCA 5DXRA 3MNEA 5DWIA 4PF3A 4N8RA 5C4TA 4FNEA 4N73A 3WTQA 4TUZB 2V7CA 2J7YA 4K4JA 5DXEA 4J5WA 4OZRE 4PWLA 5DXPA 3F7DA 1K7LA 2JJ3A 3LMPA 5E7VA 2AMAA 4ZNUA 5GIEA 3V9TA 4ZJRA 2Q7KA 3DZYA 3BC5A 1GWQA 5KD9A 3B1MA 3NSPA 3UU7A 4OEDA 4DK8A 3NOAA 1P93A 1DB1A 1TFCA 5I4VA 3TX7B 2AA6A 2HWRA 4OKBA 2ZLAA 2P54A 2Q5SA 4UDDA 1X7RA 1XLSE 2NXXA 4PRGA 4WHGA 4MG9B 1U9EA 3L3XA 3ADVA 2PIRA 3W5RA 2OCFA 3OMPA 4XTAA 4IU7A 2NV7A 5DKEA 1FM9D 4A4VA 5L7EA 3VT6A 5LWPA 2P4YA 4KZIA 1NAXA 1DKFA 4OLMA 4IA1A 5KROA 4JAZA 2Q1HA 3WFFA 3O1EA 5G43A 1RJKA 4IVWA 5KCDA 4OKWA 5C4OA 4IVYA 2B23A 5DY8A 4QK4A 3O1DA 2YFEA 2QE4A 2ZK0A 3HO0A 2HASA 4OHAA 2ZMIA 2GTKA 2Q5GA 3KDTA 4OJ9A 3B0TA 4G2HA 3TY0A 1XV9B 1XVPA 1GWRA 2POGA 2R6WA 2ACLB 3ERDA 5DYBA 3WT5A 1PQ6A 1ZDTA 3GD2A 4IA2A 3VN2A 2Q3YA 2QR9A 4DM6A 2Q8SA 3L1BA 5DP0A 4J5XC 4EMAA 5HYRA 3OLLA 3DZYD 3FXVA 1MZNA 1OT7A 2QZOA 4KZMA 2ZK1A 4NIEA 4R2UA 3OMMA 1FBYA 3UUDA 3OOKA 4POJA 2BJ4A 3IPUA 2OVHA 3GWSX 1XQ3A 4OK1A 1PQCA 1K4WA 1YY4A 3B0QA 4G21A 4ONIA 4OZRU 5KRIA 1U3RA 2AA2A 3IXPA 4NQAB 2JFAB 2IOGA 2NPAA 2AYRA 2VV1A 4DMAA 3HVLA 2IOKA 2GPUA 5KRJA 4X1FA 3N00A 3RY9A 2PIUA 4TV1B 5AWJA 3DY6A 4ITEA 2P1UA 3T03A 3R5NA 3W0HA 2XKWA 4OJBA 4ZO1B 5DYDA 5G45A 1ZUCA 3TKMA 2NXXE 2QA8A 2OAXA 4G2IA 3Q95A 2PJLA 1IE8A 3JZBA 3ADUA 2HBHA 2Q5PA 1T7FA 1E3GA 1P8DA 3ZRAA 3UU7B 5DMFA 4QL8A 2B1ZA 3HC5A 4J24A 4UDBA 1YP0A 3B0WA 4OIUA 5EITA 3CDPA 3VI8A 2PIPL 1XP9A 4S15A 1RKHA 2PINA 5DVSA 5K13A 5AVIA 2AMBA 3E00A 1UOMA 1R5KA 3FUGA 3L0LA 2Q6RA 2ZK5A 3OLFA 3R29A 3P89A 4PPSA 1T7RA 3CJWA 5DLRA 5HJPA 1I7GA 2Q7JA 1DKFB 5DXGA 2ZVTA 3IXPD 3WGPA 1FCZA 1PZLA 1T7MA 2LBDA 4MG8A 2Q6JA 1LBDA 1FM6A 5IAWA 2P15A 4YT1A 1M7WA 1SJ0A 1X7EA 1XJ7A 4N1YA 1RKGA 5F9BA 3ADSA 1A52A 1Q4XA 4MG5A 2O4RA 2PKLA 3KWYA 3L03A 2HCDA 2HWQA 4IA3A 1ILGA 4OJ4A 4E4QA 1PRGA 3L3ZA 1X76A 2ZBSA 4OFUA 2GIUA 2P1TA 4RUJA 4ZNWA 3B67A 1N83A 1YA3A 1UHLA 5G3JA 4BCRA 5FQRA 1MVCA 4X1GA 3W0AA 1XVPB 4HLWA 3A40X 1KNUA 3KYTA 3OKIA 2Q6SA 2ZK6A 3P88A 1Z5XE 3ILZA 3OSWA 2QZOB 1T79A 2G44A 3NSQA 4R6SA 1XIUA 3UUDB 2BJ4B 5AZTA 2EWPA 3E00D 3W5TA 2ZXZA 2Q70A 5EC9A 2R40A 3VHVA 4L98A 1GS4A 2R6YA 2VV1B 3UP0A 5AVLA 3ZQTA 2Q7IA 4JYGA 4OZTE 3HC6A 1X7BA 5C4SA 1WM0X 4R06A 3PCUA 5E19A 2QGWA 1FM6D 3DCUA 1YUCA 2E2RA 5DZ3A 3IPSA 5JI0D 2AA7A 1S0ZA 5KCCA 1OSHA 4NUFA 5A86A 4IS8A 1Z95A 2QA8B 4ITFA 1NRLA 2AA5A 3HQ5A 2AAXA 3Q95B 3RLJA 4FGYA 2ATHA 1ZH7A 1G1UA 3FLIA 1YYEA 3R2AA 2YLYA 4IUIA 4PVUA 2VSRA 3VRWA 3FURA 4J5XA 4OEAA 3SP6A 2P7ZA 3HZFA 4RMDA 4DK7A 3UUAA 3QT0A 1EXXA 5DWLA 5APKA 3A2JA 4KZJA 4FHIA 4XAOA 5DUEA 3KDUA 2GP7A 4IW6A 2VV3A 4OC7A 5AAVA 3DCTA 1ZEOA 5DIGA 4POHA 3VT5A 1G2NA 4DOSA 5HJPB 3AUNA 3B5RA 2QGTA 4FHHA 2R40D 4XHDA 3LBDA 5DI7A 4MG8B 2ZXMA 2ZLCA 4K6IA 1KV6A 1XP6A 4RZGA 4PP5A 3VTCA 2YHDA 5DTVA 1FCYA 3KBAA 4IQRA 2XHSA 1K74A 2I4JA 2B50A 2ZKCA 4RZEA 2OZ7A 2ZNQA 4MGAA 3UUCA 1XDKA 2HVCA 2NW4A 5KR9A 3U9QA 1R1KA 1XP1A 1UHLB 2P7AA 2ZASA 4G1YA 5KRKA 3K8SA 2ABIA 4OZTU 3SZ1A 4K7AA 1ERRA 4XUMA 3CQVA 3IMYA 3K6PA 3OOFA 4MGBA 5DU5A 3W5PA 5KCEA 5E1CA 3OSIA 1UPVA 1Y9RA 3PEQA 3GZ9A 2QXSA 4QE8A 2PRGA 1PQ9A 4RMCA 1T5ZA 4ZI1A 2Q61A 3CS8A 4MG7A 3VT8A 1BSXA 3VSOA 3X1HA 1S9QA 3WT6A 3V49A 3UVVA 4CSJA 5CJ6A 4ZOMA 2G0HA 3FEJA 3KFCA 4RZFA 4YPQA 4OH6A 3FALA 5KCUA 3OS9A 3UP3A 1L2JA 2J4AA 2AXAA 2I4ZA 1NHZA 3OAPA 1GWXA 4ZNTA 1T65A 4M8EA 5JY3A 1NUOA 4CI4A 5DKBA 2P1VA 3TKCA 2QTUA 2YLPA 3W0YA 4MGCA 2PNUA 4IA7A 3P0UA 3VTDA 1HJ1A 2QMVA 5KRMA 5KRHA 5DZHA 4CI5A 3GWXA 1R1KD 5KRLA 1OVLA 1S9PA 3VRUA 1U3SA 3UUAB 4A2JA 2YJDA 2ZK2A 4B7WA 2GPPA 5AAVB 3VT3A 1QKMA 4ZN7A 3PBAA 5EHJA 1R20A 2I0GA 1Y0XX 2ZMJA 4PLEA 4Q50A 5DXBA 5E0XA 2VSTA 4ZO1X 1NQ2A 4JYHA 3R8DA 5DRJA 3VT7A 4E4KA 5DIEA 3VJTA 2F4BA 2OVMA 2QXMA 1LV2A 4OEZA 4WQPA 5DWJA 5GIDA 5B41A 3IA6A 3KPZA 3B68A 3GYUA 2PIVA 1QKTA 1YMTA 3B65A 3R8IA 3A9EA 3OKHA 3F5CA 4RWVA 3D24A 5AYGA 2HAMA 5DX3A 4MGAB 1SKXA 4P6XA 5GICA 1XDKB 3BQDA 1XNNA 1E3KA 3AUQA 1S0XA 1SQNA 1U3QA 1KKQA 4S14A 4YNKA 1YIMA 5DXKA 4G20A 4PP3A 2HARA 4OGHA 3OMQA 4PLDA 4Q0AC 1EXAA 2QNVA 4MGBB 2Q60A 1MV9A 3AZ3A 3AZ2A 5KCTA 1L2IA 2XYJA 5M96A 2ZL9A 4HEEX 2QABA 3ET2A 3VJHA 4XI3A 3VT4A 3VHUA 2HB7A 5LGAA 2AWHA 1NYXA 4MG7B 3P8XA 4RUOX 5E15A 2REWA 3V9YA 1R20D 2ZNOA 4IWCA 3WMHA 4RE8A 1I37A 3A2HA 4OIVA 3UVVB 1YINA 3KMZA 3K22A 4RUPA 4EM9A 1OSVA 5DVVA 1I7IA 2ZFXA 1ZGYA 3FALB 5HZCA 1YOWA 1R6GA 2Q1VA 3B0RA 4ZNSA 1QKUA 5KYJA 4UDAA 2P7GA 1HG4A 2GPVA 3B3KA 4Y29A 3PO9A 4JL4A 1FM9A 3G9EA 3L0EA 3WFGA 1PDUA 5H1EA 4OEYA 1G50A 2YATA 3VRVA 5DSHA 3ET3A 5ETHA 3ET1A 4MG6A 5IZ0A 4YMQA 3R8AA 1ZKYA 2HC4A 5JJMA 1OVLB 3GN8A 3VHWA 5ICKA 4ZN9A 2HB8A 3H0AA 3PRGA 5DZ0A 3FC6A 2ZXNA 5EGVA 3OZJA 2V0VA 4APUA 1TXIA 4QJRA 3WWRA 1I38A 4MGDA 4WPFA 3VJSA 5AZVA 5APJA 2QH6A 5FQVA 3CWDA 3M7RA 5DXBB 4ZNVA 3ET0A 5DUGA 1Y0SA 1N4HA 3D5FA 4WVDA 2J14A 3CLDA 3PLZA 1T76A 1XQCA 3G8OA 2O9IA 3HLVA 2PIQA 5C4UA 1Z5XU 3RVFA 3A2IA 1NDEA 2FSZA 1T73A 4OFRA 3HM1A 5L7HA 5SYZA 5KRAA 2VV4A 3A9EB 3F5CB 1N46A 4LNXA 3E7CA 4Q13A 5DV8A 3OS8C 4LTWA 3GYTA 5L11A 5DX3B 4O8FA 4ZJWA 4FN9A 1NQ0A 3D6DA 4JYIA 2ZK4A 4MDDA 1SR7A 1T7TA 4UDCA 3D57A 1NQ7A 3DR1A 3HODA 5GT4A 4IV4A 2GL8A 3AFRA 4NY9A 3V3EA 3DZUA 3D90A 3CS6A 5DZ1A 3DT3A 3H0AD 5DWEA 5G44A 1RK3A 2QW4A 4OILA 2H77A 1XOWA 2AX7A 4NB6A 3AX8A 4J5WC 2G0GA 1FCXA 3RUUA 4DORA 5EJVA 5FQTA 2J7XA 4J26A 4LSJA 1T74A 3OZ0A 4OKTA 2I4PA 4G1ZA 1UPWA 4RFWA 5FQSA 3VSPA 5E0WA 2YLQA 3KMRA 3OMOA 1S19A 3FS1A 5IXKA 2O4JA 4OARA 4XT9A 2QA6A 2GPOA 1EREA 2VV0A 3W0CA 1NAVA 1T63A 2XYXA 5E14A 3W5QA 5ACCA 3CS4A 1K74D 2Q59A 3MNPA 5DL4A 3W0JA 4ZNHA 3ERTA 3EYBA 4S0SA 3WT7A 1XB7A 5DZIA 5EI1A 3ZRBA 3OGTA 2OM9A 5DUHA 4OH5A 3ADWA 5JJMB 4XUHA 4A4WA 5AAUA 4QM0A 4RMEA 2QPYA 1A28A 2YJAB 2IHQA 1X7JA 2PIXA 1G5YA 1ILHA 3B66A 1YJEA 2B1VA 3FC6B 2ZMHA 3DZUD 4OKXA 3RUTA 2ZNNA 3ADXA 3CDSA 3OLSA 4TUZA 2I0JA 5L7GA 3AURA 4WLBA 4MGDB 3H52A 5DXQA 4IV2A 2HFPA 5DMCA 3WJ5A 5DVCA 3IPQA 4PXMA 3ZR7A 2FVJA 5G46A 3SP9A 2A3IA 3A78A 4LNWA 3AZ1A 5AWKA 2QSEA 5DV6A 3E94A 5HCVA 3ADTA 2VV4B 3L0JA 3X31A 3W0GA 4MG9A 1NQ1A 3V9VA 3VRTA 2XYWA 4DQMA 3R5MA 2BAWA 1ZAFA 2AM9A 3RLLA 2Z4JA 3A3ZX
chains in the Genus database with same CATH superfamily
