5B5BA

Crystal structure of vdr-lbd complexed with 2-methylidene-26,27-diphenyl-19-nor-1,25-dihydroxyvitamin d3
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
260
structure length
249
Chain Sequence
SPLKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMSPLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helix12-Stabilization Antagonist of Vitamin D Receptor
pubmed doi rcsb
molecule keywords Vitamin D3 receptor
molecule tags Transcription
source organism Rattus norvegicus
total genus 100
structure length 249
sequence length 260
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5b5bA00
1VJBA 5AAVA 1ZDUA 3PLZA 1FM9D 3FC6A 3D90A 4CSJA 3KBAA 4OKXA 4ZNHA 3UUAB 2VV2A 5ETHA 3B0QA 4O8FA 5DSHA 3WWRA 5KRCA 1X76A 2P15A 3TX7B 4WQPA 3OZJA 5KCEA 3OS9A 1QKMA 5AAVB 1R1KD 2B50A 1IE9A 3FC6B 4MGAA 4RZFA 3A2IA 1WM0X 5DMCA 2POBA 3W5QA 1GWRA 3A40X 1E3GA 5KCWA 3D5FA 4PXMA 4OHAA 1OVLA 4S14A 5IZ0A 1U3SA 1ZDTA 3A2HA 4IA2A 4OH6A 1X7JA 1FM6D 1RDTD 5DU5A 1YYEA 4JAZA 4LNXA 4XT9A 3OS8A 1OSHA 4MGAB 1RJKA 4OJ9A 5DXGA 1U3RA 3UP3A 3OMOA 2A3IA 5FQTA 4K7AA 4OILA 5SYZA 3UUDA 1OVLB 1FBYA 3VT5A 2Q70A 2AMBA 3TY0A 4M8EA 4OC7A 1FCYA 4Q50A 1IE8A 5L11A 2PIVA 2P7ZA 4IS8A 5DZ3A 3FXVA 4MGDA 2P7AA 3PRGA 5FQRA 1DB1A 1S0ZA 1ZGYA 1YY4A 2Q6RA 3GYUA 4UDBA 4PRGA 1XP6A 2YJDA 4OZTU 3UUDB 1S19A 2VV1A 3L03A 3E00D 5KRLA 5HJSA 4ITEA 4ZO1B 5KROA 1N4HA 5CJ6A 2BJ4A 4MGDB 1T5ZA 2Q1VA 2I4JA 4G20A 2HARA 2I0JA 4PLDA 4NUFA 4R06A 1Y0SA 4OK1A 4J26A 5DWLA 2VV1B 1YJEA 5AK2A 4OARA 3PO9A 1EREA 5EJVA 3VT9A 1RKHA 3WGPA 1L2JA 2NPAA 3OLSA 1Y9RA 5AVLA 5G42A 2BJ4B 3W0YA 4WHFA 1XQCA 3ET2A 2QA6A 3B66A 4ZO1X 3VT7A 3VT3A 1PQ6A 4G21A 3K22A 3VJTA 5G3JA 3W0GA 2ZVTA 4S0TA 3UUCA 2QXSA 3VTCA 3BQDA 3IA6A 1G2NA 1FCXA 2H77A 2F4BA 2ZNOA 3FALA 2IHQA 2GL8A 2AWHA 1XLSA 4RFWA 4FNEA 1HJ1A 2R6WA 2HFPA 4OFRA 1XLSE 3RVFA 3WFGA 4CI4A 4IV4A 3TKMA 1YA3A 3R2AA 2GPUA 4OIUA 5AVIA 2QXMA 1QKUA 5DUEA 4IU7A 2GWXA 2YLOA 5KRHA 2ZFXA 3FALB 5G46A 3HZFA 1I7GA 2XYJA 1T65A 4OJBA 3IXPD 5DP0A 1PQ9A 3R29A 4APUA 1NQ7A 2YLPA 2ZL9A 4RE8A 1ZAFA 4WHGA 3UVVA 4LSJA 3WJ5A 2R40D 5E7VA 1LV2A 2Q1HA 3GYTA 3ERTA 4PPSA 4WLBA 4ZNTA 4PF3A 1NYXA 5DZ0A 5IAWA 3OOKA 5E15A 1XDKA 3M7RA 3OKHA 1YOWA 4E2JA 1XP9A 3UVVB 4IA7A 5DX3A 3RLJA 3Q95A 2ZK6A 5KR9A 3AN4A 3ET1A 5EHJA 1XVPA 1K74A 4ZNSA 5EITA 4OEYA 4RAKA 1XDKB 2P1UA 3AUNA 2Z4BA 2PIWA 4Q0AC 2V0VA 5FQSA 5DIEA 5DRJA 4PPPA 5DYBA 4DM6A 5DX3B 1YP0A 3B5RA 2Q7KA 3ERDA 3Q95B 1M2ZA 4LTWA 2QZOA 5DY8A 1T76A 4G1YA 3W0CA 4LNWA 5DV8A 1XVPB 2REWA 3K6PA 1NQ2A 3O1EA 1ZH7A 3V3EA 2HASA 3A3ZX 3VHUA 5G5WA 4IVYA 2ZK3A 1PQCA 2QZOB 4XUMA 1R20D 1X7EA 4E4QA 2G0HA 2XYXA 3VJHA 2ZXZA 5DV3A 4ZI1A 2HCDA 1XJ7A 4X1FA 3H0AA 2AO6A 4PP6A 5DXMA 2ZY0A 4J5XA 5AYGA 1U9EA 2PIPL 3AX8A 5E0XA 4OEZA 3V9TA 3UU7B 3KMGA 4JL4A 1A52A 3BEJA 1M7WA 4HEEX 4OKWA 1NAVA 3QT0A 5L7GA 4PVUA 2ZLCA 3W0JA 4J5WA 4ZJRA 1X78A 3UP0A 1YUCA 5HZCA 1NRLA 1OT7A 5M96A 4L98A 5LWPA 1ILGA 4RMEA 1OSVA 1XPCA 3OZ0A 3PEQA 4JYIA 4Q13A 2AMAA 2J7YA 4DQMA 2HWRA 3L0LA 1ILHA 4QJRA 1XIUA 4P6WA 3RUTA 1QKTA 4QK4A 3OMMA 5DRMA 5DWGA 4OZRU 3W5RA 5DWIA 2E2RA 1GWXA 1T7MA 1RDTA 3BC5A 5E0WA 5KRFA 1E3KA 1EXAA 1RK3A 2POGA 3A78A 1S9PA 5DZHA 3VI8A 3VRWA 2P54A 3W5PA 3X1IA 2GP7A 3VTDA 3X31A 3G0WA 1T74A 3LMPA 1Q4XA 5DZ1A 3ILZA 4ITFA 1H9UA 3A9EA 3E00A 3HM1A 3R8AA 5DKGA 5GIEA 1HG4A 4MG8A 4A4WA 5KCUA 1GS4A 4QE6A 4XLDA 1NDEA 3D6DA 2AX7A 1XB7A 4MGCA 4NY9A 4IW8A 4KZJA 4IWFA 3DZYA 2PIOA 4EM9A 1N83A 4P6XA 4G2IA 3A9EB 3V49A 2B1ZA 3W0IA 4MG8B 5HJPA 3HC6A 1PDUA 3P8XA 3MNOA 1P93A 2QGTA 4N8RA 3RLLA 2Q3YA 3PCUA 3OMQA 3R5NA 4OKTA 4N1YA 2YLYA 1T7RA 3GBKA 3JZBA 5L7HA 4OKBA 3VJSA 1NUOA 4S15A 2ZK2A 3HLVA 2J7XA 4RMCA 5HJPB 4XAOA 1PCGA 3FURA 1Y0XX 1S0XA 3OGTA 5FQVA 3AFRA 4REEA 4S0SA 5KCCA 5APHA 5HYKA 1A28A 5KCFA 2JF9A 2ATHA 4JGVA 3OMKA 3RUUA 5DXKA 2PIUA 4YT1A 3VT4A 3AN3A 2P1TA 5I4VA 4IVWA 1XOWA 3EYBA 3NSPA 4DK7A 1NQ0A 5C4TA 4DMAA 5KRJA 2W8YA 3VRVA 5H1EA 3ET0A 3CS6A 3OLLA 1PZLA 4MDDA 1I7IA 3FUGA 4OLMA 3KFCA 2ZXMA 5DXEA 4G1DA 3CQVA 5AZTA 4IA1A 2ZK5A 4RUPA 3CS4A 4K4JA 4RUJA 5E14A 5DXQA 5F9BA 3ZRBA 4TV1A 2G44A 2OVMA 2GPOA 3G8OA 3AZ3A 3WJ4A 4IWCA 1FCZA 2HWQA 5DWEA 5AWKA 3OLFA 1KNUA 3KWYA 3OOFA 4RZGA 2Q5PA 4TUZA 5DK9A 2LBDA 3ZRAA 4QE8A 5KYAA 4PP5A 4TV1B 3SP6A 1UHLA 1ZUCA 2R40A 2J4AA 1P8DA 4OFUA 3FLIA 3OS8C 4E4KA 2P4YA 2HAMA 3HC5A 4R2UA 3TKCA 2QPYA 2AX8A 2PIRA 4XHDA 4DORA 1TXIA 4TUZB 1TFCA 4F9MA 3AZ2A 2AA6A 3P0UA 2IOKA 1Z5XE 4REFA 2OM9A 5GIDA 1N46A 1XV9A 2AA5A 1UHLB 5DIGA 4L96A 2Q8SA 1PRGA 2V7CA 2AM9A 2YLQA 4ZN7A 3L3XA 2QW4A 5DIDA 2QH6A 4JYHA 2OAXA 1XNNA 1T7FA 4LBDA 4FN9A 2Q7JA 1SQNA 5IXKA 1XV9B 3HVLA 4OEDA 1KKQA 1G50A 5DLRA 2NW4A 3VSOA 3VHWA 4IW6A 2QNVA 1K74D 3WMHA 3WFFA 5KRKA 2OVHA 3F5CA 4PP3A 4QM0A 4CI5A 2GTKA 4PLEA 5DVCA 3K23A 1K4WA 3F7DA 3UU7A 1SR7A 3V4AA 2XYWA 4XI3A 2HC4A 3AZ1A 3G8IA 2R6YA 3V9YA 3IPQA 3FEIA 5G44A 4ZNWA 4KZIA 5KRAA 1I38A 2GPPA 2YHDA 1M13A 3F5CB 3KMRA 4A2JA 5KCDA 3VN2A 5DUGA 3DZUA 2QTUA 2PKLA 3B67A 3N00A 1SKXA 3VJIA 1T73A 1UPVA 2QMVA 4ONIA 3D57A 5KD9A 4RWVA 1XP1A 3VTBA 1FM9A 2Q6JA 5DVSA 1XZXX 2I0GA 2FAIA 2QE4A 4RUOX 1I37A 1T63A 2HB7A 2QSEA 2ZLAA 3B65A 5HYRA 2AA7A 2FVJA 4HLWA 3CWDA 5KYJA 3OMPA 1X7RA 1YMTA 4XTAA 4YPQA 1R1KA 4OIVA 2Q61A 3V3QA 1X7BA 1FD0A 1RKGA 1G1UA 2AB2A 3WT5A 4FHIA 5EGVA 2XKWA 3WTQA 3CJWA 1K7LA 1EXXA 3A2JA 4OGHA 3RY9A 5KRMA 4RMDA 2HB8A 1FM6A 2VSRA 4OZRE 4FGYA 1YIMA 4POHA 2PJLA 5C4OA 2JFAA 2Q60A 3WT6A 4BCRA 3ADWA 4DK8A 3DY6A 3DR1A 4MG7A 3K8SA 1GWQA 2O9IA 2PIXA 2VV4A 3B0TA 4MG6A 1UPWA 3B68A 3T03A 2AA2A 1XAPA 5C4SA 3B0RA 3PBAA 5DI7A 4XUHA 2JFAB 2I4ZA 2VV3A 4OZTE 3B0WA 4IV2A 3VHVA 4RZEA 4UDAA 2QR9A 2YJAB 3OSAA 2OUZA 3MNEA 3B3KA 4MG7B 3L1BA 4OEAA 5JJMA 1MVCA 4OJ4A 3GD2A 3OAPA 3IMYA 2VV4B 2ZK4A 2ZK1A 2IOGA 3H52A 1DKFA 4K6IA 3ADVA 3G9EA 2B23A 4UDCA 4A4VA 5AZVA 2ZNQA 1ERRA 4ZNVA 5DMFA 2ZKCA 3VRUA 2ZMHA 2ZMIA 1NQ1A 3SP9A 5GT4A 2O4RA 2QABA 3OKIA 2HBHA 5JJMB 3GWSX 2VSTA 3KDUA 3DZYD 2ZK0A 1DKFB 2QGWA 2ZXNA 3L3ZA 3P89A 3S9SA 3DCUA 2AYRA 3X36A 4G1ZA 5APKA 5AWJA 4NB6A 3E94A 5C4UA 3ZQTA 5DXPA 5ICKA 3E7CA 2QA8A 3HO0A 3CS8A 5DUHA 1R6GA 1NAXA 2H79A 4UDDA 5JI0D 2HVCA 4J5XC 4R6SA 3VT6A 4QL8A 3WT7A 3ADXA 3LBDA 1G5YA 2AX9A 2Q7IA 4JYGA 3GN8A 4ZOMA 3W0HA 1KV6A 3OSIA 4FHHA 1ZKYA 3SZ1A 2B1VA 2QA8B 4NQAB 3D24A 2AX6A 4J5WC 4KZMA 5DXRA 4NIEA 3O1DA 1Z95A 2ZNNA 4DOSA 1T79A 5APJA 4YMQA 5B41A 5K13A 1S9QA 3IXPA 2AXAA 2Q5GA 3R5MA 3CLDA 1QKNA 1NHZA 4MG9A 2GIUA 5KRIA 3DT3A 1MZNA 2PIQA 2VV0A 3HQ5A 3KMZA 4MG5A 3GZ9A 4N73A 2P1VA 1YOKA 4IQRA 2ZMJA 2ZASA 5DKSA 4Y29A 2YFEA 3VT8A 1YINA 2ZBSA 5ACCA 5DYDA 1SJ0A 3CDSA 4MG9B 2YATA 4X1GA 4MGBA 4OH5A 1XQ3A 2J14A 2Z4JA 5DL4A 4ZN9A 1L2IA 5EI1A 3L0JA 5AAUA 4DM8A 5FQPA 3P88A 2PINA 3U9QA 1LBDA 2ACLA 5DXBA 2JJ3A 4N5GA 4MGBB 1U3QA 2I4PA 4IUIA 2Q59A 3AURA 2NXXA 3DCTA 5GICA 2EWPA 3W5TA 2NXXE 2P7GA 5G43A 4ZJWA 5DKBA 4POJA 4WPFA 1Z5XU 3ET3A 3L0EA 2ACLB 5DXBB 5DVVA 4J24A 3V9VA 4EMAA 4PWLA 3VRTA 2Q59B 2ABIA 1UOMA 3KDTA 5DKEA 2PITA 5DTVA 5E19A 5A86A 5LGAA 4M8HA 3FEJA 3KPZA 3MNPA 2ZNPA 2Q5SA 5L7EA 1R20A 1T7TA 2G5OA 2GPVA 3OSWA 2G0GA 3ADTA 4IA3A 3CTBA 5JY3A 4YNKA 5EC9A 2OCFA 1PK5A 5G45A 1MV9A 2XHSA 4G2HA 5DV6A 2Q7LA 5B5BA 3R8IA 2Q6SA 1ZEOA 3FS1A 3IPSA 5DZIA 3GWXA 5E1CA 5KCTA 3HODA 3AUQA 3ADUA 3KYTA 2NV7A 3B1MA 3VSPA 2AAXA 3NOAA 4ZNUA 1XNXA 5DWJA 3H0AD 4WVDA 2OZ7A 2PRGA 3W0AA 3ADSA 3R8DA 3X1HA 3ZR7A 3JZCA 5HCVA 3UUAA 1BSXA 3CDPA 2O4JA 2FSZA 2PNUA 3DZUD 3IPUA 3NSQA 2BAWA 1R5KA 4B7WA
chains in the Genus database with same CATH superfamily
1VJBA 5AAVA 1ZDUA 3PLZA 1FM9D 3FC6A 3D90A 4CSJA 3KBAA 4OKXA 4ZNHA 3UUAB 2VV2A 5ETHA 3B0QA 4O8FA 5DSHA 3WWRA 5KRCA 1X76A 2P15A 3TX7B 4WQPA 3OZJA 5KCEA 3OS9A 1QKMA 5AAVB 1R1KD 2B50A 1IE9A 3FC6B 4MGAA 4RZFA 3A2IA 1WM0X 5DMCA 2POBA 3W5QA 1GWRA 3A40X 1E3GA 5KCWA 3D5FA 4PXMA 4OHAA 1OVLA 4S14A 5IZ0A 1U3SA 1ZDTA 3A2HA 4IA2A 4OH6A 1X7JA 1FM6D 1RDTD 5DU5A 1YYEA 4JAZA 4LNXA 4XT9A 3OS8A 1OSHA 4MGAB 1RJKA 4OJ9A 5DXGA 1U3RA 3UP3A 3OMOA 2A3IA 5FQTA 4K7AA 4OILA 5SYZA 3UUDA 1OVLB 1FBYA 3VT5A 2Q70A 2AMBA 3TY0A 4M8EA 4OC7A 1FCYA 4Q50A 1IE8A 5L11A 2PIVA 2P7ZA 4IS8A 5DZ3A 3FXVA 4MGDA 2P7AA 3PRGA 5FQRA 1DB1A 1S0ZA 1ZGYA 1YY4A 2Q6RA 3GYUA 4UDBA 4PRGA 1XP6A 2YJDA 4OZTU 3UUDB 1S19A 2VV1A 3L03A 3E00D 5KRLA 5HJSA 4ITEA 4ZO1B 5KROA 1N4HA 5CJ6A 2BJ4A 4MGDB 1T5ZA 2Q1VA 2I4JA 4G20A 2HARA 2I0JA 4PLDA 4NUFA 4R06A 1Y0SA 4OK1A 4J26A 5DWLA 2VV1B 1YJEA 5AK2A 4OARA 3PO9A 1EREA 5EJVA 3VT9A 1RKHA 3WGPA 1L2JA 2NPAA 3OLSA 1Y9RA 5AVLA 5G42A 2BJ4B 3W0YA 4WHFA 1XQCA 3ET2A 2QA6A 3B66A 4ZO1X 3VT7A 3VT3A 1PQ6A 4G21A 3K22A 3VJTA 5G3JA 3W0GA 2ZVTA 4S0TA 3UUCA 2QXSA 3VTCA 3BQDA 3IA6A 1G2NA 1FCXA 2H77A 2F4BA 2ZNOA 3FALA 2IHQA 2GL8A 2AWHA 1XLSA 4RFWA 4FNEA 1HJ1A 2R6WA 2HFPA 4OFRA 1XLSE 3RVFA 3WFGA 4CI4A 4IV4A 3TKMA 1YA3A 3R2AA 2GPUA 4OIUA 5AVIA 2QXMA 1QKUA 5DUEA 4IU7A 2GWXA 2YLOA 5KRHA 2ZFXA 3FALB 5G46A 3HZFA 1I7GA 2XYJA 1T65A 4OJBA 3IXPD 5DP0A 1PQ9A 3R29A 4APUA 1NQ7A 2YLPA 2ZL9A 4RE8A 1ZAFA 4WHGA 3UVVA 4LSJA 3WJ5A 2R40D 5E7VA 1LV2A 2Q1HA 3GYTA 3ERTA 4PPSA 4WLBA 4ZNTA 4PF3A 1NYXA 5DZ0A 5IAWA 3OOKA 5E15A 1XDKA 3M7RA 3OKHA 1YOWA 4E2JA 1XP9A 3UVVB 4IA7A 5DX3A 3RLJA 3Q95A 2ZK6A 5KR9A 3AN4A 3ET1A 5EHJA 1XVPA 1K74A 4ZNSA 5EITA 4OEYA 4RAKA 1XDKB 2P1UA 3AUNA 2Z4BA 2PIWA 4Q0AC 2V0VA 5FQSA 5DIEA 5DRJA 4PPPA 5DYBA 4DM6A 5DX3B 1YP0A 3B5RA 2Q7KA 3ERDA 3Q95B 1M2ZA 4LTWA 2QZOA 5DY8A 1T76A 4G1YA 3W0CA 4LNWA 5DV8A 1XVPB 2REWA 3K6PA 1NQ2A 3O1EA 1ZH7A 3V3EA 2HASA 3A3ZX 3VHUA 5G5WA 4IVYA 2ZK3A 1PQCA 2QZOB 4XUMA 1R20D 1X7EA 4E4QA 2G0HA 2XYXA 3VJHA 2ZXZA 5DV3A 4ZI1A 2HCDA 1XJ7A 4X1FA 3H0AA 2AO6A 4PP6A 5DXMA 2ZY0A 4J5XA 5AYGA 1U9EA 2PIPL 3AX8A 5E0XA 4OEZA 3V9TA 3UU7B 3KMGA 4JL4A 1A52A 3BEJA 1M7WA 4HEEX 4OKWA 1NAVA 3QT0A 5L7GA 4PVUA 2ZLCA 3W0JA 4J5WA 4ZJRA 1X78A 3UP0A 1YUCA 5HZCA 1NRLA 1OT7A 5M96A 4L98A 5LWPA 1ILGA 4RMEA 1OSVA 1XPCA 3OZ0A 3PEQA 4JYIA 4Q13A 2AMAA 2J7YA 4DQMA 2HWRA 3L0LA 1ILHA 4QJRA 1XIUA 4P6WA 3RUTA 1QKTA 4QK4A 3OMMA 5DRMA 5DWGA 4OZRU 3W5RA 5DWIA 2E2RA 1GWXA 1T7MA 1RDTA 3BC5A 5E0WA 5KRFA 1E3KA 1EXAA 1RK3A 2POGA 3A78A 1S9PA 5DZHA 3VI8A 3VRWA 2P54A 3W5PA 3X1IA 2GP7A 3VTDA 3X31A 3G0WA 1T74A 3LMPA 1Q4XA 5DZ1A 3ILZA 4ITFA 1H9UA 3A9EA 3E00A 3HM1A 3R8AA 5DKGA 5GIEA 1HG4A 4MG8A 4A4WA 5KCUA 1GS4A 4QE6A 4XLDA 1NDEA 3D6DA 2AX7A 1XB7A 4MGCA 4NY9A 4IW8A 4KZJA 4IWFA 3DZYA 2PIOA 4EM9A 1N83A 4P6XA 4G2IA 3A9EB 3V49A 2B1ZA 3W0IA 4MG8B 5HJPA 3HC6A 1PDUA 3P8XA 3MNOA 1P93A 2QGTA 4N8RA 3RLLA 2Q3YA 3PCUA 3OMQA 3R5NA 4OKTA 4N1YA 2YLYA 1T7RA 3GBKA 3JZBA 5L7HA 4OKBA 3VJSA 1NUOA 4S15A 2ZK2A 3HLVA 2J7XA 4RMCA 5HJPB 4XAOA 1PCGA 3FURA 1Y0XX 1S0XA 3OGTA 5FQVA 3AFRA 4REEA 4S0SA 5KCCA 5APHA 5HYKA 1A28A 5KCFA 2JF9A 2ATHA 4JGVA 3OMKA 3RUUA 5DXKA 2PIUA 4YT1A 3VT4A 3AN3A 2P1TA 5I4VA 4IVWA 1XOWA 3EYBA 3NSPA 4DK7A 1NQ0A 5C4TA 4DMAA 5KRJA 2W8YA 3VRVA 5H1EA 3ET0A 3CS6A 3OLLA 1PZLA 4MDDA 1I7IA 3FUGA 4OLMA 3KFCA 2ZXMA 5DXEA 4G1DA 3CQVA 5AZTA 4IA1A 2ZK5A 4RUPA 3CS4A 4K4JA 4RUJA 5E14A 5DXQA 5F9BA 3ZRBA 4TV1A 2G44A 2OVMA 2GPOA 3G8OA 3AZ3A 3WJ4A 4IWCA 1FCZA 2HWQA 5DWEA 5AWKA 3OLFA 1KNUA 3KWYA 3OOFA 4RZGA 2Q5PA 4TUZA 5DK9A 2LBDA 3ZRAA 4QE8A 5KYAA 4PP5A 4TV1B 3SP6A 1UHLA 1ZUCA 2R40A 2J4AA 1P8DA 4OFUA 3FLIA 3OS8C 4E4KA 2P4YA 2HAMA 3HC5A 4R2UA 3TKCA 2QPYA 2AX8A 2PIRA 4XHDA 4DORA 1TXIA 4TUZB 1TFCA 4F9MA 3AZ2A 2AA6A 3P0UA 2IOKA 1Z5XE 4REFA 2OM9A 5GIDA 1N46A 1XV9A 2AA5A 1UHLB 5DIGA 4L96A 2Q8SA 1PRGA 2V7CA 