1VJBA 2ZY0A 1FD0A 1RDTA 3AN3A 4PPPA 2W8YA 4S0TA 3V3QA 2AX9A 3V4AA 5KRFA 5KRCA 1XZXX 3MNOA 2VV2A 1IE9A 3AN4A 1XLSA 3G8IA 4REEA 5AK2A 2JF9A 1M13A 3G0WA 4WHFA 4XLDA 5B5BA 4DM8A 3S9SA 1H9UA 2PIWA 5DK9A 3X1IA 2POBA 5G42A 3W0IA 3X36A 4IWFA 1XNXA 2H79A 3OSAA 4LBDA 4M8HA 1PCGA 2FAIA 4IW8A 4N5GA 3KMGA 2Z4BA 5KCFA 1XAPA 1QKNA 3K23A 3VT9A 4JGVA 1XV9A 5DRMA 3GBKA 3OMKA 1M2ZA 2ACLA 2AX6A 3BEJA 4F9MA 3WJ4A 2G5OA 2PIOA 3CTBA 2Q7LA 2ZK3A 4QE6A 4RAKA 5KCWA 4PP6A 2OUZA 5DWGA 1XPCA 2ZNPA 3OS8A 4P6WA 5HJSA 5G5WA 4E2JA 2Q59B 1YOKA 5KYAA 5DV3A 1ZDUA 1X78A 5HYKA 4L96A 2JFAA 2PITA 4REFA 3FEIA 2GWXA 4G1DA 5APHA 1PK5A 2YLOA 5DXMA 2AO6A 5DKGA 2AB2A 5FQPA 1RDTD 5DIDA 3VJIA 5DKSA 4TV1A 2AX8A 3VTBA 3JZCA 5DXRA 3MNEA 5DWIA 4PF3A 4N8RA 5C4TA 4FNEA 4N73A 3WTQA 4TUZB 2V7CA 2J7YA 4K4JA 5DXEA 4J5WA 4OZRE 4PWLA 5DXPA 3F7DA 1K7LA 2JJ3A 3LMPA 5E7VA 2AMAA 4ZNUA 5GIEA 3V9TA 4ZJRA 2Q7KA 3DZYA 3BC5A 1GWQA 5KD9A 3B1MA 3NSPA 3UU7A 4OEDA 4DK8A 3NOAA 1P93A 1DB1A 1TFCA 5I4VA 3TX7B 2AA6A 2HWRA 4OKBA 2ZLAA 2P54A 2Q5SA 4UDDA 1X7RA 1XLSE 2NXXA 4PRGA 4WHGA 4MG9B 1U9EA 3L3XA 3ADVA 2PIRA 3W5RA 2OCFA 3OMPA 4XTAA 4IU7A 2NV7A 5DKEA 1FM9D 4A4VA 5L7EA 3VT6A 5LWPA 2P4YA 4KZIA 1NAXA 1DKFA 4OLMA 4IA1A 5KROA 4JAZA 2Q1HA 3WFFA 3O1EA 5G43A 1RJKA 4IVWA 5KCDA 4OKWA 5C4OA 4IVYA 2B23A 5DY8A 4QK4A 3O1DA 2YFEA 2QE4A 2ZK0A 3HO0A 2HASA 4OHAA 2ZMIA 2GTKA 2Q5GA 3KDTA 4OJ9A 3B0TA 4G2HA 3TY0A 1XV9B 1XVPA 1GWRA 2POGA 2R6WA 2ACLB 3ERDA 5DYBA 3WT5A 1PQ6A 1ZDTA 3GD2A 4IA2A 3VN2A 2Q3YA 2QR9A 4DM6A 2Q8SA 3L1BA 5DP0A 4J5XC 4EMAA 5HYRA 3OLLA 3DZYD 3FXVA 1MZNA 1OT7A 2QZOA 4KZMA 2ZK1A 4NIEA 4R2UA 3OMMA 1FBYA 3UUDA 3OOKA 4POJA 2BJ4A 3IPUA 2OVHA 3GWSX 1XQ3A 4OK1A 1PQCA 1K4WA 1YY4A 3B0QA 4G21A 4ONIA 4OZRU 5KRIA 1U3RA 2AA2A 3IXPA 4NQAB 2JFAB 2IOGA 2NPAA 2AYRA 2VV1A 4DMAA 3HVLA 2IOKA 2GPUA 5KRJA 4X1FA 3N00A 3RY9A 2PIUA 4TV1B 5AWJA 3DY6A 4ITEA 2P1UA 3T03A 3R5NA 3W0HA 2XKWA 4OJBA 4ZO1B 5DYDA 5G45A 1ZUCA 3TKMA 2NXXE 2QA8A 2OAXA 4G2IA 3Q95A 2PJLA 1IE8A 3JZBA 3ADUA 2HBHA 2Q5PA 1T7FA 1E3GA 1P8DA 3ZRAA 3UU7B 5DMFA 4QL8A 2B1ZA 3HC5A 4J24A 4UDBA 1YP0A 3B0WA 4OIUA 5EITA 3CDPA 3VI8A 2PIPL 1XP9A 4S15A 1RKHA 2PINA 5DVSA 5K13A 5AVIA 2AMBA 3E00A 1UOMA 1R5KA 3FUGA 3L0LA 2Q6RA 2ZK5A 3OLFA 3R29A 3P89A 4PPSA 1T7RA 3CJWA 5DLRA 5HJPA 1I7GA 2Q7JA 1DKFB 5DXGA 2ZVTA 3IXPD 3WGPA 1FCZA 1PZLA 1T7MA 2LBDA 4MG8A 2Q6JA 1LBDA 1FM6A 5IAWA 2P15A 4YT1A 1M7WA 1SJ0A 1X7EA 1XJ7A 4N1YA 1RKGA 5F9BA 3ADSA 1A52A 1Q4XA 4MG5A 2O4RA 2PKLA 3KWYA 3L03A 2HCDA 2HWQA 4IA3A 1ILGA 4OJ4A 4E4QA 1PRGA 3L3ZA 1X76A 2ZBSA 4OFUA 2GIUA 2P1TA 4RUJA 4ZNWA 3B67A 1N83A 1YA3A 1UHLA 5G3JA 4BCRA 5FQRA 1MVCA 4X1GA 3W0AA 1XVPB 4HLWA 3A40X 1KNUA 3KYTA 3OKIA 2Q6SA 2ZK6A 3P88A 1Z5XE 3ILZA 3OSWA 2QZOB 1T79A 2G44A 3NSQA 4R6SA 1XIUA 3UUDB 2BJ4B 5AZTA 2EWPA 3E00D 3W5TA 2ZXZA 2Q70A 5EC9A 2R40A 3VHVA 4L98A 1GS4A 2R6YA 2VV1B 3UP0A 5AVLA 3ZQTA 2Q7IA 4JYGA 4OZTE 3HC6A 1X7BA 5C4SA 1WM0X 4R06A 3PCUA 5E19A 2QGWA 1FM6D 3DCUA 1YUCA 2E2RA 5DZ3A 3IPSA 5JI0D 2AA7A 1S0ZA 5KCCA 1OSHA 4NUFA 5A86A 4IS8A 1Z95A 2QA8B 4ITFA 1NRLA 2AA5A 3HQ5A 2AAXA 3Q95B 3RLJA 4FGYA 2ATHA 1ZH7A 1G1UA 3FLIA 1YYEA 3R2AA 2YLYA 4IUIA 4PVUA 2VSRA 3VRWA 3FURA 4J5XA 4OEAA 3SP6A 2P7ZA 3HZFA 4RMDA 4DK7A 3UUAA 3QT0A 1EXXA 5DWLA 5APKA 3A2JA 4KZJA 4FHIA 4XAOA 5DUEA 3KDUA 2GP7A 4IW6A 2VV3A 4OC7A 5AAVA 3DCTA 1ZEOA 5DIGA 4POHA 3VT5A 1G2NA 4DOSA 5HJPB 3AUNA 3B5RA 2QGTA 4FHHA 2R40D 4XHDA 3LBDA 5DI7A 4MG8B 2ZXMA 2ZLCA 4K6IA 1KV6A 1XP6A 4RZGA 4PP5A 3VTCA 2YHDA 5DTVA 1FCYA 3KBAA 4IQRA 2XHSA 1K74A 2I4JA 2B50A 2ZKCA 4RZEA 2OZ7A 2ZNQA 4MGAA 3UUCA 1XDKA 2HVCA 2NW4A 5KR9A 3U9QA 1R1KA 1XP1A 1UHLB 2P7AA 2ZASA 4G1YA 5KRKA 3K8SA 2ABIA 4OZTU 3SZ1A 4K7AA 1ERRA 4XUMA 3CQVA 3IMYA 3K6PA 3OOFA 4MGBA 5DU5A 3W5PA 5KCEA 5E1CA 3OSIA 1UPVA 1Y9RA 3PEQA 3GZ9A 2QXSA 4QE8A 2PRGA 1PQ9A 4RMCA 1T5ZA 4ZI1A 2Q61A 3CS8A 4MG7A 3VT8A 1BSXA 3VSOA 3X1HA 1S9QA 3WT6A 3V49A 3UVVA 4CSJA 5CJ6A 4ZOMA 2G0HA 3FEJA 3KFCA 4RZFA 4YPQA 4OH6A 3FALA 5KCUA 3OS9A 3UP3A 1L2JA 2J4AA 2AXAA 2I4ZA 1NHZA 3OAPA 1GWXA 4ZNTA 1T65A 4M8EA 5JY3A 1NUOA 4CI4A 5DKBA 2P1VA 3TKCA 2QTUA 2YLPA 3W0YA 4MGCA 2PNUA 4IA7A 3P0UA 3VTDA 1HJ1A 2QMVA 5KRMA 5KRHA 5DZHA 4CI5A 3GWXA 1R1KD 5KRLA 1OVLA 1S9PA 3VRUA 1U3SA 3UUAB 4A2JA 2YJDA 2ZK2A 4B7WA 2GPPA 5AAVB 3VT3A 1QKMA 4ZN7A 3PBAA 5EHJA 1R20A 2I0GA 1Y0XX 2ZMJA 4PLEA 4Q50A 5DXBA 5E0XA 2VSTA 4ZO1X 1NQ2A 4JYHA 3R8DA 5DRJA 3VT7A 4E4KA 5DIEA 3VJTA 2F4BA 2OVMA 2QXMA 1LV2A 4OEZA 4WQPA 5DWJA 5GIDA 5B41A 3IA6A 3KPZA 3B68A 3GYUA 2PIVA 1QKTA 1YMTA 3B65A 3R8IA 3A9EA 3OKHA 3F5CA 4RWVA 3D24A 5AYGA 2HAMA 5DX3A 4MGAB 1SKXA 4P6XA 5GICA 1XDKB 3BQDA 1XNNA 1E3KA 3AUQA 1S0XA 1SQNA 1U3QA 1KKQA 4S14A 4YNKA 1YIMA 5DXKA 4G20A 4PP3A 2HARA 4OGHA 3OMQA 4PLDA 4Q0AC 1EXAA 2QNVA 4MGBB 2Q60A 1MV9A 3AZ3A 3AZ2A 5KCTA 1L2IA 2XYJA 5M96A 2ZL9A 4HEEX 2QABA 3ET2A 3VJHA 4XI3A 3VT4A 3VHUA 2HB7A 5LGAA 2AWHA 1NYXA 4MG7B 3P8XA 4RUOX 5E15A 2REWA 3V9YA 1R20D 2ZNOA 4IWCA 3WMHA 4RE8A 1I37A 3A2HA 4OIVA 3UVVB 1YINA 3KMZA 3K22A 4RUPA 4EM9A 1OSVA 5DVVA 1I7IA 2ZFXA 1ZGYA 3FALB 5HZCA 1YOWA 1R6GA 2Q1VA 3B0RA 4ZNSA 1QKUA 5KYJA 4UDAA 2P7GA 1HG4A 2GPVA 3B3KA 4Y29A 3PO9A 4JL4A 1FM9A 3G9EA 3L0EA 3WFGA 1PDUA 5H1EA 4OEYA 1G50A 2YATA 3VRVA 5DSHA 3ET3A 5ETHA 3ET1A 4MG6A 5IZ0A 4YMQA 3R8AA 1ZKYA 2HC4A 5JJMA 1OVLB 3GN8A 3VHWA 5ICKA 4ZN9A 2HB8A 3H0AA 3PRGA 5DZ0A 3FC6A 2ZXNA 5EGVA 3OZJA 2V0VA 4APUA 1TXIA 4QJRA 3WWRA 1I38A 4MGDA 4WPFA 3VJSA 5AZVA 5APJA 2QH6A 5FQVA 3CWDA 3M7RA 5DXBB 4ZNVA 3ET0A 5DUGA 1Y0SA 1N4HA 3D5FA 4WVDA 2J14A 3CLDA 3PLZA 1T76A 1XQCA 3G8OA 2O9IA 3HLVA 2PIQA 5C4UA 1Z5XU 3RVFA 3A2IA 1NDEA 2FSZA 1T73A 4OFRA 3HM1A 5L7HA 5SYZA 5KRAA 2VV4A 3A9EB 3F5CB 1N46A 4LNXA 3E7CA 4Q13A 5DV8A 3OS8C 4LTWA 3GYTA 5L11A 5DX3B 4O8FA 4ZJWA 4FN9A 1NQ0A 3D6DA 4JYIA 2ZK4A 4MDDA 1SR7A 1T7TA 4UDCA 3D57A 1NQ7A 3DR1A 3HODA 5GT4A 4IV4A 2GL8A 3AFRA 4NY9A 3V3EA 3DZUA 3D90A 3CS6A 5DZ1A 3DT3A 3H0AD 5DWEA 5G44A 1RK3A 2QW4A 4OILA 2H77A 1XOWA 2AX7A 4NB6A 3AX8A 4J5WC 2G0GA 1FCXA 3RUUA 4DORA 5EJVA 5FQTA 2J7XA 4J26A 4LSJA 1T74A 3OZ0A 4OKTA 2I4PA 4G1ZA 1UPWA 4RFWA 5FQSA 3VSPA 5E0WA 2YLQA 3KMRA 3OMOA 1S19A 3FS1A 5IXKA 2O4JA 4OARA 4XT9A 2QA6A 2GPOA 1EREA 2VV0A 3W0CA 1NAVA 1T63A 2XYXA 5E14A 3W5QA 5ACCA 3CS4A 1K74D 2Q59A 3MNPA 5DL4A 3W0JA 4ZNHA 3ERTA 3EYBA 4S0SA 3WT7A 1XB7A 5DZIA 5EI1A 3ZRBA 3OGTA 2OM9A 5DUHA 4OH5A 3ADWA 5JJMB 4XUHA 4A4WA 5AAUA 4QM0A 4RMEA 2QPYA 1A28A 2YJAB 2IHQA 1X7JA 2PIXA 1G5YA 1ILHA 3B66A 1YJEA 2B1VA 3FC6B 2ZMHA 3DZUD 4OKXA 3RUTA 2ZNNA 3ADXA 3CDSA 3OLSA 4TUZA 2I0JA 5L7GA 3AURA 4WLBA 4MGDB 3H52A 5DXQA 4IV2A 2HFPA 5DMCA 3WJ5A 5DVCA 3IPQA 4PXMA 3ZR7A 2FVJA 5G46A 3SP9A 2A3IA 3A78A 4LNWA 3AZ1A 5AWKA 2QSEA 5DV6A 3E94A 5HCVA 3ADTA 2VV4B 3L0JA 3X31A 3W0GA 4MG9A 1NQ1A 3V9VA 3VRTA 2XYWA 4DQMA 3R5MA 2BAWA 1ZAFA 2AM9A 3RLLA 2Z4JA 3A3ZX