2AM9A 2YLQA 4ZN7A 3L3XA 2QW4A 5DIDA 2QH6A 4JYHA 2OAXA 1XNNA 1T7FA 4LBDA 4FN9A 2Q7JA 1SQNA 5IXKA 1XV9B 3HVLA 4OEDA 1KKQA 1G50A 5DLRA 2NW4A 3VSOA 3VHWA 4IW6A 2QNVA 1K74D 3WMHA 3WFFA 5KRKA 2OVHA 3F5CA 4PP3A 4QM0A 4CI5A 2GTKA 4PLEA 5DVCA 3K23A 1K4WA 3F7DA 3UU7A 1SR7A 3V4AA 2XYWA 4XI3A 2HC4A 3AZ1A 3G8IA 2R6YA 3V9YA 3IPQA 3FEIA 5G44A 4ZNWA 4KZIA 5KRAA 1I38A 2GPPA 2YHDA 1M13A 3F5CB 3KMRA 4A2JA 5KCDA 3VN2A 5DUGA 3DZUA 2QTUA 2PKLA 3B67A 3N00A 1SKXA 3VJIA 1T73A 1UPVA 2QMVA 4ONIA 3D57A 5KD9A 4RWVA 1XP1A 3VTBA 1FM9A 2Q6JA 5DVSA 1XZXX 2I0GA 2FAIA 2QE4A 4RUOX 1I37A 1T63A 2HB7A 2QSEA 2ZLAA 3B65A 5HYRA 2AA7A 2FVJA 4HLWA 3CWDA 5KYJA 3OMPA 1X7RA 1YMTA 4XTAA 4YPQA 1R1KA 4OIVA 2Q61A 3V3QA 1X7BA 1FD0A 1RKGA 1G1UA 2AB2A 3WT5A 4FHIA 5EGVA 2XKWA 3WTQA 3CJWA 1K7LA 1EXXA 3A2JA 4OGHA 3RY9A 5KRMA 4RMDA 2HB8A 1FM6A 2VSRA 4OZRE 4FGYA 1YIMA 4POHA 2PJLA 5C4OA 2JFAA 2Q60A 3WT6A 4BCRA 3ADWA 4DK8A 3DY6A 3DR1A 4MG7A 3K8SA 1GWQA 2O9IA 2PIXA 2VV4A 3B0TA 4MG6A 1UPWA 3B68A 3T03A 2AA2A 1XAPA 5C4SA 3B0RA 3PBAA 5DI7A 4XUHA 2JFAB 2I4ZA 2VV3A 4OZTE 3B0WA 4IV2A 3VHVA 4RZEA 4UDAA 2QR9A 2YJAB 3OSAA 2OUZA 3MNEA 3B3KA 4MG7B 3L1BA 4OEAA 5JJMA 1MVCA 4OJ4A 3GD2A 3OAPA 3IMYA 2VV4B 2ZK4A 2ZK1A 2IOGA 3H52A 1DKFA 4K6IA 3ADVA 3G9EA 2B23A 4UDCA 4A4VA 5AZVA 2ZNQA 1ERRA 4ZNVA 5DMFA 2ZKCA 3VRUA 2ZMHA 2ZMIA 1NQ1A 3SP9A 5GT4A 2O4RA 2QABA 3OKIA 2HBHA 5JJMB 3GWSX 2VSTA 3KDUA 3DZYD 2ZK0A 1DKFB 2QGWA 2ZXNA 3L3ZA 3P89A 3S9SA 3DCUA 2AYRA 3X36A 4G1ZA 5APKA 5AWJA 4NB6A 3E94A 5C4UA 3ZQTA 5DXPA 5ICKA 3E7CA 2QA8A 3HO0A 3CS8A 5DUHA 1R6GA 1NAXA 2H79A 4UDDA 5JI0D 2HVCA 4J5XC 4R6SA 3VT6A 4QL8A 3WT7A 3ADXA 3LBDA 1G5YA 2AX9A 2Q7IA 4JYGA 3GN8A 4ZOMA 3W0HA 1KV6A 3OSIA 4FHHA 1ZKYA 3SZ1A 2B1VA 2QA8B 4NQAB 3D24A 2AX6A 4J5WC 4KZMA 5DXRA 4NIEA 3O1DA 1Z95A 2ZNNA 4DOSA 1T79A 5APJA 4YMQA 5B41A 5K13A 1S9QA 3IXPA 2AXAA 2Q5GA 3R5MA 3CLDA 1QKNA 1NHZA 4MG9A 2GIUA 5KRIA 3DT3A 1MZNA 2PIQA 2VV0A 3HQ5A 3KMZA 4MG5A 3GZ9A 4N73A 2P1VA 1YOKA 4IQRA 2ZMJA 2ZASA 5DKSA 4Y29A 2YFEA 3VT8A 1YINA 2ZBSA 5ACCA 5DYDA 1SJ0A 3CDSA 4MG9B 2YATA 4X1GA 4MGBA 4OH5A 1XQ3A 2J14A 2Z4JA 5DL4A 4ZN9A 1L2IA 5EI1A 3L0JA 5AAUA 4DM8A 5FQPA 3P88A 2PINA 3U9QA 1LBDA 2ACLA 5DXBA 2JJ3A 4N5GA 4MGBB 1U3QA 2I4PA 4IUIA 2Q59A 3AURA 2NXXA 3DCTA 5GICA 2EWPA 3W5TA 2NXXE 2P7GA 5G43A 4ZJWA 5DKBA 4POJA 4WPFA 1Z5XU 3ET3A 3L0EA 2ACLB 5DXBB 5DVVA 4J24A 3V9VA 4EMAA 4PWLA 3VRTA 2Q59B 2ABIA 1UOMA 3KDTA 5DKEA 2PITA 5DTVA 5E19A 5A86A 5LGAA 4M8HA 3FEJA 3KPZA 3MNPA 2ZNPA 2Q5SA 5L7EA 1R20A 1T7TA 2G5OA 2GPVA 3OSWA 2G0GA 3ADTA 4IA3A 3CTBA 5JY3A 4YNKA 5EC9A 2OCFA 1PK5A 5G45A 1MV9A 2XHSA 4G2HA 5DV6A 2Q7LA 5B5BA 3R8IA 2Q6SA 1ZEOA 3FS1A 3IPSA 5DZIA 3GWXA 5E1CA 5KCTA 3HODA 3AUQA 3ADUA 3KYTA 2NV7A 3B1MA 3VSPA 2AAXA 3NOAA 4ZNUA 1XNXA 5DWJA 3H0AD 4WVDA 2OZ7A 2PRGA 3W0AA 3ADSA 3R8DA 3X1HA 3ZR7A 3JZCA 5HCVA 3UUAA 1BSXA 3CDPA 2O4JA 2FSZA 2PNUA 3DZUD 3IPUA 3NSQA 2BAWA 1R5KA 4B7WA
chains in the Genus database with same CATH topology
1VJBA 5AAVA 1ZDUA 3PLZA 1FM9D 3FC6A 3D90A 4CSJA 3KBAA 4OKXA 4ZNHA 3UUAB 2VV2A 5ETHA 3B0QA 4O8FA 5DSHA 3WWRA 5KRCA 1X76A 2P15A 3TX7B 4WQPA 3OZJA 5KCEA 3OS9A 1QKMA 5AAVB 1R1KD 2B50A 1IE9A 3FC6B 4MGAA 4RZFA 3A2IA 1WM0X 5DMCA 2POBA 3W5QA 1GWRA 3A40X 1E3GA 5KCWA 3D5FA 4PXMA 4OHAA 1OVLA 4S14A 5IZ0A 1U3SA 1ZDTA 3A2HA 4IA2A 4OH6A 1X7JA 1FM6D 1RDTD 5DU5A 1YYEA 4JAZA 4LNXA 4XT9A 3OS8A 1OSHA 4MGAB 1RJKA 4OJ9A 5DXGA 1U3RA 3UP3A 3OMOA 2A3IA 5FQTA 4K7AA 4OILA 5SYZA 3UUDA 1OVLB 1FBYA 3VT5A 2Q70A 2AMBA 3TY0A 4M8EA 4OC7A 1FCYA 4Q50A 1IE8A 5L11A 2PIVA 2P7ZA 4IS8A 5DZ3A 3FXVA 4MGDA 2P7AA 3PRGA 5FQRA 1DB1A 1S0ZA 1ZGYA 1YY4A 2Q6RA 3GYUA 4UDBA 4PRGA 1XP6A 2YJDA 4OZTU 3UUDB 1S19A 2VV1A 3L03A 3E00D 5KRLA 5HJSA 4ITEA 4ZO1B 5KROA 1N4HA 5CJ6A 2BJ4A 4MGDB 1T5ZA 2Q1VA 2I4JA 4G20A 2HARA 2I0JA 4PLDA 4NUFA 4R06A 1Y0SA 4OK1A 4J26A 5DWLA 2VV1B 1YJEA 5AK2A 4OARA 3PO9A 1EREA 5EJVA 3VT9A 1RKHA 3WGPA 1L2JA 2NPAA 3OLSA 1Y9RA 5AVLA 5G42A 2BJ4B 3W0YA 4WHFA 1XQCA 3ET2A 2QA6A 3B66A 4ZO1X 3VT7A 3VT3A 1PQ6A 4G21A 3K22A 3VJTA 5G3JA 3W0GA 2ZVTA 4S0TA 3UUCA 2QXSA 3VTCA 3BQDA 3IA6A 1G2NA 1FCXA 2H77A 2F4BA 2ZNOA 3FALA 2IHQA 2GL8A 2AWHA 1XLSA 4RFWA 4FNEA 1HJ1A 2R6WA 2HFPA 4OFRA 1XLSE 3RVFA 3WFGA 4CI4A 4IV4A 3TKMA 1YA3A 3R2AA 2GPUA 4OIUA 5AVIA 2QXMA 1QKUA 5DUEA 4IU7A 2GWXA 2YLOA 5KRHA 2ZFXA 3FALB 5G46A 3HZFA 1I7GA 2XYJA 1T65A 4OJBA 3IXPD 5DP0A 1PQ9A 3R29A 4APUA 1NQ7A 2YLPA 2ZL9A 4RE8A 1ZAFA 4WHGA 3UVVA 4LSJA 3WJ5A 2R40D 5E7VA 1LV2A 2Q1HA 3GYTA 3ERTA 4PPSA 4WLBA 4ZNTA 4PF3A 1NYXA 5DZ0A 5IAWA 3OOKA 5E15A 1XDKA 3M7RA 3OKHA 1YOWA 4E2JA 1XP9A 3UVVB 4IA7A 5DX3A 3RLJA 3Q95A 2ZK6A 5KR9A 3AN4A 3ET1A 5EHJA 1XVPA 1K74A 4ZNSA 5EITA 4OEYA 4RAKA 1XDKB 2P1UA 3AUNA 2Z4BA 2PIWA 4Q0AC 2V0VA 5FQSA 5DIEA 5DRJA 4PPPA 5DYBA 4DM6A 5DX3B 1YP0A 3B5RA 2Q7KA 3ERDA 3Q95B 1M2ZA 4LTWA 2QZOA 5DY8A 1T76A 4G1YA 3W0CA 4LNWA 5DV8A 1XVPB 2REWA 3K6PA 1NQ2A 3O1EA 1ZH7A 3V3EA 2HASA 3A3ZX 3VHUA 5G5WA 4IVYA 2ZK3A 1PQCA 2QZOB 4XUMA 1R20D 1X7EA 4E4QA 2G0HA 2XYXA 3VJHA 2ZXZA 5DV3A 4ZI1A 2HCDA 1XJ7A 4X1FA 3H0AA 2AO6A 4PP6A 5DXMA 2ZY0A 4J5XA 5AYGA 1U9EA 2PIPL 3AX8A 5E0XA 4OEZA 3V9TA 3UU7B 3KMGA 4JL4A 1A52A 3BEJA 1M7WA 4HEEX 4OKWA 1NAVA 3QT0A 5L7GA 4PVUA 2ZLCA 3W0JA 4J5WA 4ZJRA 1X78A 3UP0A 1YUCA 5HZCA 1NRLA 1OT7A 5M96A 4L98A 5LWPA 1ILGA 4RMEA 1OSVA 1XPCA 3OZ0A 3PEQA 4JYIA 4Q13A 2AMAA 2J7YA 4DQMA 2HWRA 3L0LA 1ILHA 4QJRA 1XIUA 4P6WA 3RUTA 1QKTA 4QK4A 3OMMA 5DRMA 5DWGA 4OZRU 3W5RA 5DWIA 2E2RA 1GWXA 1T7MA 1RDTA 3BC5A 5E0WA 5KRFA 1E3KA 1EXAA 1RK3A 2POGA 3A78A 1S9PA 5DZHA 3VI8A 3VRWA 2P54A 3W5PA 3X1IA 2GP7A 3VTDA 3X31A 3G0WA 1T74A 3LMPA 1Q4XA 5DZ1A 3ILZA 4ITFA 1H9UA 3A9EA 3E00A 3HM1A 3R8AA 5DKGA 5GIEA 1HG4A 4MG8A 