chains in the Genus database with same CATH topology
1VJBA 2ZY0A 1FD0A 1RDTA 3AN3A 4PPPA 2W8YA 4S0TA 3V3QA 2AX9A 3V4AA 5KRFA 5KRCA 1XZXX 3MNOA 2VV2A 1IE9A 3AN4A 1XLSA 3G8IA 4REEA 5AK2A 2JF9A 1M13A 3G0WA 4WHFA 4XLDA 5B5BA 4DM8A 3S9SA 1H9UA 2PIWA 5DK9A 3X1IA 2POBA 5G42A 3W0IA 3X36A 4IWFA 1XNXA 2H79A 3OSAA 4LBDA 4M8HA 1PCGA 2FAIA 4IW8A 4N5GA 3KMGA 2Z4BA 5KCFA 1XAPA 1QKNA 3K23A 3VT9A 4JGVA 1XV9A 5DRMA 3GBKA 3OMKA 1M2ZA 2ACLA 2AX6A 3BEJA 4F9MA 3WJ4A 2G5OA 2PIOA 3CTBA 2Q7LA 2ZK3A 4QE6A 4RAKA 5KCWA 4PP6A 2OUZA 5DWGA 1XPCA 2ZNPA 3OS8A 4P6WA 5HJSA 5G5WA 4E2JA 2Q59B 1YOKA 5KYAA 5DV3A 1ZDUA 1X78A 5HYKA 4L96A 2JFAA 2PITA 4REFA 3FEIA 2GWXA 4G1DA 5APHA 1PK5A 2YLOA 5DXMA 2AO6A 5DKGA 2AB2A 5FQPA 1RDTD 5DIDA 3VJIA 5DKSA 4TV1A 2AX8A 3VTBA 3JZCA 5DXRA 3MNEA 5DWIA 4PF3A 4N8RA 5C4TA 4FNEA 4N73A 3WTQA 4TUZB 2V7CA 2J7YA 4K4JA 5DXEA 4J5WA 4OZRE 4PWLA 5DXPA 3F7DA 1K7LA 2JJ3A 3LMPA 5E7VA 2AMAA 4ZNUA 5GIEA 3V9TA 4ZJRA 2Q7KA 3DZYA 3BC5A 1GWQA 5KD9A 3B1MA 3NSPA 3UU7A 4OEDA 4DK8A 3NOAA 1P93A 1DB1A 1TFCA 5I4VA 3TX7B 2AA6A 2HWRA 4OKBA 2ZLAA 2P54A 2Q5SA 4UDDA 1X7RA 1XLSE 2NXXA 4PRGA 4WHGA 4MG9B 1U9EA 3L3XA 3ADVA 2PIRA 3W5RA 2OCFA 3OMPA 4XTAA 4IU7A 2NV7A 5DKEA 1FM9D 4A4VA 5L7EA 3VT6A 5LWPA 2P4YA 4KZIA 1NAXA 1DKFA 4OLMA 4IA1A 5KROA 4JAZA 2Q1HA 3WFFA 3O1EA 5G43A 1RJKA 4IVWA 5KCDA 4OKWA 5C4OA 4IVYA 2B23A 5DY8A 4QK4A 3O1DA 2YFEA 2QE4A 2ZK0A 3HO0A 2HASA 4OHAA 2ZMIA 2GTKA 2Q5GA 3KDTA 4OJ9A 3B0TA 4G2HA 3TY0A 1XV9B 1XVPA 1GWRA 2POGA 2R6WA 2ACLB 3ERDA 5DYBA 3WT5A 1PQ6A 1ZDTA 3GD2A 4IA2A 3VN2A 2Q3YA 2QR9A 4DM6A 2Q8SA 3L1BA 5DP0A 4J5XC 4EMAA 5HYRA 3OLLA 3DZYD 3FXVA 1MZNA 1OT7A 2QZOA 4KZMA 2ZK1A 4NIEA 4R2UA 3OMMA 1FBYA 3UUDA 3OOKA 4POJA 2BJ4A 3IPUA 2OVHA 3GWSX 1XQ3A 4OK1A 1PQCA 1K4WA 1YY4A 3B0QA 4G21A 4ONIA 4OZRU 5KRIA 1U3RA 2AA2A 3IXPA 4NQAB 2JFAB 2IOGA 2NPAA 2AYRA 2VV1A 4DMAA 3HVLA 2IOKA 2GPUA 5KRJA 4X1FA 3N00A 3RY9A 2PIUA 4TV1B 5AWJA 3DY6A 4ITEA 2P1UA 3T03A 3R5NA 3W0HA 2XKWA 4OJBA 4ZO1B 5DYDA 5G45A 1ZUCA 3TKMA 2NXXE 2QA8A 2OAXA 4G2IA 3Q95A 2PJLA 1IE8A 3JZBA 3ADUA 2HBHA 2Q5PA 1T7FA 1E3GA 1P8DA 3ZRAA 3UU7B 5DMFA 4QL8A 2B1ZA 3HC5A 4J24A 4UDBA 1YP0A 3B0WA 4OIUA 5EITA 3CDPA 3VI8A 2PIPL 1XP9A 4S15A 1RKHA 2PINA 5DVSA 5K13A 5AVIA 2AMBA 3E00A 1UOMA 1R5KA 3FUGA 3L0LA 2Q6RA 2ZK5A 3OLFA 3R29A 3P89A 4PPSA 1T7RA 3CJWA 5DLRA 5HJPA 1I7GA 2Q7JA 1DKFB 5DXGA 2ZVTA 3IXPD 3WGPA 1FCZA 1PZLA 1T7MA 2LBDA 4MG8A 2Q6JA 1LBDA 1FM6A 5IAWA 2P15A 4YT1A 1M7WA 1SJ0A 1X7EA 1XJ7A 4N1YA 1RKGA 5F9BA 3ADSA 1A52A 1Q4XA 4MG5A 2O4RA 2PKLA 3KWYA 3L03A 2HCDA 2HWQA 4IA3A 1ILGA 4OJ4A 4E4QA 1PRGA 3L3ZA 1X76A 2ZBSA 4OFUA 2GIUA 2P1TA 4RUJA 4ZNWA 3B67A 1N83A 1YA3A 1UHLA 5G3JA 4BCRA 5FQRA 1MVCA 4X1GA 3W0AA 1XVPB 4HLWA 3A40X 1KNUA 3KYTA 3OKIA 2Q6SA 2ZK6A 3P88A 1Z5XE 3ILZA 3OSWA 2QZOB 1T79A 2G44A 3NSQA 4R6SA 1XIUA 3UUDB 2BJ4B 5AZTA 2EWPA 3E00D 3W5TA 2ZXZA 2Q70A 5EC9A 2R40A 3VHVA 4L98A 1GS4A 2R6YA 2VV1B 3UP0A 5AVLA 3ZQTA 2Q7IA 4JYGA 4OZTE 3HC6A 1X7BA 5C4SA 1WM0X 4R06A 3PCUA 5E19A 2QGWA 1FM6D 3DCUA 1YUCA 2E2RA 5DZ3A 3IPSA 5JI0D 2AA7A 1S0ZA 5KCCA 1OSHA 4NUFA 5A86A 4IS8A 1Z95A 2QA8B 4ITFA 1NRLA 2AA5A 3HQ5A 2AAXA 3Q95B 3RLJA 4FGYA 2ATHA 1ZH7A 1G1UA 3FLIA 1YYEA 3R2AA 2YLYA 4IUIA 4PVUA 2VSRA 3VRWA 3FURA 4J5XA 4OEAA 3SP6A 2P7ZA 3HZFA 4RMDA 4DK7A 3UUAA 3QT0A 1EXXA 5DWLA 5APKA 3A2JA 4KZJA 4FHIA 4XAOA 5DUEA 3KDUA 2GP7A 4IW6A 2VV3A 4OC7A 5AAVA 3DCTA 1ZEOA 5DIGA 4POHA 3VT5A 1G2NA 4DOSA 5HJPB 3AUNA 3B5RA 2QGTA 4FHHA 2R40D 4XHDA 3LBDA 5DI7A 4MG8B 2ZXMA 2ZLCA 4K6IA 1KV6A 1XP6A 4RZGA 4PP5A 3VTCA 2YHDA 5DTVA 1FCYA 3KBAA 4IQRA 2XHSA 1K74A 2I4JA 2B50A 2ZKCA 4RZEA 2OZ7A 2ZNQA 4MGAA 3UUCA 1XDKA 2HVCA 2NW4A 5KR9A 3U9QA 1R1KA 1XP1A 1UHLB 2P7AA 2ZASA 4G1YA 5KRKA 3K8SA 2ABIA 4OZTU 3SZ1A 4K7AA 1ERRA 4XUMA 3CQVA 3IMYA 3K6PA 3OOFA 4MGBA 5DU5A 3W5PA 5KCEA 5E1CA 3OSIA 1UPVA 1Y9RA 3PEQA 3GZ9A 2QXSA 4QE8A 2PRGA 1PQ9A 4RMCA 1T5ZA 4ZI1A 2Q61A 3CS8A 4MG7A 3VT8A 1BSXA 3VSOA 3X1HA 1S9QA 3WT6A 3V49A 3UVVA 4CSJA 5CJ6A 4ZOMA 2G0HA 3FEJA 3KFCA 4RZFA 4YPQA 4OH6A 3FALA 5KCUA 3OS9A 3UP3A 1L2JA 2J4AA 2AXAA 2I4ZA 1NHZA 3OAPA 1GWXA 4ZNTA 1T65A 4M8EA 5JY3A 1NUOA 4CI4A 5DKBA 2P1VA 3TKCA 2QTUA 2YLPA 3W0YA 4MGCA 2PNUA 4IA7A 3P0UA 3VTDA 1HJ1A 2QMVA 5KRMA 5KRHA 5DZHA 4CI5A 3GWXA 1R1KD 5KRLA 1OVLA 1S9PA 3VRUA 1U3SA 3UUAB 4A2JA 2YJDA 2ZK2A 4B7WA 2GPPA 5AAVB 3VT3A 1QKMA 4ZN7A 3PBAA 5EHJA 1R20A 2I0GA 1Y0XX 2ZMJA 4PLEA 4Q50A 5DXBA 5E0XA 2VSTA 4ZO1X 1NQ2A 4JYHA 3R8DA 5DRJA 3VT7A 4E4KA 5DIEA 3VJTA 2F4BA 2OVMA 2QXMA 1LV2A 4OEZA 4WQPA 5DWJA 5GIDA 5B41A 3IA6A 3KPZA 3B68A 3GYUA 2PIVA 1QKTA 1YMTA 3B65A 3R8IA 3A9EA 3OKHA 3F5CA 4RWVA 3D24A 5AYGA 2HAMA 5DX3A 4MGAB 1SKXA 4P6XA 5GICA 1XDKB 3BQDA 1XNNA 1E3KA 3AUQA 1S0XA 1SQNA 1U3QA 1KKQA 4S14A 4YNKA 1YIMA 5DXKA 4G20A 4PP3A 2HARA 4OGHA 3OMQA 4PLDA 4Q0AC 1EXAA 2QNVA 4MGBB 2Q60A 1MV9A 3AZ3A 3AZ2A 5KCTA 1L2IA 2XYJA 5M96A 2ZL9A 4HEEX 2QABA 3ET2A 3VJHA 4XI3A 3VT4A 3VHUA 2HB7A 5LGAA 2AWHA 1NYXA 4MG7B 3P8XA 4RUOX 5E15A 2REWA 3V9YA 1R20D 2ZNOA 4IWCA 3WMHA 4RE8A 1I37A 3A2HA 4OIVA 3UVVB 1YINA 3KMZA 3K22A 4RUPA 4EM9A 1OSVA 5DVVA 1I7IA 2ZFXA 1ZGYA 3FALB 5HZCA 1YOWA 1R6GA 2Q1VA 3B0RA 4ZNSA 1QKUA 5KYJA 4UDAA 2P7GA 1HG4A 2GPVA 3B3KA 4Y29A 3PO9A 4JL4A 1FM9A 3G9EA 3L0EA 3WFGA 1PDUA 5H1EA 4OEYA 1G50A 2YATA 3VRVA 5DSHA 3ET3A 5ETHA 3ET1A 4MG6A 5IZ0A 4YMQA 3R8AA 1ZKYA 2HC4A 5JJMA 1OVLB 3GN8A 3VHWA 5ICKA 4ZN9A 2HB8A 3H0AA 3PRGA 5DZ0A 3FC6A 2ZXNA 5EGVA 3OZJA 2V0VA 4APUA 1TXIA 4QJRA 3WWRA 1I38A 4MGDA 4WPFA 3VJSA 5AZVA 5APJA 2QH6A 5FQVA 3CWDA 3M7RA 5DXBB 4ZNVA 3ET0A 5DUGA 1Y0SA 1N4HA 3D5FA 4WVDA 2J14A 3CLDA 3PLZA 1T76A 1XQCA 3G8OA 2O9IA 3HLVA 2PIQA 5C4UA 1Z5XU 3RVFA 3A2IA 1NDEA 2FSZA 1T73A 4OFRA 3HM1A 5L7HA 5SYZA 5KRAA 2VV4A 3A9EB 3F5CB 1N46A 4LNXA 3E7CA 4Q13A 5DV8A 3OS8C 4LTWA 3GYTA 5L11A 5DX3B 4O8FA 4ZJWA 4FN9A 1NQ0A 3D6DA 4JYIA 2ZK4A 4MDDA 1SR7A 1T7TA 4UDCA 3D57A 1NQ7A 3DR1A 3HODA 5GT4A 4IV4A 2GL8A 3AFRA 4NY9A 3V3EA 3DZUA 3D90A 3CS6A 5DZ1A 3DT3A 3H0AD 5DWEA 5G44A 1RK3A 2QW4A 4OILA 2H77A 1XOWA 2AX7A 4NB6A 3AX8A 4J5WC 2G0GA 1FCXA 3RUUA 4DORA 5EJVA 5FQTA 2J7XA 4J26A 4LSJA 1T74A 3OZ0A 4OKTA 2I4PA 4G1ZA 1UPWA 4RFWA 5FQSA 3VSPA 5E0WA 2YLQA 3KMRA 3OMOA 1S19A 3FS1A 5IXKA 2O4JA 4OARA 4XT9A 2QA6A 2GPOA 1EREA 2VV0A 3W0CA 1NAVA 1T63A 2XYXA 5E14A 3W5QA 5ACCA 3CS4A 1K74D 2Q59A 3MNPA 5DL4A 3W0JA 4ZNHA 3ERTA 3EYBA 4S0SA 3WT7A 1XB7A 5DZIA 5EI1A 3ZRBA 3OGTA 2OM9A 5DUHA 4OH5A 3ADWA 5JJMB 4XUHA 4A4WA 5AAUA 4QM0A 4RMEA 2QPYA 1A28A 2YJAB 2IHQA 1X7JA 2PIXA 1G5YA 1ILHA 3B66A 1YJEA 2B1VA 3FC6B 2ZMHA 3DZUD 4OKXA 3RUTA 2ZNNA 3ADXA 3CDSA 3OLSA 4TUZA 2I0JA 5L7GA 3AURA 4WLBA 4MGDB 3H52A 5DXQA 4IV2A 2HFPA 5DMCA 3WJ5A 5DVCA 3IPQA 4PXMA 3ZR7A 2FVJA 5G46A 3SP9A 2A3IA 3A78A 4LNWA 3AZ1A 5AWKA 2QSEA 5DV6A 3E94A 5HCVA 3ADTA 2VV4B 3L0JA 3X31A 3W0GA 4MG9A 1NQ1A 3V9VA 3VRTA 2XYWA 4DQMA 3R5MA 2BAWA 1ZAFA 2AM9A 3RLLA 2Z4JA 3A3ZX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJB A;  2ZY0 A;  1FD0 A;  1RDT A;  3AN3 A;  4PPP A;  2W8Y A;  4S0T A;  3V3Q A;  2AX9 A;  3V4A A;  5KRF A;  5KRC A;  1XZX X;  3MNO A;  2VV2 A;  1IE9 A;  3AN4 A;  1XLS A;  3G8I A;  4REE A;  5AK2 A;  2JF9 A;  1M13 A;  3G0W A;  4WHF A;  4XLD A;  5B5B A;  4DM8 A;  3S9S A;  1H9U A;  2PIW A;  5DK9 A;  3X1I A;  2POB A;  5G42 A;  3W0I A;  3X36 A;  4IWF A;  1XNX A;  2H79 A;  3OSA A;  4LBD A;  4M8H A;  1PCG A;  2FAI A;  4IW8 A;  4N5G A;  3KMG A;  2Z4B A;  5KCF A;  1XAP A;  1QKN A;  3K23 A;  3VT9 A;  4JGV A;  1XV9 A;  5DRM A;  3GBK A;  3OMK A;  1M2Z A;  2ACL A;  2AX6 A;  3BEJ A;  4F9M A;  3WJ4 A;  2G5O A;  2PIO A;  3CTB A;  2Q7L A;  2ZK3 A;  4QE6 A;  4RAK A;  5KCW A;  4PP6 A;  2OUZ A;  5DWG A;  1XPC A;  2ZNP A;  3OS8 A;  4P6W A;  5HJS A;  5G5W A;  4E2J A;  2Q59 B;  1YOK A;  5KYA A;  5DV3 A;  1ZDU A;  1X78 A;  5HYK A;  4L96 A;  2JFA A;  2PIT A;  4REF A;  3FEI A;  2GWX A;  4G1D A;  5APH A;  1PK5 A;  2YLO A;  5DXM A;  2AO6 A;  5DKG A;  2AB2 A;  5FQP A;  1RDT D;  5DID A;  3VJI A;  5DKS A;  4TV1 A;  2AX8 A;  3VTB A;  3JZC A;  5DXR A;  3MNE A;  5DWI A;  4PF3 A;  4N8R A;  5C4T A;  4FNE A;  4N73 A;  3WTQ A;  4TUZ B;  2V7C A;  2J7Y A;  4K4J A;  5DXE A;  4J5W A;  4OZR E;  4PWL A;  5DXP A;  3F7D A;  1K7L A;  2JJ3 A;  3LMP A;  5E7V A;  2AMA A;  4ZNU A;  5GIE A;  3V9T A;  4ZJR A;  2Q7K A;  3DZY A;  3BC5 A;  1GWQ A;  5KD9 A;  3B1M A;  3NSP A;  3UU7 A;  4OED A;  4DK8 A;  3NOA A;  1P93 A;  1DB1 A;  1TFC A;  5I4V A;  3TX7 B;  2AA6 A;  2HWR A;  4OKB A;  2ZLA A;  2P54 A;  2Q5S A;  4UDD A;  1X7R A;  1XLS E;  2NXX A;  4PRG A;  4WHG A;  4MG9 B;  1U9E A;  3L3X A;  3ADV A;  2PIR A;  3W5R A;  2OCF A;  3OMP A;  4XTA A;  4IU7 A;  2NV7 A;  5DKE A;  1FM9 D;  4A4V A;  5L7E A;  3VT6 A;  5LWP A;  2P4Y A;  4KZI A;  1NAX A;  1DKF A;  4OLM A;  4IA1 A;  5KRO A;  4JAZ A;  2Q1H A;  3WFF A;  3O1E A;  5G43 A;  1RJK A;  4IVW A;  5KCD A;  4OKW A;  5C4O A;  4IVY A;  2B23 A;  5DY8 A;  4QK4 A;  3O1D A;  2YFE A;  2QE4 A;  2ZK0 A;  3HO0 A;  2HAS A;  4OHA A;  2ZMI A;  2GTK A;  2Q5G A;  3KDT A;  4OJ9 A;  3B0T A;  4G2H A;  3TY0 A;  1XV9 B;  1XVP A;  1GWR A;  2POG A;  2R6W A;  2ACL B;  3ERD A;  5DYB A;  3WT5 A;  1PQ6 A;  1ZDT A;  3GD2 A;  4IA2 A;  3VN2 A;  2Q3Y A;  2QR9 A;  4DM6 A;  2Q8S A;  3L1B A;  5DP0 A;  4J5X C;  4EMA A;  5HYR A;  3OLL A;  3DZY D;  3FXV A;  1MZN A;  1OT7 A;  2QZO A;  4KZM A;  2ZK1 A;  4NIE A;  4R2U A;  3OMM A;  1FBY A;  3UUD A;  3OOK A;  4POJ A;  2BJ4 A;  3IPU A;  2OVH A;  3GWS X;  1XQ3 A;  4OK1 A;  1PQC A;  1K4W A;  1YY4 A;  3B0Q A;  4G21 A;  4ONI A;  4OZR U;  5KRI A;  1U3R A;  2AA2 A;  3IXP A;  4NQA B;  2JFA B;  2IOG A;  2NPA A;  2AYR A;  2VV1 A;  4DMA A;  3HVL A;  2IOK A;  2GPU A;  5KRJ A;  4X1F A;  3N00 A;  3RY9 A;  2PIU A;  4TV1 B;  5AWJ A;  3DY6 A;  4ITE A;  2P1U A;  3T03 A;  3R5N A;  3W0H A;  2XKW A;  4OJB A;  4ZO1 B;  5DYD A;  5G45 A;  1ZUC A;  3TKM A;  2NXX E;  2QA8 A;  2OAX A;  4G2I A;  3Q95 A;  2PJL A;  1IE8 A;  3JZB A;  3ADU A;  2HBH A;  2Q5P A;  1T7F A;  1E3G A;  1P8D A;  3ZRA A;  3UU7 B;  5DMF A;  4QL8 A;  2B1Z A;  3HC5 A;  4J24 A;  4UDB A;  1YP0 A;  3B0W A;  4OIU A;  5EIT A;  3CDP A;  3VI8 A;  2PIP L;  1XP9 A;  4S15 A;  1RKH A;  2PIN A;  5DVS A;  5K13 A;  5AVI A;  2AMB A;  3E00 A;  1UOM A;  1R5K A;  3FUG A;  3L0L A;  2Q6R A;  2ZK5 A;  3OLF A;  3R29 A;  3P89 A;  4PPS A;  1T7R A;  3CJW A;  5DLR A;  5HJP A;  1I7G A;  2Q7J A;  1DKF B;  5DXG A;  2ZVT A;  3IXP D;  3WGP A;  1FCZ A;  1PZL A;  1T7M A;  2LBD A;  4MG8 A;  2Q6J A;  1LBD A;  1FM6 A;  5IAW A;  2P15 A;  4YT1 A;  1M7W A;  1SJ0 A;  1X7E A;  1XJ7 A;  4N1Y A;  1RKG A;  5F9B A;  3ADS A;  1A52 A;  1Q4X A;  4MG5 A;  2O4R A;  2PKL A;  3KWY A;  3L03 A;  2HCD A;  2HWQ A;  4IA3 A;  1ILG A;  4OJ4 A;  4E4Q A;  1PRG A;  3L3Z A;  1X76 A;  2ZBS A;  4OFU A;  2GIU A;  2P1T A;  4RUJ A;  4ZNW A;  3B67 A;  1N83 A;  1YA3 A;  1UHL A;  5G3J A;  4BCR A;  5FQR A;  1MVC A;  4X1G A;  3W0A A;  1XVP B;  4HLW A;  3A40 X;  1KNU A;  3KYT A;  3OKI A;  2Q6S A;  2ZK6 A;  3P88 A;  1Z5X E;  3ILZ A;  3OSW A;  2QZO B;  1T79 A;  2G44 A;  3NSQ A;  4R6S A;  1XIU A;  3UUD B;  2BJ4 B;  5AZT A;  2EWP A;  3E00 D;  3W5T A;  2ZXZ A;  2Q70 A;  5EC9 A;  2R40 A;  3VHV A;  4L98 A;  1GS4 A;  2R6Y A;  2VV1 B;  3UP0 A;  5AVL A;  3ZQT A;  2Q7I A;  4JYG A;  4OZT E;  3HC6 A;  1X7B A;  5C4S A;  1WM0 X;  4R06 A;  3PCU A;  5E19 A;  2QGW A;  1FM6 D;  3DCU A;  1YUC A;  2E2R A;  5DZ3 A;  3IPS A;  5JI0 D;  2AA7 A;  1S0Z A;  5KCC A;  1OSH A;  4NUF A;  5A86 A;  4IS8 A;  1Z95 A;  2QA8 B;  4ITF A;  1NRL A;  2AA5 A;  3HQ5 A;  2AAX A;  3Q95 B;  3RLJ A;  4FGY A;  2ATH A;  1ZH7 A;  1G1U A;  3FLI A;  1YYE A;  3R2A A;  2YLY A;  4IUI A;  4PVU A;  2VSR A;  3VRW A;  3FUR A;  4J5X A;  4OEA A;  3SP6 A;  2P7Z A;  3HZF A;  4RMD A;  4DK7 A;  3UUA A;  3QT0 A;  1EXX A;  5DWL A;  5APK A;  3A2J A;  4KZJ A;  4FHI A;  4XAO A;  5DUE A;  3KDU A;  2GP7 A;  4IW6 A;  2VV3 A;  4OC7 A;  5AAV A;  3DCT A;  1ZEO A;  5DIG A;  4POH A;  3VT5 A;  1G2N A;  4DOS A;  5HJP B;  3AUN A;  3B5R A;  2QGT A;  4FHH A;  2R40 D;  4XHD A;  3LBD A;  5DI7 A;  4MG8 B;  2ZXM A;  2ZLC A;  4K6I A;  1KV6 A;  1XP6 A;  4RZG A;  4PP5 A;  3VTC A;  2YHD A;  5DTV A;  1FCY A;  3KBA A;  4IQR A;  2XHS A;  1K74 A;  2I4J A;  2B50 A;  2ZKC A;  4RZE A;  2OZ7 A;  2ZNQ A;  4MGA A;  3UUC A;  1XDK A;  2HVC A;  2NW4 A;  5KR9 A;  3U9Q A;  1R1K A;  1XP1 A;  1UHL B;  2P7A A;  