4A4WA 5KCUA 1GS4A 4QE6A 4XLDA 1NDEA 3D6DA 2AX7A 1XB7A 4MGCA 4NY9A 4IW8A 4KZJA 4IWFA 3DZYA 2PIOA 4EM9A 1N83A 4P6XA 4G2IA 3A9EB 3V49A 2B1ZA 3W0IA 4MG8B 5HJPA 3HC6A 1PDUA 3P8XA 3MNOA 1P93A 2QGTA 4N8RA 3RLLA 2Q3YA 3PCUA 3OMQA 3R5NA 4OKTA 4N1YA 2YLYA 1T7RA 3GBKA 3JZBA 5L7HA 4OKBA 3VJSA 1NUOA 4S15A 2ZK2A 3HLVA 2J7XA 4RMCA 5HJPB 4XAOA 1PCGA 3FURA 1Y0XX 1S0XA 3OGTA 5FQVA 3AFRA 4REEA 4S0SA 5KCCA 5APHA 5HYKA 1A28A 5KCFA 2JF9A 2ATHA 4JGVA 3OMKA 3RUUA 5DXKA 2PIUA 4YT1A 3VT4A 3AN3A 2P1TA 5I4VA 4IVWA 1XOWA 3EYBA 3NSPA 4DK7A 1NQ0A 5C4TA 4DMAA 5KRJA 2W8YA 3VRVA 5H1EA 3ET0A 3CS6A 3OLLA 1PZLA 4MDDA 1I7IA 3FUGA 4OLMA 3KFCA 2ZXMA 5DXEA 4G1DA 3CQVA 5AZTA 4IA1A 2ZK5A 4RUPA 3CS4A 4K4JA 4RUJA 5E14A 5DXQA 5F9BA 3ZRBA 4TV1A 2G44A 2OVMA 2GPOA 3G8OA 3AZ3A 3WJ4A 4IWCA 1FCZA 2HWQA 5DWEA 5AWKA 3OLFA 1KNUA 3KWYA 3OOFA 4RZGA 2Q5PA 4TUZA 5DK9A 2LBDA 3ZRAA 4QE8A 5KYAA 4PP5A 4TV1B 3SP6A 1UHLA 1ZUCA 2R40A 2J4AA 1P8DA 4OFUA 3FLIA 3OS8C 4E4KA 2P4YA 2HAMA 3HC5A 4R2UA 3TKCA 2QPYA 2AX8A 2PIRA 4XHDA 4DORA 1TXIA 4TUZB 1TFCA 4F9MA 3AZ2A 2AA6A 3P0UA 2IOKA 1Z5XE 4REFA 2OM9A 5GIDA 1N46A 1XV9A 2AA5A 1UHLB 5DIGA 4L96A 2Q8SA 1PRGA 2V7CA 2AM9A 2YLQA 4ZN7A 3L3XA 2QW4A 5DIDA 2QH6A 4JYHA 2OAXA 1XNNA 1T7FA 4LBDA 4FN9A 2Q7JA 1SQNA 5IXKA 1XV9B 3HVLA 4OEDA 1KKQA 1G50A 5DLRA 2NW4A 3VSOA 3VHWA 4IW6A 2QNVA 1K74D 3WMHA 3WFFA 5KRKA 2OVHA 3F5CA 4PP3A 4QM0A 4CI5A 2GTKA 4PLEA 5DVCA 3K23A 1K4WA 3F7DA 3UU7A 1SR7A 3V4AA 2XYWA 4XI3A 2HC4A 3AZ1A 3G8IA 2R6YA 3V9YA 3IPQA 3FEIA 5G44A 4ZNWA 4KZIA 5KRAA 1I38A 2GPPA 2YHDA 1M13A 3F5CB 3KMRA 4A2JA 5KCDA 3VN2A 5DUGA 3DZUA 2QTUA 2PKLA 3B67A 3N00A 1SKXA 3VJIA 1T73A 1UPVA 2QMVA 4ONIA 3D57A 5KD9A 4RWVA 1XP1A 3VTBA 1FM9A 2Q6JA 5DVSA 1XZXX 2I0GA 2FAIA 2QE4A 4RUOX 1I37A 1T63A 2HB7A 2QSEA 2ZLAA 3B65A 5HYRA 2AA7A 2FVJA 4HLWA 3CWDA 5KYJA 3OMPA 1X7RA 1YMTA 4XTAA 4YPQA 1R1KA 4OIVA 2Q61A 3V3QA 1X7BA 1FD0A 1RKGA 1G1UA 2AB2A 3WT5A 4FHIA 5EGVA 2XKWA 3WTQA 3CJWA 1K7LA 1EXXA 3A2JA 4OGHA 3RY9A 5KRMA 4RMDA 2HB8A 1FM6A 2VSRA 4OZRE 4FGYA 1YIMA 4POHA 2PJLA 5C4OA 2JFAA 2Q60A 3WT6A 4BCRA 3ADWA 4DK8A 3DY6A 3DR1A 4MG7A 3K8SA 1GWQA 2O9IA 2PIXA 2VV4A 3B0TA 4MG6A 1UPWA 3B68A 3T03A 2AA2A 1XAPA 5C4SA 3B0RA 3PBAA 5DI7A 4XUHA 2JFAB 2I4ZA 2VV3A 4OZTE 3B0WA 4IV2A 3VHVA 4RZEA 4UDAA 2QR9A 2YJAB 3OSAA 2OUZA 3MNEA 3B3KA 4MG7B 3L1BA 4OEAA 5JJMA 1MVCA 4OJ4A 3GD2A 3OAPA 3IMYA 2VV4B 2ZK4A 2ZK1A 2IOGA 3H52A 1DKFA 4K6IA 3ADVA 3G9EA 2B23A 4UDCA 4A4VA 5AZVA 2ZNQA 1ERRA 4ZNVA 5DMFA 2ZKCA 3VRUA 2ZMHA 2ZMIA 1NQ1A 3SP9A 5GT4A 2O4RA 2QABA 3OKIA 2HBHA 5JJMB 3GWSX 2VSTA 3KDUA 3DZYD 2ZK0A 1DKFB 2QGWA 2ZXNA 3L3ZA 3P89A 3S9SA 3DCUA 2AYRA 3X36A 4G1ZA 5APKA 5AWJA 4NB6A 3E94A 5C4UA 3ZQTA 5DXPA 5ICKA 3E7CA 2QA8A 3HO0A 3CS8A 5DUHA 1R6GA 1NAXA 2H79A 4UDDA 5JI0D 2HVCA 4J5XC 4R6SA 3VT6A 4QL8A 3WT7A 3ADXA 3LBDA 1G5YA 2AX9A 2Q7IA 4JYGA 3GN8A 4ZOMA 3W0HA 1KV6A 3OSIA 4FHHA 1ZKYA 3SZ1A 2B1VA 2QA8B 4NQAB 3D24A 2AX6A 4J5WC 4KZMA 5DXRA 4NIEA 3O1DA 1Z95A 2ZNNA 4DOSA 1T79A 5APJA 4YMQA 5B41A 5K13A 1S9QA 3IXPA 2AXAA 2Q5GA 3R5MA 3CLDA 1QKNA 1NHZA 4MG9A 2GIUA 5KRIA 3DT3A 1MZNA 2PIQA 2VV0A 3HQ5A 3KMZA 4MG5A 3GZ9A 4N73A 2P1VA 1YOKA 4IQRA 2ZMJA 2ZASA 5DKSA 4Y29A 2YFEA 3VT8A 1YINA 2ZBSA 5ACCA 5DYDA 1SJ0A 3CDSA 4MG9B 2YATA 4X1GA 4MGBA 4OH5A 1XQ3A 2J14A 2Z4JA 5DL4A 4ZN9A 1L2IA 5EI1A 3L0JA 5AAUA 4DM8A 5FQPA 3P88A 2PINA 3U9QA 1LBDA 2ACLA 5DXBA 2JJ3A 4N5GA 4MGBB 1U3QA 2I4PA 4IUIA 2Q59A 3AURA 2NXXA 3DCTA 5GICA 2EWPA 3W5TA 2NXXE 2P7GA 5G43A 4ZJWA 5DKBA 4POJA 4WPFA 1Z5XU 3ET3A 3L0EA 2ACLB 5DXBB 5DVVA 4J24A 3V9VA 4EMAA 4PWLA 3VRTA 2Q59B 2ABIA 1UOMA 3KDTA 5DKEA 2PITA 5DTVA 5E19A 5A86A 5LGAA 4M8HA 3FEJA 3KPZA 3MNPA 2ZNPA 2Q5SA 5L7EA 1R20A 1T7TA 2G5OA 2GPVA 3OSWA 2G0GA 3ADTA 4IA3A 3CTBA 5JY3A 4YNKA 5EC9A 2OCFA 1PK5A 5G45A 1MV9A 2XHSA 4G2HA 5DV6A 2Q7LA 5B5BA 3R8IA 2Q6SA 1ZEOA 3FS1A 3IPSA 5DZIA 3GWXA 5E1CA 5KCTA 3HODA 3AUQA 3ADUA 3KYTA 2NV7A 3B1MA 3VSPA 2AAXA 3NOAA 4ZNUA 1XNXA 5DWJA 3H0AD 4WVDA 2OZ7A 2PRGA 3W0AA 3ADSA 3R8DA 3X1HA 3ZR7A 3JZCA 5HCVA 3UUAA 1BSXA 3CDPA 2O4JA 2FSZA 2PNUA 3DZUD 3IPUA 3NSQA 2BAWA 1R5KA 4B7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJB A;  5AAV A;  1ZDU A;  3PLZ A;  1FM9 D;  3FC6 A;  3D90 A;  4CSJ A;  3KBA A;  4OKX A;  4ZNH A;  3UUA B;  2VV2 A;  5ETH A;  3B0Q A;  4O8F A;  5DSH A;  3WWR A;  5KRC A;  1X76 A;  2P15 A;  3TX7 B;  4WQP A;  3OZJ A;  5KCE A;  3OS9 A;  1QKM A;  5AAV B;  1R1K D;  2B50 A;  1IE9 A;  3FC6 B;  4MGA A;  4RZF A;  3A2I A;  1WM0 X;  5DMC A;  2POB A;  3W5Q A;  1GWR A;  3A40 X;  1E3G A;  5KCW A;  3D5F A;  4PXM A;  4OHA A;  1OVL A;  4S14 A;  5IZ0 A;  1U3S A;  1ZDT A;  3A2H A;  4IA2 A;  4OH6 A;  1X7J A;  1FM6 D;  1RDT D;  5DU5 A;  1YYE A;  4JAZ A;  4LNX A;  4XT9 A;  3OS8 A;  1OSH A;  4MGA B;  1RJK A;  4OJ9 A;  5DXG A;  1U3R A;  3UP3 A;  3OMO A;  2A3I A;  5FQT A;  4K7A A;  4OIL A;  5SYZ A;  3UUD A;  1OVL B;  1FBY A;  3VT5 A;  2Q70 A;  2AMB A;  3TY0 A;  4M8E A;  4OC7 A;  1FCY A;  4Q50 A;  1IE8 A;  5L11 A;  2PIV A;  2P7Z A;  4IS8 A;  5DZ3 A;  3FXV A;  4MGD A;  2P7A A;  3PRG A;  5FQR A;  1DB1 A;  1S0Z A;  1ZGY A;  1YY4 A;  2Q6R A;  3GYU A;  4UDB A;  4PRG A;  1XP6 A;  2YJD A;  4OZT U;  3UUD B;  1S19 A;  2VV1 A;  3L03 A;  3E00 D;  5KRL A;  5HJS A;  4ITE A;  4ZO1 B;  5KRO A;  1N4H A;  5CJ6 A;  2BJ4 A;  4MGD B;  1T5Z A;  2Q1V A;  2I4J A;  4G20 A;  2HAR A;  2I0J A;  4PLD A;  4NUF A;  4R06 A;  1Y0S A;  4OK1 A;  4J26 A;  5DWL A;  2VV1 B;  1YJE A;  5AK2 A;  4OAR A;  3PO9 A;  1ERE A;  5EJV A;  3VT9 A;  1RKH A;  3WGP A;  1L2J A;  2NPA A;  3OLS A;  1Y9R A;  5AVL A;  5G42 A;  2BJ4 B;  3W0Y A;  4WHF A;  1XQC A;  3ET2 A;  2QA6 A;  3B66 A;  4ZO1 X;  3VT7 A;  3VT3 A;  1PQ6 