2ZAS A;  4G1Y A;  5KRK A;  3K8S A;  2ABI A;  4OZT U;  3SZ1 A;  4K7A A;  1ERR A;  4XUM A;  3CQV A;  3IMY A;  3K6P A;  3OOF A;  4MGB A;  5DU5 A;  3W5P A;  5KCE A;  5E1C A;  3OSI A;  1UPV A;  1Y9R A;  3PEQ A;  3GZ9 A;  2QXS A;  4QE8 A;  2PRG A;  1PQ9 A;  4RMC A;  1T5Z A;  4ZI1 A;  2Q61 A;  3CS8 A;  4MG7 A;  3VT8 A;  1BSX A;  3VSO A;  3X1H A;  1S9Q A;  3WT6 A;  3V49 A;  3UVV A;  4CSJ A;  5CJ6 A;  4ZOM A;  2G0H A;  3FEJ A;  3KFC A;  4RZF A;  4YPQ A;  4OH6 A;  3FAL A;  5KCU A;  3OS9 A;  3UP3 A;  1L2J A;  2J4A A;  2AXA A;  2I4Z A;  1NHZ A;  3OAP A;  1GWX A;  4ZNT A;  1T65 A;  4M8E A;  5JY3 A;  1NUO A;  4CI4 A;  5DKB A;  2P1V A;  3TKC A;  2QTU A;  2YLP A;  3W0Y A;  4MGC A;  2PNU A;  4IA7 A;  3P0U A;  3VTD A;  1HJ1 A;  2QMV A;  5KRM A;  5KRH A;  5DZH A;  4CI5 A;  3GWX A;  1R1K D;  5KRL A;  1OVL A;  1S9P A;  3VRU A;  1U3S A;  3UUA B;  4A2J A;  2YJD A;  2ZK2 A;  4B7W A;  2GPP A;  5AAV B;  3VT3 A;  1QKM A;  4ZN7 A;  3PBA A;  5EHJ A;  1R20 A;  2I0G A;  1Y0X X;  2ZMJ A;  4PLE A;  4Q50 A;  5DXB A;  5E0X A;  2VST A;  4ZO1 X;  1NQ2 A;  4JYH A;  3R8D A;  5DRJ A;  3VT7 A;  4E4K A;  5DIE A;  3VJT A;  2F4B A;  2OVM A;  2QXM A;  1LV2 A;  4OEZ A;  4WQP A;  5DWJ A;  5GID A;  5B41 A;  3IA6 A;  3KPZ A;  3B68 A;  3GYU A;  2PIV A;  1QKT A;  1YMT A;  3B65 A;  3R8I A;  3A9E A;  3OKH A;  3F5C A;  4RWV A;  3D24 A;  5AYG A;  2HAM A;  5DX3 A;  4MGA B;  1SKX A;  4P6X A;  5GIC A;  1XDK B;  3BQD A;  1XNN A;  1E3K A;  3AUQ A;  1S0X A;  1SQN A;  1U3Q A;  1KKQ A;  4S14 A;  4YNK A;  1YIM A;  5DXK A;  4G20 A;  4PP3 A;  2HAR A;  4OGH A;  3OMQ A;  4PLD A;  4Q0A C;  1EXA A;  2QNV A;  4MGB B;  2Q60 A;  1MV9 A;  3AZ3 A;  3AZ2 A;  5KCT A;  1L2I A;  2XYJ A;  5M96 A;  2ZL9 A;  4HEE X;  2QAB A;  3ET2 A;  3VJH A;  4XI3 A;  3VT4 A;  3VHU A;  2HB7 A;  5LGA A;  2AWH A;  1NYX A;  4MG7 B;  3P8X A;  4RUO X;  5E15 A;  2REW A;  3V9Y A;  1R20 D;  2ZNO A;  4IWC A;  3WMH A;  4RE8 A;  1I37 A;  3A2H A;  4OIV A;  3UVV B;  1YIN A;  3KMZ A;  3K22 A;  4RUP A;  4EM9 A;  1OSV A;  5DVV A;  1I7I A;  2ZFX A;  1ZGY A;  3FAL B;  5HZC A;  1YOW A;  1R6G A;  2Q1V A;  3B0R A;  4ZNS A;  1QKU A;  5KYJ A;  4UDA A;  2P7G A;  1HG4 A;  2GPV A;  3B3K A;  4Y29 A;  3PO9 A;  4JL4 A;  1FM9 A;  3G9E A;  3L0E A;  3WFG A;  1PDU A;  5H1E A;  4OEY A;  1G50 A;  2YAT A;  3VRV A;  5DSH A;  3ET3 A;  5ETH A;  3ET1 A;  4MG6 A;  5IZ0 A;  4YMQ A;  3R8A A;  1ZKY A;  2HC4 A;  5JJM A;  1OVL B;  3GN8 A;  3VHW A;  5ICK A;  4ZN9 A;  2HB8 A;  3H0A A;  3PRG A;  5DZ0 A;  3FC6 A;  2ZXN A;  5EGV A;  3OZJ A;  2V0V A;  4APU A;  1TXI A;  4QJR A;  3WWR A;  1I38 A;  4MGD A;  4WPF A;  3VJS A;  5AZV A;  5APJ A;  2QH6 A;  5FQV A;  3CWD A;  3M7R A;  5DXB B;  4ZNV A;  3ET0 A;  5DUG A;  1Y0S A;  1N4H A;  3D5F A;  4WVD A;  2J14 A;  3CLD A;  3PLZ A;  1T76 A;  1XQC A;  3G8O A;  2O9I A;  3HLV A;  2PIQ A;  5C4U A;  1Z5X U;  3RVF A;  3A2I A;  1NDE A;  2FSZ A;  1T73 A;  4OFR A;  3HM1 A;  5L7H A;  5SYZ A;  5KRA A;  2VV4 A;  3A9E B;  3F5C B;  1N46 A;  4LNX A;  3E7C A;  4Q13 A;  5DV8 A;  3OS8 C;  4LTW A;  3GYT A;  5L11 A;  5DX3 B;  4O8F A;  4ZJW A;  4FN9 A;  1NQ0 A;  3D6D A;  4JYI A;  2ZK4 A;  4MDD A;  1SR7 A;  1T7T A;  4UDC A;  3D57 A;  1NQ7 A;  3DR1 A;  3HOD A;  5GT4 A;  4IV4 A;  2GL8 A;  3AFR A;  4NY9 A;  3V3E A;  3DZU A;  3D90 A;  3CS6 A;  5DZ1 A;  3DT3 A;  3H0A D;  5DWE A;  5G44 A;  1RK3 A;  2QW4 A;  4OIL A;  2H77 A;  1XOW A;  2AX7 A;  4NB6 A;  3AX8 A;  4J5W C;  2G0G A;  1FCX A;  3RUU A;  4DOR A;  5EJV A;  5FQT A;  2J7X A;  4J26 A;  4LSJ A;  1T74 A;  3OZ0 A;  4OKT A;  2I4P A;  4G1Z A;  1UPW A;  4RFW A;  5FQS A;  3VSP A;  5E0W A;  2YLQ A;  3KMR A;  3OMO A;  1S19 A;  3FS1 A;  5IXK A;  2O4J A;  4OAR A;  4XT9 A;  2QA6 A;  2GPO A;  1ERE A;  2VV0 A;  3W0C A;  1NAV A;  1T63 A;  2XYX A;  5E14 A;  3W5Q A;  5ACC A;  3CS4 A;  1K74 D;  2Q59 A;  3MNP A;  5DL4 A;  3W0J A;  4ZNH A;  3ERT A;  3EYB A;  4S0S A;  3WT7 A;  1XB7 A;  5DZI A;  5EI1 A;  3ZRB A;  3OGT A;  2OM9 A;  5DUH A;  4OH5 A;  3ADW A;  5JJM B;  4XUH A;  4A4W A;  5AAU A;  4QM0 A;  4RME A;  2QPY A;  1A28 A;  2YJA B;  2IHQ A;  1X7J A;  2PIX A;  1G5Y A;  1ILH A;  3B66 A;  1YJE A;  2B1V A;  3FC6 B;  2ZMH A;  3DZU D;  4OKX A;  3RUT A;  2ZNN A;  3ADX A;  3CDS A;  3OLS A;  4TUZ A;  2I0J A;  5L7G A;  3AUR A;  4WLB A;  4MGD B;  3H52 A;  5DXQ A;  4IV2 A;  2HFP A;  5DMC A;  3WJ5 A;  5DVC A;  3IPQ A;  4PXM A;  3ZR7 A;  2FVJ A;  5G46 A;  3SP9 A;  2A3I A;  3A78 A;  4LNW A;  3AZ1 A;  5AWK A;  2QSE A;  5DV6 A;  3E94 A;  5HCV A;  3ADT A;  2VV4 B;  3L0J A;  3X31 A;  3W0G A;  4MG9 A;  1NQ1 A;  3V9V A;  3VRT A;  2XYW A;  4DQM A;  3R5M A;  2BAW A;  1ZAF A;  2AM9 A;  3RLL A;  2Z4J A;  3A3Z X; 
#chains in the Genus database with same CATH topology
 1VJB A;  2ZY0 A;  1FD0 A;  1RDT A;  3AN3 A;  4PPP A;  2W8Y A;  4S0T A;  3V3Q A;  2AX9 A;  3V4A A;  5KRF A;  5KRC A;  1XZX X;  3MNO A;  2VV2 A;  1IE9 A;  3AN4 A;  1XLS A;  3G8I A;  4REE A;  5AK2 A;  2JF9 A;  1M13 A;  3G0W A;  4WHF A;  4XLD A;  5B5B A;  4DM8 A;  3S9S A;  1H9U A;  2PIW A;  5DK9 A;  3X1I A;  2POB A;  5G42 A;  3W0I A;  3X36 A;  4IWF A;  1XNX A;  2H79 A;  3OSA A;  4LBD A;  4M8H A;  1PCG A;  2FAI A;  4IW8 A;  4N5G A;  3KMG A;  2Z4B A;  5KCF A;  1XAP A;  1QKN A;  3K23 A;  3VT9 A;  4JGV A;  1XV9 A;  5DRM A;  3GBK A;  3OMK A;  1M2Z A;  2ACL A;  2AX6 A;  3BEJ A;  4F9M A;  3WJ4 A;  2G5O A;  2PIO A;  3CTB A;  2Q7L A;  2ZK3 A;  4QE6 A;  4RAK A;  5KCW A;  4PP6 A;  2OUZ A;  5DWG A;  1XPC A;  2ZNP A;  3OS8 A;  4P6W A;  5HJS A;  5G5W A;  4E2J A;  2Q59 B;  1YOK A;  5KYA A;  5DV3 A;  1ZDU A;  1X78 A;  5HYK A;  4L96 A;  2JFA A;  2PIT A;  4REF A;  3FEI A;  2GWX A;  4G1D A;  5APH A;  1PK5 A;  2YLO A;  5DXM A;  2AO6 A;  5DKG A;  2AB2 A;  5FQP A;  1RDT D;  5DID A;  3VJI A;  5DKS A;  4TV1 A;  2AX8 A;  3VTB A;  3JZC A;  5DXR A;  3MNE A;  5DWI A;  4PF3 A;  4N8R A;  5C4T A;  4FNE A;  4N73 A;  3WTQ A;  4TUZ B;  2V7C A;  2J7Y A;  4K4J A;  5DXE A;  4J5W A;  4OZR E;  4PWL A;  5DXP A;  3F7D A;  1K7L A;  2JJ3 A;  3LMP A;  5E7V A;  2AMA A;  4ZNU A;  5GIE A;  3V9T A;  4ZJR A;  2Q7K A;  3DZY A;  3BC5 A;  1GWQ A;  5KD9 A;  3B1M A;  3NSP A;  3UU7 A;  4OED A;  4DK8 A;  3NOA A;  1P93 A;  1DB1 A;  1TFC A;  5I4V A;  3TX7 B;  2AA6 A;  2HWR A;  4OKB A;  2ZLA A;  2P54 A;  2Q5S A;  4UDD A;  1X7R A;  1XLS E;  2NXX A;  4PRG A;  4WHG A;  4MG9 B;  1U9E A;  3L3X A;  3ADV A;  2PIR A;  3W5R A;  2OCF A;  3OMP A;  4XTA A;  4IU7 A;  2NV7 A;  5DKE A;  1FM9 D;  4A4V A;  5L7E A;  3VT6 A;  5LWP A;  2P4Y A;  4KZI A;  1NAX A;  1DKF A;  4OLM A;  4IA1 A;  5KRO A;  4JAZ A;  2Q1H A;  3WFF A;  3O1E A;  5G43 A;  1RJK A;  4IVW A;  5KCD A;  4OKW A;  5C4O A;  4IVY A;  2B23 A;  5DY8 A;  4QK4 A;  3O1D A;  2YFE A;  2QE4 A;  2ZK0 A;  3HO0 A;  2HAS A;  4OHA A;  2ZMI A;  2GTK A;  2Q5G A;  3KDT A;  4OJ9 A;  3B0T A;  4G2H A;  3TY0 A;  1XV9 B;  1XVP A;  1GWR A;  2POG A;  2R6W A;  2ACL B;  3ERD A;  5DYB A;  3WT5 A;  1PQ6 A;  1ZDT A;  3GD2 A;  4IA2 A;  3VN2 A;  2Q3Y A;  2QR9 A;  4DM6 A;  2Q8S A;  3L1B A;  5DP0 A;  4J5X C;  4EMA A;  5HYR A;  3OLL A;  3DZY D;  3FXV A;  1MZN A;  1OT7 A;  2QZO A;  4KZM A;  2ZK1 A;  4NIE A;  4R2U A;  3OMM A;  1FBY A;  3UUD A;  3OOK A;  4POJ A;  2BJ4 A;  3IPU A;  2OVH A;  3GWS X;  1XQ3 A;  4OK1 A;  1PQC A;  1K4W A;  1YY4 A;  3B0Q A;  4G21 A;  4ONI A;  4OZR U;  5KRI A;  1U3R A;  2AA2 A;  3IXP A;  4NQA B;  2JFA B;  2IOG A;  2NPA A;  2AYR A;  2VV1 A;  4DMA A;  3HVL A;  2IOK A;  2GPU A;  5KRJ A;  4X1F A;  3N00 A;  3RY9 A;  2PIU A;  4TV1 B;  5AWJ A;  3DY6 A;  4ITE A;  2P1U A;  3T03 A;  3R5N A;  3W0H A;  2XKW A;  4OJB A;  4ZO1 B;  5DYD A;  5G45 A;  1ZUC A;  3TKM A;  2NXX E;  2QA8 A;  2OAX A;  4G2I A;  3Q95 A;  2PJL A;  1IE8 A;  3JZB A;  3ADU A;  2HBH A;  2Q5P A;  1T7F A;  1E3G A;  1P8D A;  3ZRA A;  3UU7 B;  5DMF A;  4QL8 A;  2B1Z A;  3HC5 A;  4J24 A;  4UDB A;  1YP0 A;  3B0W A;  4OIU A;  5EIT A;  3CDP A;  3VI8 A;  2PIP L;  1XP9 A;  4S15 A;  1RKH A;  2PIN A;  5DVS A;  5K13 A;  5AVI A;  2AMB A;  3E00 A;  1UOM A;  1R5K A;  3FUG A;  3L0L A;  2Q6R A;  2ZK5 A;  3OLF A;  3R29 A;  3P89 A;  4PPS A;  1T7R A;  3CJW A;  5DLR A;  5HJP A;  1I7G A;  2Q7J A;  1DKF B;  5DXG A;  2ZVT A;  3IXP D;  3WGP A;  1FCZ A;  1PZL A;  1T7M A;  2LBD A;  4MG8 A;  2Q6J A;  1LBD A;  1FM6 A;  5IAW A;  2P15 A;  4YT1 A;  1M7W A;  1SJ0 A;  1X7E A;  1XJ7 A;  4N1Y A;  1RKG A;  5F9B A;  3ADS A;  1A52 A;  1Q4X A;  4MG5 A;  2O4R A;  2PKL A;  3KWY A;  3L03 A;  2HCD A;  2HWQ A;  4IA3 A;  1ILG A;  4OJ4 A;  4E4Q A;  1PRG A;  3L3Z A;  1X76 A;  2ZBS A;  4OFU A;  2GIU A;  2P1T A;  4RUJ A;  4ZNW A;  3B67 A;  1N83 A;  1YA3 A;  1UHL A;  5G3J A;  4BCR A;  5FQR A;  1MVC A;  4X1G A;  3W0A A;  1XVP B;  4HLW A;  3A40 X;  1KNU A;  3KYT A;  3OKI A;  2Q6S A;  2ZK6 A;  3P88 A;  1Z5X E;  3ILZ A;  3OSW A;  2QZO B;  1T79 A;  2G44 A;  3NSQ A;  4R6S A;  1XIU A;  3UUD B;  2BJ4 B;  5AZT A;  2EWP A;  3E00 D;  3W5T A;  2ZXZ A;  2Q70 A;  5EC9 A;  2R40 A;  3VHV A;  4L98 A;  1GS4 A;  2R6Y A;  2VV1 B;  3UP0 A;  5AVL A;  3ZQT A;  2Q7I A;  4JYG A;  4OZT E;  3HC6 A;  1X7B A;  5C4S A;  1WM0 X;  4R06 A;  3PCU A;  5E19 A;  2QGW A;  1FM6 D;  3DCU A;  1YUC A;  2E2R A;  5DZ3 A;  3IPS A;  5JI0 D;  2AA7 A;  1S0Z A;  5KCC A;  1OSH A;  4NUF A;  5A86 A;  4IS8 A;  1Z95 A;  2QA8 B;  4ITF A;  1NRL A;  2AA5 A;  3HQ5 A;  2AAX A;  3Q95 B;  3RLJ A;  4FGY A;  2ATH A;  1ZH7 A;  1G1U A;  3FLI A;  1YYE A;  3R2A A;  2YLY A;  4IUI A;  4PVU A;  2VSR A;  3VRW A;  3FUR A;  4J5X A;  4OEA A;  3SP6 A;  2P7Z A;  3HZF A;  4RMD A;  4DK7 A;  3UUA A;  3QT0 A;  1EXX A;  5DWL A;  5APK A;  3A2J A;  4KZJ A;  4FHI A;  4XAO A;  5DUE A;  3KDU A;  2GP7 A;  4IW6 A;  2VV3 A;  4OC7 A;  5AAV A;  3DCT A;  1ZEO A;  5DIG A;  4POH A;  3VT5 A;  1G2N A;  4DOS A;  5HJP B;  3AUN A;  3B5R A;  2QGT A;  4FHH A;  2R40 D;  4XHD A;  3LBD A;  5DI7 A;  4MG8 B;  2ZXM A;  2ZLC A;  4K6I A;  1KV6 A;  1XP6 A;  4RZG A;  4PP5 A;  3VTC A;  2YHD A;  5DTV A;  1FCY A;  3KBA A;  4IQR A;  2XHS A;  1K74 A;  2I4J A;  2B50 A;  2ZKC A;  4RZE A;  2OZ7 A;  2ZNQ A;  4MGA A;  3UUC A;  1XDK A;  2HVC A;  2NW4 A;  5KR9 A;  3U9Q A;  1R1K A;  1XP1 A;  1UHL B;  2P7A A;  2ZAS A;  4G1Y A;  5KRK A;  3K8S A;  2ABI A;  4OZT U;  3SZ1 A;  4K7A A;  1ERR A;  4XUM A;  3CQV A;  3IMY A;  3K6P A;  3OOF A;  4MGB A;  5DU5 A;  3W5P A;  5KCE A;  5E1C A;  3OSI A;  1UPV A;  1Y9R A;  3PEQ A;  3GZ9 A;  2QXS A;  4QE8 A;  2PRG A;  1PQ9 A;  4RMC A;  1T5Z A;  4ZI1 A;  2Q61 A;  3CS8 A;  4MG7 A;  3VT8 A;  1BSX A;  3VSO A;  3X1H A;  1S9Q A;  3WT6 A;  3V49 A;  3UVV A;  4CSJ A;  5CJ6 A;  4ZOM A;  2G0H A;  3FEJ A;  3KFC A;  4RZF A;  4YPQ A;  4OH6 A;  3FAL A;  5KCU A;  3OS9 A;  3UP3 A;  1L2J A;  2J4A A;  2AXA A;  2I4Z A;  1NHZ A;  3OAP A;  1GWX A;  4ZNT A;  1T65 A;  4M8E A;  5JY3 A;  1NUO A;  4CI4 A;  5DKB A;  2P1V A;  3TKC A;  2QTU A;  2YLP A;  3W0Y A;  4MGC A;  2PNU A;  4IA7 A;  3P0U A;  3VTD A;  1HJ1 A;  2QMV A;  5KRM A;  5KRH A;  5DZH A;  4CI5 A;  3GWX A;  1R1K D;  5KRL A;  1OVL A;  1S9P A;  3VRU A;  1U3S A;  3UUA B;  4A2J A;  2YJD A;  2ZK2 A;  4B7W A;  2GPP A;  5AAV B;  3VT3 A;  1QKM A;  4ZN7 A;  3PBA A;  5EHJ A;  1R20 A;  2I0G A;  1Y0X X;  2ZMJ A;  4PLE A;  4Q50 A;  5DXB A;  5E0X A;  2VST A;  4ZO1 X;  1NQ2 A;  4JYH A;  3R8D A;  5DRJ A;  3VT7 A;  4E4K A;  5DIE A;  3VJT A;  2F4B A;  2OVM A;  2QXM A;  1LV2 A;  4OEZ A;  4WQP A;  5DWJ A;  5GID A;  5B41 A;  3IA6 A;  3KPZ A;  3B68 A;  3GYU A;  2PIV A;  1QKT A;  1YMT A;  3B65 A;  3R8I A;  3A9E A;  3OKH A;  3F5C A;  4RWV A;  3D24 A;  5AYG A;  2HAM A;  5DX3 A;  4MGA B;  1SKX A;  4P6X A;  5GIC A;  1XDK B;  3BQD A;  1XNN A;  1E3K A;  3AUQ A;  1S0X A;  1SQN A;  1U3Q A;  1KKQ A;  4S14 A;  4YNK A;  1YIM A;  5DXK A;  4G20 A;  4PP3 A;  2HAR A;  4OGH A;  3OMQ A;  4PLD A;  4Q0A C;  1EXA A;  2QNV A;  4MGB B;  2Q60 A;  1MV9 A;  3AZ3 A;  3AZ2 A;  5KCT A;  1L2I A;  2XYJ A;  5M96 A;  2ZL9 A;  4HEE X;  2QAB A;  3ET2 A;  3VJH A;  4XI3 A;  3VT4 A;  3VHU A;  2HB7 A;  5LGA A;  2AWH A;  1NYX A;  4MG7 B;  3P8X A;  4RUO X;  5E15 A;  2REW A;  3V9Y A;  1R20 D;  2ZNO A;  4IWC A;  3WMH A;  4RE8 A;  1I37 A;  3A2H A;  4OIV A;  3UVV B;  1YIN A;  3KMZ A;  3K22 A;  4RUP A;  4EM9 A;  1OSV A;  5DVV A;  1I7I A;  2ZFX A;  1ZGY A;  3FAL B;  5HZC A;  1YOW A;  1R6G A;  2Q1V A;  3B0R A;  4ZNS A;  1QKU A;  5KYJ A;  4UDA A;  2P7G A;  1HG4 A;  2GPV A;  3B3K A;  4Y29 A;  3PO9 A;  4JL4 A;  1FM9 A;  3G9E A;  3L0E A;  3WFG A;  1PDU A;  5H1E A;  4OEY A;  1G50 A;  2YAT A;  3VRV A;  5DSH A;  3ET3 A;  5ETH A;  3ET1 A;  4MG6 