A;  4G21 A;  3K22 A;  3VJT A;  5G3J A;  3W0G A;  2ZVT A;  4S0T A;  3UUC A;  2QXS A;  3VTC A;  3BQD A;  3IA6 A;  1G2N A;  1FCX A;  2H77 A;  2F4B A;  2ZNO A;  3FAL A;  2IHQ A;  2GL8 A;  2AWH A;  1XLS A;  4RFW A;  4FNE A;  1HJ1 A;  2R6W A;  2HFP A;  4OFR A;  1XLS E;  3RVF A;  3WFG A;  4CI4 A;  4IV4 A;  3TKM A;  1YA3 A;  3R2A A;  2GPU A;  4OIU A;  5AVI A;  2QXM A;  1QKU A;  5DUE A;  4IU7 A;  2GWX A;  2YLO A;  5KRH A;  2ZFX A;  3FAL B;  5G46 A;  3HZF A;  1I7G A;  2XYJ A;  1T65 A;  4OJB A;  3IXP D;  5DP0 A;  1PQ9 A;  3R29 A;  4APU A;  1NQ7 A;  2YLP A;  2ZL9 A;  4RE8 A;  1ZAF A;  4WHG A;  3UVV A;  4LSJ A;  3WJ5 A;  2R40 D;  5E7V A;  1LV2 A;  2Q1H A;  3GYT A;  3ERT A;  4PPS A;  4WLB A;  4ZNT A;  4PF3 A;  1NYX A;  5DZ0 A;  5IAW A;  3OOK A;  5E15 A;  1XDK A;  3M7R A;  3OKH A;  1YOW A;  4E2J A;  1XP9 A;  3UVV B;  4IA7 A;  5DX3 A;  3RLJ A;  3Q95 A;  2ZK6 A;  5KR9 A;  3AN4 A;  3ET1 A;  5EHJ A;  1XVP A;  1K74 A;  4ZNS A;  5EIT A;  4OEY A;  4RAK A;  1XDK B;  2P1U A;  3AUN A;  2Z4B A;  2PIW A;  4Q0A C;  2V0V A;  5FQS A;  5DIE A;  5DRJ A;  4PPP A;  5DYB A;  4DM6 A;  5DX3 B;  1YP0 A;  3B5R A;  2Q7K A;  3ERD A;  3Q95 B;  1M2Z A;  4LTW A;  2QZO A;  5DY8 A;  1T76 A;  4G1Y A;  3W0C A;  4LNW A;  5DV8 A;  1XVP B;  2REW A;  3K6P A;  1NQ2 A;  3O1E A;  1ZH7 A;  3V3E A;  2HAS A;  3A3Z X;  3VHU A;  5G5W A;  4IVY A;  2ZK3 A;  1PQC A;  2QZO B;  4XUM A;  1R20 D;  1X7E A;  4E4Q A;  2G0H A;  2XYX A;  3VJH A;  2ZXZ A;  5DV3 A;  4ZI1 A;  2HCD A;  1XJ7 A;  4X1F A;  3H0A A;  2AO6 A;  4PP6 A;  5DXM A;  2ZY0 A;  4J5X A;  5AYG A;  1U9E A;  2PIP L;  3AX8 A;  5E0X A;  4OEZ A;  3V9T A;  3UU7 B;  3KMG A;  4JL4 A;  1A52 A;  3BEJ A;  1M7W A;  4HEE X;  4OKW A;  1NAV A;  3QT0 A;  5L7G A;  4PVU A;  2ZLC A;  3W0J A;  4J5W A;  4ZJR A;  1X78 A;  3UP0 A;  1YUC A;  5HZC A;  1NRL A;  1OT7 A;  5M96 A;  4L98 A;  5LWP A;  1ILG A;  4RME A;  1OSV A;  1XPC A;  3OZ0 A;  3PEQ A;  4JYI A;  4Q13 A;  2AMA A;  2J7Y A;  4DQM A;  2HWR A;  3L0L A;  1ILH A;  4QJR A;  1XIU A;  4P6W A;  3RUT A;  1QKT A;  4QK4 A;  3OMM A;  5DRM A;  5DWG A;  4OZR U;  3W5R A;  5DWI A;  2E2R A;  1GWX A;  1T7M A;  1RDT A;  3BC5 A;  5E0W A;  5KRF A;  1E3K A;  1EXA A;  1RK3 A;  2POG A;  3A78 A;  1S9P A;  5DZH A;  3VI8 A;  3VRW A;  2P54 A;  3W5P A;  3X1I A;  2GP7 A;  3VTD A;  3X31 A;  3G0W A;  1T74 A;  3LMP A;  1Q4X A;  5DZ1 A;  3ILZ A;  4ITF A;  1H9U A;  3A9E A;  3E00 A;  3HM1 A;  3R8A A;  5DKG A;  5GIE A;  1HG4 A;  4MG8 A;  4A4W A;  5KCU A;  1GS4 A;  4QE6 A;  4XLD A;  1NDE A;  3D6D A;  2AX7 A;  1XB7 A;  4MGC A;  4NY9 A;  4IW8 A;  4KZJ A;  4IWF A;  3DZY A;  2PIO A;  4EM9 A;  1N83 A;  4P6X A;  4G2I A;  3A9E B;  3V49 A;  2B1Z A;  3W0I A;  4MG8 B;  5HJP A;  3HC6 A;  1PDU A;  3P8X A;  3MNO A;  1P93 A;  2QGT A;  4N8R A;  3RLL A;  2Q3Y A;  3PCU A;  3OMQ A;  3R5N A;  4OKT A;  4N1Y A;  2YLY A;  1T7R A;  3GBK A;  3JZB A;  5L7H A;  4OKB A;  3VJS A;  1NUO A;  4S15 A;  2ZK2 A;  3HLV A;  2J7X A;  4RMC A;  5HJP B;  4XAO A;  1PCG A;  3FUR A;  1Y0X X;  1S0X A;  3OGT A;  5FQV A;  3AFR A;  4REE A;  4S0S A;  5KCC A;  5APH A;  5HYK A;  1A28 A;  5KCF A;  2JF9 A;  2ATH A;  4JGV A;  3OMK A;  3RUU A;  5DXK A;  2PIU A;  4YT1 A;  3VT4 A;  3AN3 A;  2P1T A;  5I4V A;  4IVW A;  1XOW A;  3EYB A;  3NSP A;  4DK7 A;  1NQ0 A;  5C4T A;  4DMA A;  5KRJ A;  2W8Y A;  3VRV A;  5H1E A;  3ET0 A;  3CS6 A;  3OLL A;  1PZL A;  4MDD A;  1I7I A;  3FUG A;  4OLM A;  3KFC A;  2ZXM A;  5DXE A;  4G1D A;  3CQV A;  5AZT A;  4IA1 A;  2ZK5 A;  4RUP A;  3CS4 A;  4K4J A;  4RUJ A;  5E14 A;  5DXQ A;  5F9B A;  3ZRB A;  4TV1 A;  2G44 A;  2OVM A;  2GPO A;  3G8O A;  3AZ3 A;  3WJ4 A;  4IWC A;  1FCZ A;  2HWQ A;  5DWE A;  5AWK A;  3OLF A;  1KNU A;  3KWY A;  3OOF A;  4RZG A;  2Q5P A;  4TUZ A;  5DK9 A;  2LBD A;  3ZRA A;  4QE8 A;  5KYA A;  4PP5 A;  4TV1 B;  3SP6 A;  1UHL A;  1ZUC A;  2R40 A;  2J4A A;  1P8D A;  4OFU A;  3FLI A;  3OS8 C;  4E4K A;  2P4Y A;  2HAM A;  3HC5 A;  4R2U A;  3TKC A;  2QPY A;  2AX8 A;  2PIR A;  4XHD A;  4DOR A;  1TXI A;  4TUZ B;  1TFC A;  4F9M A;  3AZ2 A;  2AA6 A;  3P0U A;  2IOK A;  1Z5X E;  4REF A;  2OM9 A;  5GID A;  1N46 A;  1XV9 A;  2AA5 A;  1UHL B;  5DIG A;  4L96 A;  2Q8S A;  1PRG A;  2V7C A;  2AM9 A;  2YLQ A;  4ZN7 A;  3L3X A;  2QW4 A;  5DID A;  2QH6 A;  4JYH A;  2OAX A;  1XNN A;  1T7F A;  4LBD A;  4FN9 A;  2Q7J A;  1SQN A;  5IXK A;  1XV9 B;  3HVL A;  4OED A;  1KKQ A;  1G50 A;  5DLR A;  2NW4 A;  3VSO A;  3VHW A;  4IW6 A;  2QNV A;  1K74 D;  3WMH A;  3WFF A;  5KRK A;  2OVH A;  3F5C A;  4PP3 A;  4QM0 A;  4CI5 A;  2GTK A;  4PLE A;  5DVC A;  3K23 A;  1K4W A;  3F7D A;  3UU7 A;  1SR7 A;  3V4A A;  2XYW A;  4XI3 A;  2HC4 A;  3AZ1 A;  3G8I A;  2R6Y A;  3V9Y A;  3IPQ A;  3FEI A;  5G44 A;  4ZNW A;  4KZI A;  5KRA A;  1I38 A;  2GPP A;  2YHD A;  1M13 A;  3F5C B;  3KMR A;  4A2J A;  5KCD A;  3VN2 A;  5DUG A;  3DZU A;  2QTU A;  2PKL A;  3B67 A;  3N00 A;  1SKX A;  3VJI A;  1T73 A;  1UPV A;  2QMV A;  4ONI A;  3D57 A;  5KD9 A;  4RWV A;  1XP1 A;  3VTB A;  1FM9 A;  2Q6J A;  5DVS A;  1XZX X;  2I0G A;  2FAI A;  2QE4 A;  4RUO X;  1I37 A;  1T63 A;  2HB7 A;  2QSE A;  2ZLA A;  3B65 A;  5HYR A;  2AA7 A;  2FVJ A;  4HLW A;  3CWD A;  5KYJ A;  3OMP A;  1X7R A;  1YMT A;  4XTA A;  4YPQ A;  1R1K A;  4OIV A;  2Q61 A;  3V3Q A;  1X7B A;  1FD0 A;  1RKG A;  1G1U A;  2AB2 A;  3WT5 A;  4FHI A;  5EGV A;  2XKW A;  3WTQ A;  3CJW A;  1K7L A;  1EXX A;  3A2J A;  4OGH A;  3RY9 A;  5KRM A;  4RMD A;  2HB8 A;  1FM6 A;  2VSR A;  4OZR E;  4FGY A;  1YIM A;  4POH A;  2PJL A;  5C4O A;  2JFA A;  2Q60 A;  3WT6 A;  4BCR A;  3ADW A;  4DK8 A;  3DY6 A;  3DR1 A;  4MG7 A;  3K8S A;  1GWQ A;  2O9I A;  2PIX A;  2VV4 A;  3B0T A;  4MG6 A;  1UPW A;  3B68 A;  3T03 A;  2AA2 A;  1XAP A;  5C4S A;  3B0R A;  3PBA A;  5DI7 A;  4XUH A;  2JFA B;  2I4Z A;  2VV3 A;  4OZT E;  3B0W A;  4IV2 A;  3VHV A;  4RZE A;  4UDA A;  2QR9 A;  2YJA B;  3OSA A;  2OUZ A;  3MNE A;  3B3K A;  4MG7 B;  3L1B A;  4OEA A;  5JJM A;  1MVC A;  4OJ4 A;  3GD2 A;  3OAP A;  3IMY A;  2VV4 B;  2ZK4 A;  2ZK1 A;  2IOG A;  3H52 A;  1DKF A;  4K6I A;  3ADV A;  3G9E A;  2B23 A;  4UDC A;  4A4V A;  5AZV A;  2ZNQ A;  1ERR A;  4ZNV A;  5DMF A;  2ZKC A;  3VRU A;  2ZMH A;  2ZMI A;  1NQ1 A;  3SP9 A;  5GT4 A;  2O4R A;  2QAB A;  3OKI A;  2HBH A;  5JJM B;  3GWS X;  2VST A;  3KDU A;  3DZY D;  2ZK0 A;  1DKF B;  2QGW A;  2ZXN A;  3L3Z A;  3P89 A;  3S9S A;  3DCU A;  2AYR A;  3X36 A;  4G1Z A;  5APK A;  5AWJ A;  4NB6 A;  3E94 A;  5C4U A;  3ZQT A;  5DXP A;  5ICK A;  3E7C A;  2QA8 A;  3HO0 A;  3CS8 A;  5DUH A;  1R6G A;  1NAX A;  2H79 A;  4UDD A;  5JI0 D;  2HVC A;  4J5X C;  4R6S A;  3VT6 A;  4QL8 A;  3WT7 A;  3ADX A;  3LBD A;  1G5Y A;  2AX9 A;  2Q7I A;  4JYG A;  3GN8 A;  4ZOM A;  3W0H A;  1KV6 A;  3OSI A;  4FHH A;  1ZKY A;  3SZ1 A;  2B1V A;  2QA8 B;  4NQA B;  3D24 A;  2AX6 A;  4J5W C;  4KZM A;  5DXR A;  4NIE A;  3O1D A;  1Z95 A;  2ZNN A;  4DOS A;  1T79 A;  5APJ A;  4YMQ A;  5B41 A;  5K13 A;  1S9Q A;  3IXP A;  2AXA A;  2Q5G A;  3R5M A;  3CLD A;  1QKN A;  1NHZ A;  4MG9 A;  2GIU A;  5KRI A;  3DT3 A;  1MZN A;  2PIQ A;  2VV0 A;  3HQ5 A;  3KMZ A;  4MG5 A;  3GZ9 A;  4N73 A;  2P1V A;  1YOK A;  4IQR A;  2ZMJ A;  2ZAS A;  5DKS A;  4Y29 A;  2YFE A;  3VT8 A;  1YIN A;  2ZBS A;  5ACC A;  5DYD A;  1SJ0 A;  3CDS A;  4MG9 B;  2YAT A;  4X1G A;  4MGB A;  4OH5 A;  1XQ3 A;  2J14 A;  2Z4J A;  5DL4 A;  4ZN9 A;  1L2I A;  5EI1 A;  3L0J A;  5AAU A;  4DM8 A;  5FQP A;  3P88 A;  2PIN A;  3U9Q A;  1LBD A;  2ACL A;  5DXB A;  2JJ3 A;  4N5G A;  4MGB B;  1U3Q A;  2I4P A;  4IUI A;  2Q59 A;  3AUR A;  2NXX A;  3DCT A;  5GIC A;  2EWP A;  3W5T A;  2NXX E;  2P7G A;  5G43 A;  4ZJW A;  5DKB A;  4POJ A;  4WPF A;  1Z5X U;  3ET3 A;  3L0E A;  2ACL B;  5DXB B;  5DVV A;  4J24 A;  3V9V A;  4EMA A;  4PWL A;  3VRT A;  2Q59 B;  2ABI A;  1UOM A;  3KDT A;  5DKE A;  2PIT A;  5DTV A;  5E19 A;  5A86 A;  5LGA A;  4M8H A;  3FEJ A;  3KPZ A;  3MNP A;  2ZNP A;  2Q5S A;  5L7E A;  1R20 A;  1T7T A;  2G5O A;  2GPV A;  3OSW A;  2G0G A;  3ADT A;  4IA3 A;  3CTB A;  5JY3 A;  4YNK A;  5EC9 A;  2OCF A;  1PK5 A;  5G45 A;  1MV9 A;  2XHS A;  4G2H A;  5DV6 A;  2Q7L A;  5B5B A;  3R8I A;  2Q6S A;  1ZEO A;  3FS1 A;  3IPS A;  5DZI A;  3GWX A;  5E1C A;  5KCT A;  3HOD A;  3AUQ A;  3ADU A;  3KYT A;  2NV7 A;  3B1M A;  3VSP A;  2AAX A;  3NOA A;  4ZNU A;  1XNX A;  5DWJ A;  3H0A D;  4WVD A;  2OZ7 A;  2PRG A;  3W0A A;  3ADS A;  3R8D A;  3X1H A;  3ZR7 A;  3JZC A;  5HCV A;  3UUA A;  1BSX A;  3CDP A;  2O4J A;  2FSZ A;  2PNU A;  3DZU D;  3IPU A;  3NSQ A;  2BAW A;  1R5K A;  4B7W A; 
#chains in the Genus database with same CATH topology
 1VJB A;  5AAV A;  1ZDU A;  3PLZ A;  1FM9 D;  3FC6 A;  3D90 A;  4CSJ A;  3KBA A;  4OKX A;  4ZNH A;  3UUA B;  2VV2 A;  5ETH A;  3B0Q A;  4O8F A;  5DSH A;  3WWR A;  5KRC A;  1X76 A;  2P15 A;  3TX7 B;  4WQP A;  3OZJ A;  5KCE A;  3OS9 A;  1QKM A;  5AAV B;  1R1K D;  2B50 A;  1IE9 A;  3FC6 B;  4MGA A;  4RZF A;  3A2I A;  1WM0 X;  5DMC A;  2POB A;  3W5Q A;  1GWR A;  3A40 X;  1E3G A;  5KCW A;  3D5F A;  4PXM A;  4OHA A;  1OVL A;  4S14 A;  5IZ0 A;  1U3S A;  1ZDT A;  3A2H A;  4IA2 A;  4OH6 A;  1X7J A;  1FM6 D;  1RDT D;  5DU5 A;  1YYE A;  4JAZ A;  4LNX A;  4XT9 A;  3OS8 A;  1OSH A;  4MGA B;  1RJK A;  4OJ9 A;  5DXG A;  1U3R A;  3UP3 A;  3OMO A;  2A3I A;  5FQT A;  4K7A A;  4OIL A;  5SYZ A;  3UUD A;  1OVL B;  1FBY A;  3VT5 A;  2Q70 A;  2AMB A;  3TY0 A;  4M8E A;  4OC7 A;  1FCY A;  4Q50 A;  1IE8 A;  5L11 A;  2PIV A;  2P7Z A;  4IS8 A;  5DZ3 A;  3FXV A;  4MGD A;  2P7A A;  3PRG A;  5FQR A;  1DB1 A;  1S0Z A;  1ZGY A;  1YY4 A;  2Q6R A;  3GYU A;  4UDB A;  4PRG A;  1XP6 A;  2YJD A;  4OZT U;  3UUD B;  1S19 A;  2VV1 A;  3L03 A;  3E00 D;  5KRL A;  5HJS A;  4ITE A;  4ZO1 B;  5KRO A;  1N4H A;  5CJ6 A;  2BJ4 A;  4MGD B;  1T5Z A;  2Q1V A;  2I4J A;  4G20 A;  2HAR A;  2I0J A;  4PLD A;  4NUF A;  4R06 A;  1Y0S A;  4OK1 A;  4J26 A;  5DWL A;  2VV1 B;  1YJE A;  5AK2 A;  4OAR A;  3PO9 A;  1ERE A;  5EJV A;  3VT9 A;  1RKH A;  3WGP A;  1L2J A;  2NPA A;  3OLS A;  1Y9R A;  5AVL A;  5G42 A;  2BJ4 B;  3W0Y A;  4WHF A;  1XQC A;  3ET2 A;  2QA6 A;  3B66 A;  4ZO1 X;  3VT7 A;  3VT3 A;  1PQ6 A;  4G21 A;  3K22 A;  3VJT A;  5G3J A;  3W0G A;  2ZVT A;  4S0T A;  3UUC A;  2QXS A;  3VTC A;  3BQD A;  3IA6 A;  1G2N A;  1FCX A;  2H77 A;  2F4B A;  2ZNO A;  3FAL A;  2IHQ A;  2GL8 A;  2AWH A;  1XLS A;  4RFW A;  4FNE A;  1HJ1 A;  2R6W A;  2HFP A;  4OFR A;  1XLS E;  3RVF A;  3WFG A;  4CI4 A;  4IV4 A;  3TKM A;  1YA3 A;  3R2A A;  2GPU A;  4OIU A;  5AVI A;  2QXM A;  1QKU A;  5DUE A;  4IU7 A;  2GWX A;  2YLO A;  5KRH A;  2ZFX A;  3FAL B;  5G46 A;  3HZF A;  1I7G A;  2XYJ A;  1T65 A;  4OJB A;  3IXP D;  5DP0 A;  1PQ9 A;  3R29 A;  4APU A;  1NQ7 A;  2YLP A;  2ZL9 A;  4RE8 A;  1ZAF A;  4WHG A;  3UVV A;  4LSJ A;  3WJ5 A;  2R40 D;  5E7V A;  1LV2 A;  2Q1H A;  3GYT A;  3ERT A;  4PPS A;  4WLB A;  4ZNT A;  4PF3 A;  1NYX A;  5DZ0 A;  5IAW A;  3OOK A;  5E15 A;  1XDK A;  3M7R A;  3OKH A;  1YOW A;  4E2J A;  1XP9 A;  3UVV B;  4IA7 A;  5DX3 A;  3RLJ A;  3Q95 A;  2ZK6 A;  5KR9 A;  3AN4 A;  3ET1 A;  5EHJ A;  1XVP A;  1K74 A;  4ZNS A;  5EIT A;  4OEY A;  4RAK A;  1XDK B;  2P1U A;  3AUN A;  2Z4B A;  2PIW A;  4Q0A C;  2V0V A;  5FQS A;  5DIE A;  5DRJ A;  4PPP A;  5DYB A;  