A;  5IZ0 A;  4YMQ A;  3R8A A;  1ZKY A;  2HC4 A;  5JJM A;  1OVL B;  3GN8 A;  3VHW A;  5ICK A;  4ZN9 A;  2HB8 A;  3H0A A;  3PRG A;  5DZ0 A;  3FC6 A;  2ZXN A;  5EGV A;  3OZJ A;  2V0V A;  4APU A;  1TXI A;  4QJR A;  3WWR A;  1I38 A;  4MGD A;  4WPF A;  3VJS A;  5AZV A;  5APJ A;  2QH6 A;  5FQV A;  3CWD A;  3M7R A;  5DXB B;  4ZNV A;  3ET0 A;  5DUG A;  1Y0S A;  1N4H A;  3D5F A;  4WVD A;  2J14 A;  3CLD A;  3PLZ A;  1T76 A;  1XQC A;  3G8O A;  2O9I A;  3HLV A;  2PIQ A;  5C4U A;  1Z5X U;  3RVF A;  3A2I A;  1NDE A;  2FSZ A;  1T73 A;  4OFR A;  3HM1 A;  5L7H A;  5SYZ A;  5KRA A;  2VV4 A;  3A9E B;  3F5C B;  1N46 A;  4LNX A;  3E7C A;  4Q13 A;  5DV8 A;  3OS8 C;  4LTW A;  3GYT A;  5L11 A;  5DX3 B;  4O8F A;  4ZJW A;  4FN9 A;  1NQ0 A;  3D6D A;  4JYI A;  2ZK4 A;  4MDD A;  1SR7 A;  1T7T A;  4UDC A;  3D57 A;  1NQ7 A;  3DR1 A;  3HOD A;  5GT4 A;  4IV4 A;  2GL8 A;  3AFR A;  4NY9 A;  3V3E A;  3DZU A;  3D90 A;  3CS6 A;  5DZ1 A;  3DT3 A;  3H0A D;  5DWE A;  5G44 A;  1RK3 A;  2QW4 A;  4OIL A;  2H77 A;  1XOW A;  2AX7 A;  4NB6 A;  3AX8 A;  4J5W C;  2G0G A;  1FCX A;  3RUU A;  4DOR A;  5EJV A;  5FQT A;  2J7X A;  4J26 A;  4LSJ A;  1T74 A;  3OZ0 A;  4OKT A;  2I4P A;  4G1Z A;  1UPW A;  4RFW A;  5FQS A;  3VSP A;  5E0W A;  2YLQ A;  3KMR A;  3OMO A;  1S19 A;  3FS1 A;  5IXK A;  2O4J A;  4OAR A;  4XT9 A;  2QA6 A;  2GPO A;  1ERE A;  2VV0 A;  3W0C A;  1NAV A;  1T63 A;  2XYX A;  5E14 A;  3W5Q A;  5ACC A;  3CS4 A;  1K74 D;  2Q59 A;  3MNP A;  5DL4 A;  3W0J A;  4ZNH A;  3ERT A;  3EYB A;  4S0S A;  3WT7 A;  1XB7 A;  5DZI A;  5EI1 A;  3ZRB A;  3OGT A;  2OM9 A;  5DUH A;  4OH5 A;  3ADW A;  5JJM B;  4XUH A;  4A4W A;  5AAU A;  4QM0 A;  4RME A;  2QPY A;  1A28 A;  2YJA B;  2IHQ A;  1X7J A;  2PIX A;  1G5Y A;  1ILH A;  3B66 A;  1YJE A;  2B1V A;  3FC6 B;  2ZMH A;  3DZU D;  4OKX A;  3RUT A;  2ZNN A;  3ADX A;  3CDS A;  3OLS A;  4TUZ A;  2I0J A;  5L7G A;  3AUR A;  4WLB A;  4MGD B;  3H52 A;  5DXQ A;  4IV2 A;  2HFP A;  5DMC A;  3WJ5 A;  5DVC A;  3IPQ A;  4PXM A;  3ZR7 A;  2FVJ A;  5G46 A;  3SP9 A;  2A3I A;  3A78 A;  4LNW A;  3AZ1 A;  5AWK A;  2QSE A;  5DV6 A;  3E94 A;  5HCV A;  3ADT A;  2VV4 B;  3L0J A;  3X31 A;  3W0G A;  4MG9 A;  1NQ1 A;  3V9V A;  3VRT A;  2XYW A;  4DQM A;  3R5M A;  2BAW A;  1ZAF A;  2AM9 A;  3RLL A;  2Z4J A;  3A3Z X; 
#chains in the Genus database with same CATH homology
 1VJB A;  2ZY0 A;  1FD0 A;  1RDT A;  3AN3 A;  4PPP A;  2W8Y A;  4S0T A;  3V3Q A;  2AX9 A;  3V4A A;  5KRF A;  5KRC A;  1XZX X;  3MNO A;  2VV2 A;  1IE9 A;  3AN4 A;  1XLS A;  3G8I A;  4REE A;  5AK2 A;  2JF9 A;  1M13 A;  3G0W A;  4WHF A;  4XLD A;  5B5B A;  4DM8 A;  3S9S A;  1H9U A;  2PIW A;  5DK9 A;  3X1I A;  2POB A;  5G42 A;  3W0I A;  3X36 A;  4IWF A;  1XNX A;  2H79 A;  3OSA A;  4LBD A;  4M8H A;  1PCG A;  2FAI A;  4IW8 A;  4N5G A;  3KMG A;  2Z4B A;  5KCF A;  1XAP A;  1QKN A;  3K23 A;  3VT9 A;  4JGV A;  1XV9 A;  5DRM A;  3GBK A;  3OMK A;  1M2Z A;  2ACL A;  2AX6 A;  3BEJ A;  4F9M A;  3WJ4 A;  2G5O A;  2PIO A;  3CTB A;  2Q7L A;  2ZK3 A;  4QE6 A;  4RAK A;  5KCW A;  4PP6 A;  2OUZ A;  5DWG A;  1XPC A;  2ZNP A;  3OS8 A;  4P6W A;  5HJS A;  5G5W A;  4E2J A;  2Q59 B;  1YOK A;  5KYA A;  5DV3 A;  1ZDU A;  1X78 A;  5HYK A;  4L96 A;  2JFA A;  2PIT A;  4REF A;  3FEI A;  2GWX A;  4G1D A;  5APH A;  1PK5 A;  2YLO A;  5DXM A;  2AO6 A;  5DKG A;  2AB2 A;  5FQP A;  1RDT D;  5DID A;  3VJI A;  5DKS A;  4TV1 A;  2AX8 A;  3VTB A;  3JZC A;  5DXR A;  3MNE A;  5DWI A;  4PF3 A;  4N8R A;  5C4T A;  4FNE A;  4N73 A;  3WTQ A;  4TUZ B;  2V7C A;  2J7Y A;  4K4J A;  5DXE A;  4J5W A;  4OZR E;  4PWL A;  5DXP A;  3F7D A;  1K7L A;  2JJ3 A;  3LMP A;  5E7V A;  2AMA A;  4ZNU A;  5GIE A;  3V9T A;  4ZJR A;  2Q7K A;  3DZY A;  3BC5 A;  1GWQ A;  5KD9 A;  3B1M A;  3NSP A;  3UU7 A;  4OED A;  4DK8 A;  3NOA A;  1P93 A;  1DB1 A;  1TFC A;  5I4V A;  3TX7 B;  2AA6 A;  2HWR A;  4OKB A;  2ZLA A;  2P54 A;  2Q5S A;  4UDD A;  1X7R A;  1XLS E;  2NXX A;  4PRG A;  4WHG A;  4MG9 B;  1U9E A;  3L3X A;  3ADV A;  2PIR A;  3W5R A;  2OCF A;  3OMP A;  4XTA A;  4IU7 A;  2NV7 A;  5DKE A;  1FM9 D;  4A4V A;  5L7E A;  3VT6 A;  5LWP A;  2P4Y A;  4KZI A;  1NAX A;  1DKF A;  4OLM A;  4IA1 A;  5KRO A;  4JAZ A;  2Q1H A;  3WFF A;  3O1E A;  5G43 A;  1RJK A;  4IVW A;  5KCD A;  4OKW A;  5C4O A;  4IVY A;  2B23 A;  5DY8 A;  4QK4 A;  3O1D A;  2YFE A;  2QE4 A;  2ZK0 A;  3HO0 A;  2HAS A;  4OHA A;  2ZMI A;  2GTK A;  2Q5G A;  3KDT A;  4OJ9 A;  3B0T A;  4G2H A;  3TY0 A;  1XV9 B;  1XVP A;  1GWR A;  2POG A;  2R6W A;  2ACL B;  3ERD A;  5DYB A;  3WT5 A;  1PQ6 A;  1ZDT A;  3GD2 A;  4IA2 A;  3VN2 A;  2Q3Y A;  2QR9 A;  4DM6 A;  2Q8S A;  3L1B A;  5DP0 A;  4J5X C;  4EMA A;  5HYR A;  3OLL A;  3DZY D;  3FXV A;  1MZN A;  1OT7 A;  2QZO A;  4KZM A;  2ZK1 A;  4NIE A;  4R2U A;  3OMM A;  1FBY A;  3UUD A;  3OOK A;  4POJ A;  2BJ4 A;  3IPU A;  2OVH A;  3GWS X;  1XQ3 A;  4OK1 A;  1PQC A;  1K4W A;  1YY4 A;  3B0Q A;  4G21 A;  4ONI A;  4OZR U;  5KRI A;  1U3R A;  2AA2 A;  3IXP A;  4NQA B;  2JFA B;  2IOG A;  2NPA A;  2AYR A;  2VV1 A;  4DMA A;  3HVL A;  2IOK A;  2GPU A;  5KRJ A;  4X1F A;  3N00 A;  3RY9 A;  2PIU A;  4TV1 B;  5AWJ A;  3DY6 A;  4ITE A;  2P1U A;  3T03 A;  3R5N A;  3W0H A;  2XKW A;  4OJB A;  4ZO1 B;  5DYD A;  5G45 A;  1ZUC A;  3TKM A;  2NXX E;  2QA8 A;  2OAX A;  4G2I A;  3Q95 A;  2PJL A;  1IE8 A;  3JZB A;  3ADU A;  2HBH A;  2Q5P A;  1T7F A;  1E3G A;  1P8D A;  3ZRA A;  3UU7 B;  5DMF A;  4QL8 A;  2B1Z A;  3HC5 A;  4J24 A;  4UDB A;  1YP0 A;  3B0W A;  4OIU A;  5EIT A;  3CDP A;  3VI8 A;  2PIP L;  1XP9 A;  4S15 A;  1RKH A;  2PIN A;  5DVS A;  5K13 A;  5AVI A;  2AMB A;  3E00 A;  1UOM A;  1R5K A;  3FUG A;  3L0L A;  2Q6R A;  2ZK5 A;  3OLF A;  3R29 A;  3P89 A;  4PPS A;  1T7R A;  3CJW A;  5DLR A;  5HJP A;  1I7G A;  2Q7J A;  1DKF B;  5DXG A;  2ZVT A;  3IXP D;  3WGP A;  1FCZ A;  1PZL A;  1T7M A;  2LBD A;  4MG8 A;  2Q6J A;  1LBD A;  1FM6 A;  5IAW A;  2P15 A;  4YT1 A;  1M7W A;  1SJ0 A;  1X7E A;  1XJ7 A;  4N1Y A;  1RKG A;  5F9B A;  3ADS A;  1A52 A;  1Q4X A;  4MG5 A;  2O4R A;  2PKL A;  3KWY A;  3L03 A;  2HCD A;  2HWQ A;  4IA3 A;  1ILG A;  4OJ4 A;  4E4Q A;  1PRG A;  3L3Z A;  1X76 A;  2ZBS A;  4OFU A;  2GIU A;  2P1T A;  4RUJ A;  4ZNW A;  3B67 A;  1N83 A;  1YA3 A;  1UHL A;  