4DM6 A;  5DX3 B;  1YP0 A;  3B5R A;  2Q7K A;  3ERD A;  3Q95 B;  1M2Z A;  4LTW A;  2QZO A;  5DY8 A;  1T76 A;  4G1Y A;  3W0C A;  4LNW A;  5DV8 A;  1XVP B;  2REW A;  3K6P A;  1NQ2 A;  3O1E A;  1ZH7 A;  3V3E A;  2HAS A;  3A3Z X;  3VHU A;  5G5W A;  4IVY A;  2ZK3 A;  1PQC A;  2QZO B;  4XUM A;  1R20 D;  1X7E A;  4E4Q A;  2G0H A;  2XYX A;  3VJH A;  2ZXZ A;  5DV3 A;  4ZI1 A;  2HCD A;  1XJ7 A;  4X1F A;  3H0A A;  2AO6 A;  4PP6 A;  5DXM A;  2ZY0 A;  4J5X A;  5AYG A;  1U9E A;  2PIP L;  3AX8 A;  5E0X A;  4OEZ A;  3V9T A;  3UU7 B;  3KMG A;  4JL4 A;  1A52 A;  3BEJ A;  1M7W A;  4HEE X;  4OKW A;  1NAV A;  3QT0 A;  5L7G A;  4PVU A;  2ZLC A;  3W0J A;  4J5W A;  4ZJR A;  1X78 A;  3UP0 A;  1YUC A;  5HZC A;  1NRL A;  1OT7 A;  5M96 A;  4L98 A;  5LWP A;  1ILG A;  4RME A;  1OSV A;  1XPC A;  3OZ0 A;  3PEQ A;  4JYI A;  4Q13 A;  2AMA A;  2J7Y A;  4DQM A;  2HWR A;  3L0L A;  1ILH A;  4QJR A;  1XIU A;  4P6W A;  3RUT A;  1QKT A;  4QK4 A;  3OMM A;  5DRM A;  5DWG A;  4OZR U;  3W5R A;  5DWI A;  2E2R A;  1GWX A;  1T7M A;  1RDT A;  3BC5 A;  5E0W A;  5KRF A;  1E3K A;  1EXA A;  1RK3 A;  2POG A;  3A78 A;  1S9P A;  5DZH A;  3VI8 A;  3VRW A;  2P54 A;  3W5P A;  3X1I A;  2GP7 A;  3VTD A;  3X31 A;  3G0W A;  1T74 A;  3LMP A;  1Q4X A;  5DZ1 A;  3ILZ A;  4ITF A;  1H9U A;  3A9E A;  3E00 A;  3HM1 A;  3R8A A;  5DKG A;  5GIE A;  1HG4 A;  4MG8 A;  4A4W A;  5KCU A;  1GS4 A;  4QE6 A;  4XLD A;  1NDE A;  3D6D A;  2AX7 A;  1XB7 A;  4MGC A;  4NY9 A;  4IW8 A;  4KZJ A;  4IWF A;  3DZY A;  2PIO A;  4EM9 A;  1N83 A;  4P6X A;  4G2I A;  3A9E B;  3V49 A;  2B1Z A;  3W0I A;  4MG8 B;  5HJP A;  3HC6 A;  1PDU A;  3P8X A;  3MNO A;  1P93 A;  2QGT A;  4N8R A;  3RLL A;  2Q3Y A;  3PCU A;  3OMQ A;  3R5N A;  4OKT A;  4N1Y A;  2YLY A;  1T7R A;  3GBK A;  3JZB A;  5L7H A;  4OKB A;  3VJS A;  1NUO A;  4S15 A;  2ZK2 A;  3HLV A;  2J7X A;  4RMC A;  5HJP B;  4XAO A;  1PCG A;  3FUR A;  1Y0X X;  1S0X A;  3OGT A;  5FQV A;  3AFR A;  4REE A;  4S0S A;  5KCC A;  5APH A;  5HYK A;  1A28 A;  5KCF A;  2JF9 A;  2ATH A;  4JGV A;  3OMK A;  3RUU A;  5DXK A;  2PIU A;  4YT1 A;  3VT4 A;  3AN3 A;  2P1T A;  5I4V A;  4IVW A;  1XOW A;  3EYB A;  3NSP A;  4DK7 A;  1NQ0 A;  5C4T A;  4DMA A;  5KRJ A;  2W8Y A;  3VRV A;  5H1E A;  3ET0 A;  3CS6 A;  3OLL A;  1PZL A;  4MDD A;  1I7I A;  3FUG A;  4OLM A;  3KFC A;  2ZXM A;  5DXE A;  4G1D A;  3CQV A;  5AZT A;  4IA1 A;  2ZK5 A;  4RUP A;  3CS4 A;  4K4J A;  4RUJ A;  5E14 A;  5DXQ A;  5F9B A;  3ZRB A;  4TV1 A;  2G44 A;  2OVM A;  2GPO A;  3G8O A;  3AZ3 A;  3WJ4 A;  4IWC A;  1FCZ A;  2HWQ A;  5DWE A;  5AWK A;  3OLF A;  1KNU A;  3KWY A;  3OOF A;  4RZG A;  2Q5P A;  4TUZ A;  5DK9 A;  2LBD A;  3ZRA A;  4QE8 A;  5KYA A;  4PP5 A;  4TV1 B;  3SP6 A;  1UHL A;  1ZUC A;  2R40 A;  2J4A A;  1P8D A;  4OFU A;  3FLI A;  3OS8 C;  4E4K A;  2P4Y A;  2HAM A;  3HC5 A;  4R2U A;  3TKC A;  2QPY A;  2AX8 A;  2PIR A;  4XHD A;  4DOR A;  1TXI A;  4TUZ B;  1TFC A;  4F9M A;  3AZ2 A;  2AA6 A;  3P0U A;  2IOK A;  1Z5X E;  4REF A;  2OM9 A;  5GID A;  1N46 A;  1XV9 A;  2AA5 A;  1UHL B;  5DIG A;  4L96 A;  2Q8S A;  1PRG A;  2V7C A;  2AM9 A;  2YLQ A;  4ZN7 A;  3L3X A;  2QW4 A;  5DID A;  2QH6 A;  4JYH A;  2OAX A;  1XNN A;  1T7F A;  4LBD A;  4FN9 A;  2Q7J A;  1SQN A;  5IXK A;  1XV9 B;  3HVL A;  4OED A;  1KKQ A;  1G50 A;  5DLR A;  2NW4 A;  3VSO A;  3VHW A;  4IW6 A;  2QNV A;  1K74 D;  3WMH A;  3WFF A;  5KRK A;  2OVH A;  3F5C A;  4PP3 A;  4QM0 A;  4CI5 A;  2GTK A;  4PLE A;  5DVC A;  3K23 A;  1K4W A;  3F7D A;  3UU7 A;  1SR7 A;  3V4A A;  2XYW A;  4XI3 A;  2HC4 A;  3AZ1 A;  3G8I A;  2R6Y A;  3V9Y A;  3IPQ A;  3FEI A;  5G44 A;  4ZNW A;  4KZI A;  5KRA A;  1I38 A;  2GPP A;  2YHD A;  1M13 A;  3F5C B;  3KMR A;  4A2J A;  5KCD A;  3VN2 A;  5DUG A;  3DZU A;  2QTU A;  2PKL A;  3B67 A;  3N00 A;  1SKX A;  3VJI A;  1T73 A;  1UPV A;  2QMV A;  4ONI A;  3D57 A;  5KD9 A;  4RWV A;  1XP1 A;  3VTB A;  1FM9 A;  2Q6J A;  5DVS A;  1XZX X;  2I0G A;  2FAI A;  2QE4 A;  4RUO X;  1I37 A;  1T63 A;  2HB7 A;  2QSE A;  2ZLA A;  3B65 A;  5HYR A;  2AA7 A;  2FVJ A;  4HLW A;  3CWD A;  5KYJ A;  3OMP A;  1X7R A;  1YMT A;  4XTA A;  4YPQ A;  1R1K A;  4OIV A;  2Q61 A;  3V3Q A;  1X7B A;  1FD0 A;  1RKG A;  1G1U A;  2AB2 A;  3WT5 A;  4FHI A;  5EGV A;  2XKW A;  3WTQ A;  3CJW A;  1K7L A;  1EXX A;  3A2J A;  4OGH A;  3RY9 A;  5KRM A;  4RMD A;  2HB8 A;  1FM6 A;  2VSR A;  4OZR E;  4FGY A;  1YIM A;  4POH A;  2PJL A;  5C4O A;  2JFA A;  2Q60 A;  3WT6 A;  4BCR A;  3ADW A;  4DK8 A;  3DY6 A;  3DR1 A;  4MG7 A;  3K8S A;  1GWQ A;  2O9I A;  2PIX A;  2VV4 A;  3B0T A;  4MG6 A;  1UPW A;  3B68 A;  3T03 A;  2AA2 A;  1XAP A;  5C4S A;  3B0R A;  3PBA A;  5DI7 A;  4XUH A;  2JFA B;  2I4Z A;  2VV3 A;  4OZT E;  3B0W A;  4IV2 A;  3VHV A;  4RZE A;  4UDA A;  2QR9 A;  2YJA B;  3OSA A;  2OUZ A;  3MNE A;  3B3K A;  4MG7 B;  3L1B A;  4OEA A;  5JJM A;  1MVC A;  4OJ4 A;  3GD2 A;  3OAP A;  3IMY A;  2VV4 B;  2ZK4 A;  2ZK1 A;  2IOG A;  3H52 A;  1DKF A;  4K6I A;  3ADV A;  3G9E A;  2B23 A;  4UDC A;  4A4V A;  5AZV A;  2ZNQ A;  1ERR A;  4ZNV A;  5DMF A;  2ZKC A;  3VRU A;  2ZMH A;  2ZMI A;  1NQ1 A;  3SP9 A;  5GT4 A;  2O4R A;  2QAB A;  3OKI A;  2HBH A;  5JJM B;  3GWS X;  2VST A;  3KDU A;  3DZY D;  2ZK0 A;  1DKF B;  2QGW A;  2ZXN A;  3L3Z A;  3P89 A;  3S9S A;  3DCU A;  2AYR A;  3X36 A;  4G1Z A;  5APK A;  5AWJ A;  4NB6 A;  3E94 A;  5C4U A;  3ZQT A;  5DXP A;  5ICK A;  3E7C A;  2QA8 A;  3HO0 A;  3CS8 A;  5DUH A;  1R6G A;  1NAX A;  2H79 A;  4UDD A;  5JI0 D;  2HVC A;  4J5X C;  4R6S A;  3VT6 A;  4QL8 A;  3WT7 A;  3ADX A;  3LBD A;  1G5Y A;  2AX9 A;  2Q7I A;  4JYG A;  3GN8 A;  4ZOM A;  3W0H A;  