5G3J A;  4BCR A;  5FQR A;  1MVC A;  4X1G A;  3W0A A;  1XVP B;  4HLW A;  3A40 X;  1KNU A;  3KYT A;  3OKI A;  2Q6S A;  2ZK6 A;  3P88 A;  1Z5X E;  3ILZ A;  3OSW A;  2QZO B;  1T79 A;  2G44 A;  3NSQ A;  4R6S A;  1XIU A;  3UUD B;  2BJ4 B;  5AZT A;  2EWP A;  3E00 D;  3W5T A;  2ZXZ A;  2Q70 A;  5EC9 A;  2R40 A;  3VHV A;  4L98 A;  1GS4 A;  2R6Y A;  2VV1 B;  3UP0 A;  5AVL A;  3ZQT A;  2Q7I A;  4JYG A;  4OZT E;  3HC6 A;  1X7B A;  5C4S A;  1WM0 X;  4R06 A;  3PCU A;  5E19 A;  2QGW A;  1FM6 D;  3DCU A;  1YUC A;  2E2R A;  5DZ3 A;  3IPS A;  5JI0 D;  2AA7 A;  1S0Z A;  5KCC A;  1OSH A;  4NUF A;  5A86 A;  4IS8 A;  1Z95 A;  2QA8 B;  4ITF A;  1NRL A;  2AA5 A;  3HQ5 A;  2AAX A;  3Q95 B;  3RLJ A;  4FGY A;  2ATH A;  1ZH7 A;  1G1U A;  3FLI A;  1YYE A;  3R2A A;  2YLY A;  4IUI A;  4PVU A;  2VSR A;  3VRW A;  3FUR A;  4J5X A;  4OEA A;  3SP6 A;  2P7Z A;  3HZF A;  4RMD A;  4DK7 A;  3UUA A;  3QT0 A;  1EXX A;  5DWL A;  5APK A;  3A2J A;  4KZJ A;  4FHI A;  4XAO A;  5DUE A;  3KDU A;  2GP7 A;  4IW6 A;  2VV3 A;  4OC7 A;  5AAV A;  3DCT A;  1ZEO A;  5DIG A;  4POH A;  3VT5 A;  1G2N A;  4DOS A;  5HJP B;  3AUN A;  3B5R A;  2QGT A;  4FHH A;  2R40 D;  4XHD A;  3LBD A;  5DI7 A;  4MG8 B;  2ZXM A;  2ZLC A;  4K6I A;  1KV6 A;  1XP6 A;  4RZG A;  4PP5 A;  3VTC A;  2YHD A;  5DTV A;  1FCY A;  3KBA A;  4IQR A;  2XHS A;  1K74 A;  2I4J A;  2B50 A;  2ZKC A;  4RZE A;  2OZ7 A;  2ZNQ A;  4MGA A;  3UUC A;  1XDK A;  2HVC A;  2NW4 A;  5KR9 A;  3U9Q A;  1R1K A;  1XP1 A;  1UHL B;  2P7A A;  2ZAS A;  4G1Y A;  5KRK A;  3K8S A;  2ABI A;  4OZT U;  3SZ1 A;  4K7A A;  1ERR A;  4XUM A;  3CQV A;  3IMY A;  3K6P A;  3OOF A;  4MGB A;  5DU5 A;  3W5P A;  5KCE A;  5E1C A;  3OSI A;  1UPV A;  1Y9R A;  3PEQ A;  3GZ9 A;  2QXS A;  4QE8 A;  2PRG A;  1PQ9 A;  4RMC A;  1T5Z A;  4ZI1 A;  2Q61 A;  3CS8 A;  4MG7 A;  3VT8 A;  1BSX A;  3VSO A;  3X1H A;  1S9Q A;  3WT6 A;  3V49 A;  3UVV A;  4CSJ A;  5CJ6 A;  4ZOM A;  2G0H A;  3FEJ A;  3KFC A;  4RZF A;  4YPQ A;  4OH6 A;  3FAL A;  5KCU A;  3OS9 A;  3UP3 A;  1L2J A;  2J4A A;  2AXA A;  2I4Z A;  1NHZ A;  3OAP A;  1GWX A;  4ZNT A;  1T65 A;  4M8E A;  5JY3 A;  1NUO A;  4CI4 A;  5DKB A;  2P1V A;  3TKC A;  2QTU A;  2YLP A;  3W0Y A;  4MGC A;  2PNU A;  4IA7 A;  3P0U A;  3VTD A;  1HJ1 A;  2QMV A;  5KRM A;  5KRH A;  5DZH A;  4CI5 A;  3GWX A;  1R1K D;  5KRL A;  1OVL A;  1S9P A;  3VRU A;  1U3S A;  3UUA B;  4A2J A;  2YJD A;  2ZK2 A;  4B7W A;  2GPP A;  5AAV B;  3VT3 A;  1QKM A;  4ZN7 A;  3PBA A;  5EHJ A;  1R20 A;  2I0G A;  1Y0X X;  2ZMJ A;  4PLE A;  4Q50 A;  5DXB A;  5E0X A;  2VST A;  4ZO1 X;  1NQ2 A;  4JYH A;  3R8D A;  5DRJ A;  3VT7 A;  4E4K A;  5DIE A;  3VJT A;  2F4B A;  2OVM A;  2QXM A;  1LV2 A;  4OEZ A;  4WQP A;  5DWJ A;  5GID A;  5B41 A;  3IA6 A;  3KPZ A;  3B68 A;  3GYU A;  2PIV A;  1QKT A;  1YMT A;  3B65 A;  3R8I A;  3A9E A;  3OKH A;  3F5C A;  4RWV A;  3D24 A;  5AYG A;  2HAM A;  5DX3 A;  4MGA B;  1SKX A;  4P6X A;  5GIC A;  1XDK B;  3BQD A;  1XNN A;  1E3K A;  3AUQ A;  1S0X A;  1SQN A;  1U3Q A;  1KKQ A;  4S14 A;  4YNK A;  1YIM A;  5DXK A;  4G20 A;  4PP3 A;  2HAR A;  4OGH A;  3OMQ A;  4PLD A;  4Q0A C;  1EXA A;  2QNV A;  4MGB B;  2Q60 A;  1MV9 A;  3AZ3 A;  3AZ2 A;  5KCT A;  1L2I A;  2XYJ A;  5M96 A;  2ZL9 A;  4HEE X;  2QAB A;  3ET2 A;  3VJH A;  4XI3 A;  3VT4 A;  3VHU A;  2HB7 A;  5LGA A;  2AWH A;  1NYX A;  4MG7 B;  3P8X A;  4RUO X;  5E15 A;  2REW A;  3V9Y A;  1R20 D;  2ZNO A;  4IWC A;  3WMH A;  4RE8 A;  1I37 A;  3A2H A;  4OIV A;  3UVV B;  1YIN A;  3KMZ A;  3K22 A;  4RUP A;  4EM9 A;  1OSV A;  5DVV A;  1I7I A;  2ZFX A;  1ZGY A;  3FAL B;  5HZC A;  1YOW A;  1R6G A;  2Q1V A;  3B0R A;  4ZNS A;  1QKU A;  5KYJ A;  4UDA A;  2P7G A;  1HG4 A;  2GPV A;  3B3K A;  4Y29 A;  3PO9 A;  4JL4 A;  1FM9 A;  3G9E A;  3L0E A;  3WFG A;  1PDU A;  5H1E A;  4OEY A;  1G50 A;  2YAT A;  3VRV A;  5DSH A;  3ET3 A;  5ETH A;  3ET1 A;  4MG6 A;  5IZ0 A;  4YMQ A;  3R8A A;  1ZKY A;  2HC4 A;  5JJM A;  1OVL B;  3GN8 A;  3VHW A;  5ICK A;  4ZN9 A;  2HB8 A;  3H0A A;  3PRG A;  5DZ0 A;  3FC6 A;  2ZXN A;  5EGV A;  3OZJ A;  2V0V A;  4APU A;  1TXI A;  4QJR A;  3WWR A;  1I38 A;  4MGD A;  4WPF A;  3VJS A;  5AZV A;  5APJ A;  2QH6 A;  5FQV A;  3CWD A;  3M7R A;  5DXB B;  4ZNV A;  3ET0 A;  5DUG A;  1Y0S A;  1N4H A;  3D5F A;  4WVD A;  2J14 A;  3CLD A;  3PLZ A;  1T76 A;  1XQC A;  3G8O A;  2O9I A;  3HLV A;  2PIQ A;  5C4U A;  1Z5X U;  3RVF A;  3A2I A;  1NDE A;  2FSZ A;  1T73 A;  4OFR A;  3HM1 A;  5L7H A;  5SYZ A;  5KRA A;  2VV4 A;  3A9E B;  3F5C B;  1N46 A;  4LNX A;  3E7C A;  4Q13 A;  5DV8 A;  3OS8 C;  4LTW A;  3GYT A;  5L11 A;  5DX3 B;  4O8F A;  4ZJW A;  4FN9 A;  1NQ0 A;  3D6D A;  4JYI A;  2ZK4 A;  4MDD A;  1SR7 A;  1T7T A;  4UDC A;  3D57 A;  1NQ7 A;  3DR1 A;  3HOD A;  5GT4 A;  4IV4 A;  2GL8 A;  3AFR A;  4NY9 A;  3V3E A;  3DZU A;  3D90 A;  3CS6 A;  5DZ1 A;  3DT3 A;  3H0A D;  5DWE A;  5G44 A;  1RK3 A;  2QW4 A;  4OIL A;  2H77 A;  1XOW A;  2AX7 A;  4NB6 A;  3AX8 A;  4J5W C;  2G0G A;  1FCX A;  3RUU A;  4DOR A;  5EJV A;  5FQT A;  2J7X A;  4J26 A;  4LSJ A;  1T74 A;  3OZ0 A;  4OKT A;  2I4P A;  4G1Z A;  1UPW A;  4RFW A;  5FQS A;  3VSP A;  5E0W A;  2YLQ A;  3KMR A;  3OMO A;  1S19 A;  3FS1 A;  5IXK A;  2O4J A;  4OAR A;  4XT9 A;  2QA6 A;  2GPO A;  1ERE A;  2VV0 A;  3W0C A;  1NAV A;  1T63 A;  2XYX A;  5E14 A;  3W5Q A;  5ACC A;  3CS4 A;  1K74 D;  2Q59 A;  3MNP A;  5DL4 A;  3W0J A;  4ZNH A;  3ERT A;  3EYB A;  4S0S A;  3WT7 A;  1XB7 A;  5DZI A;  5EI1 A;  3ZRB A;  3OGT A;  2OM9 A;  5DUH A;  4OH5 A;  3ADW A;  5JJM B;  4XUH A;  4A4W A;  5AAU A;  4QM0 A;  4RME A;  2QPY A;  1A28 A;  2YJA B;  2IHQ A;  1X7J A;  2PIX A;  1G5Y A;  1ILH A;  3B66 A;  1YJE A;  2B1V A;  3FC6 B;  2ZMH A;  3DZU D;  4OKX A;  3RUT A;  2ZNN A;  3ADX A;  3CDS A;  3OLS A;  4TUZ A;  2I0J A;  5L7G A;  3AUR A;  4WLB A;  4MGD B;  3H52 A;  5DXQ A;  4IV2 A;  2HFP A;  5DMC A;  3WJ5 A;  5DVC A;  3IPQ A;  4PXM A;  3ZR7 A;  2FVJ A;  5G46 A;  3SP9 A;  2A3I A;  3A78 A;  4LNW A;  3AZ1 A;  5AWK A;  2QSE A;  5DV6 A;  3E94 A;  5HCV A;  3ADT A;  2VV4 B;  3L0J A;  3X31 A;  3W0G A;  4MG9 A;  1NQ1 A;  3V9V A;  3VRT A;  2XYW A;  4DQM A;  3R5M A;  2BAW A;  1ZAF A;  2AM9 A;  3RLL A;  2Z4J A;  3A3Z X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...