1KV6 A;  3OSI A;  4FHH A;  1ZKY A;  3SZ1 A;  2B1V A;  2QA8 B;  4NQA B;  3D24 A;  2AX6 A;  4J5W C;  4KZM A;  5DXR A;  4NIE A;  3O1D A;  1Z95 A;  2ZNN A;  4DOS A;  1T79 A;  5APJ A;  4YMQ A;  5B41 A;  5K13 A;  1S9Q A;  3IXP A;  2AXA A;  2Q5G A;  3R5M A;  3CLD A;  1QKN A;  1NHZ A;  4MG9 A;  2GIU A;  5KRI A;  3DT3 A;  1MZN A;  2PIQ A;  2VV0 A;  3HQ5 A;  3KMZ A;  4MG5 A;  3GZ9 A;  4N73 A;  2P1V A;  1YOK A;  4IQR A;  2ZMJ A;  2ZAS A;  5DKS A;  4Y29 A;  2YFE A;  3VT8 A;  1YIN A;  2ZBS A;  5ACC A;  5DYD A;  1SJ0 A;  3CDS A;  4MG9 B;  2YAT A;  4X1G A;  4MGB A;  4OH5 A;  1XQ3 A;  2J14 A;  2Z4J A;  5DL4 A;  4ZN9 A;  1L2I A;  5EI1 A;  3L0J A;  5AAU A;  4DM8 A;  5FQP A;  3P88 A;  2PIN A;  3U9Q A;  1LBD A;  2ACL A;  5DXB A;  2JJ3 A;  4N5G A;  4MGB B;  1U3Q A;  2I4P A;  4IUI A;  2Q59 A;  3AUR A;  2NXX A;  3DCT A;  5GIC A;  2EWP A;  3W5T A;  2NXX E;  2P7G A;  5G43 A;  4ZJW A;  5DKB A;  4POJ A;  4WPF A;  1Z5X U;  3ET3 A;  3L0E A;  2ACL B;  5DXB B;  5DVV A;  4J24 A;  3V9V A;  4EMA A;  4PWL A;  3VRT A;  2Q59 B;  2ABI A;  1UOM A;  3KDT A;  5DKE A;  2PIT A;  5DTV A;  5E19 A;  5A86 A;  5LGA A;  4M8H A;  3FEJ A;  3KPZ A;  3MNP A;  2ZNP A;  2Q5S A;  5L7E A;  1R20 A;  1T7T A;  2G5O A;  2GPV A;  3OSW A;  2G0G A;  3ADT A;  4IA3 A;  3CTB A;  5JY3 A;  4YNK A;  5EC9 A;  2OCF A;  1PK5 A;  5G45 A;  1MV9 A;  2XHS A;  4G2H A;  5DV6 A;  2Q7L A;  5B5B A;  3R8I A;  2Q6S A;  1ZEO A;  3FS1 A;  3IPS A;  5DZI A;  3GWX A;  5E1C A;  5KCT A;  3HOD A;  3AUQ A;  3ADU A;  3KYT A;  2NV7 A;  3B1M A;  3VSP A;  2AAX A;  3NOA A;  4ZNU A;  1XNX A;  5DWJ A;  3H0A D;  4WVD A;  2OZ7 A;  2PRG A;  3W0A A;  3ADS A;  3R8D A;  3X1H A;  3ZR7 A;  3JZC A;  5HCV A;  3UUA A;  1BSX A;  3CDP A;  2O4J A;  2FSZ A;  2PNU A;  3DZU D;  3IPU A;  3NSQ A;  2BAW A;  1R5K A;  4B7W A; 
#chains in the Genus database with same CATH homology
 1VJB A;  5AAV A;  1ZDU A;  3PLZ A;  1FM9 D;  3FC6 A;  3D90 A;  4CSJ A;  3KBA A;  4OKX A;  4ZNH A;  3UUA B;  2VV2 A;  5ETH A;  3B0Q A;  4O8F A;  5DSH A;  3WWR A;  5KRC A;  1X76 A;  2P15 A;  3TX7 B;  4WQP A;  3OZJ A;  5KCE A;  3OS9 A;  1QKM A;  5AAV B;  1R1K D;  2B50 A;  1IE9 A;  3FC6 B;  4MGA A;  4RZF A;  3A2I A;  1WM0 X;  5DMC A;  2POB A;  3W5Q A;  1GWR A;  3A40 X;  1E3G A;  5KCW A;  3D5F A;  4PXM A;  4OHA A;  1OVL A;  4S14 A;  5IZ0 A;  1U3S A;  1ZDT A;  3A2H A;  4IA2 A;  4OH6 A;  1X7J A;  1FM6 D;  1RDT D;  5DU5 A;  1YYE A;  4JAZ A;  4LNX A;  4XT9 A;  3OS8 A;  1OSH A;  4MGA B;  1RJK A;  4OJ9 A;  5DXG A;  1U3R A;  3UP3 A;  3OMO A;  2A3I A;  5FQT A;  4K7A A;  4OIL A;  5SYZ A;  3UUD A;  1OVL B;  1FBY A;  3VT5 A;  2Q70 A;  2AMB A;  3TY0 A;  4M8E A;  4OC7 A;  1FCY A;  4Q50 A;  1IE8 A;  5L11 A;  2PIV A;  2P7Z A;  4IS8 A;  5DZ3 A;  3FXV A;  4MGD A;  2P7A A;  3PRG A;  5FQR A;  1DB1 A;  1S0Z A;  1ZGY A;  1YY4 A;  2Q6R A;  3GYU A;  4UDB A;  4PRG A;  1XP6 A;  2YJD A;  4OZT U;  3UUD B;  1S19 A;  2VV1 A;  3L03 A;  3E00 D;  5KRL A;  5HJS A;  4ITE A;  4ZO1 B;  5KRO A;  1N4H A;  5CJ6 A;  2BJ4 A;  4MGD B;  1T5Z A;  2Q1V A;  2I4J A;  4G20 A;  2HAR A;  2I0J A;  4PLD A;  4NUF A;  4R06 A;  1Y0S A;  4OK1 A;  4J26 A;  5DWL A;  2VV1 B;  1YJE A;  5AK2 A;  4OAR A;  3PO9 A;  1ERE A;  5EJV A;  3VT9 A;  1RKH A;  3WGP A;  1L2J A;  2NPA A;  3OLS A;  1Y9R A;  5AVL A;  5G42 A;  2BJ4 B;  3W0Y A;  4WHF A;  1XQC A;  3ET2 A;  2QA6 A;  3B66 A;  4ZO1 X;  3VT7 A;  3VT3 A;  1PQ6 A;  4G21 A;  3K22 A;  3VJT A;  5G3J A;  3W0G A;  2ZVT A;  4S0T A;  3UUC A;  2QXS A;  3VTC A;  3BQD A;  3IA6 A;  1G2N A;  1FCX A;  2H77 A;  2F4B A;  2ZNO A;  3FAL A;  2IHQ A;  2GL8 A;  2AWH A;  1XLS A;  4RFW A;  4FNE A;  1HJ1 A;  2R6W A;  2HFP A;  4OFR A;  1XLS E;  3RVF A;  3WFG A;  4CI4 A;  4IV4 A;  3TKM A;  1YA3 A;  3R2A A;  2GPU A;  4OIU A;  5AVI A;  2QXM A;  1QKU A;  5DUE A;  4IU7 A;  2GWX A;  2YLO A;  5KRH A;  2ZFX A;  3FAL B;  5G46 A;  3HZF A;  1I7G A;  2XYJ A;  1T65 A;  4OJB A;  3IXP D;  5DP0 A;  1PQ9 A;  3R29 A;  4APU A;  1NQ7 A;  2YLP A;  2ZL9 A;  4RE8 A;  1ZAF A;  4WHG A;  3UVV A;  4LSJ A;  3WJ5 A;  2R40 D;  5E7V A;  1LV2 A;  2Q1H A;  3GYT A;  3ERT A;  4PPS A;  4WLB A;  4ZNT A;  4PF3 A;  1NYX A;  5DZ0 A;  5IAW A;  3OOK A;  5E15 A;  1XDK A;  3M7R A;  3OKH A;  1YOW A;  4E2J A;  1XP9 A;  3UVV B;  4IA7 A;  5DX3 A;  3RLJ A;  3Q95 A;  2ZK6 A;  5KR9 A;  3AN4 A;  3ET1 A;  5EHJ A;  1XVP A;  1K74 A;  4ZNS A;  5EIT A;  4OEY A;  4RAK A;  1XDK B;  2P1U A;  3AUN A;  2Z4B A;  2PIW A;  4Q0A C;  2V0V A;  5FQS A;  5DIE A;  5DRJ A;  4PPP A;  5DYB A;  4DM6 A;  5DX3 B;  1YP0 A;  3B5R A;  2Q7K A;  3ERD A;  3Q95 B;  1M2Z A;  4LTW A;  2QZO A;  5DY8 A;  1T76 A;  4G1Y A;  3W0C A;  4LNW A;  5DV8 A;  1XVP B;  2REW A;  3K6P A;  1NQ2 A;  3O1E A;  1ZH7 A;  3V3E A;  2HAS A;  3A3Z X;  3VHU A;  5G5W A;  4IVY A;  2ZK3 A;  1PQC A;  2QZO B;  4XUM A;  1R20 D;  1X7E A;  4E4Q A;  2G0H A;  2XYX A;  3VJH A;  2ZXZ A;  5DV3 A;  4ZI1 A;  2HCD A;  1XJ7 A;  4X1F A;  3H0A A;  2AO6 A;  4PP6 A;  5DXM A;  2ZY0 A;  4J5X A;  5AYG A;  1U9E A;  2PIP L;  3AX8 A;  5E0X A;  4OEZ A;  3V9T A;  3UU7 B;  3KMG A;  4JL4 A;  1A52 A;  3BEJ A;  1M7W A;  4HEE X;  4OKW A;  1NAV A;  3QT0 A;  5L7G A;  4PVU A;  2ZLC A;  3W0J A;  4J5W A;  4ZJR A;  1X78 A;  3UP0 A;  1YUC A;  5HZC A;  1NRL A;  1OT7 A;  5M96 A;  4L98 A;  5LWP A;  1ILG A;  4RME A;  1OSV A;  1XPC A;  3OZ0 A;  3PEQ A;  4JYI A;  4Q13 A;  2AMA A;  2J7Y A;  4DQM A;  2HWR A;  3L0L A;  1ILH A;  4QJR A;  1XIU A;  4P6W A;  3RUT A;  1QKT A;  4QK4 A;  3OMM A;  5DRM A;  5DWG A;  4OZR U;  3W5R A;  5DWI A;  2E2R A;  1GWX A;  1T7M A;  1RDT A;  3BC5 A;  5E0W A;  5KRF A;  1E3K A;  1EXA A;  1RK3 A;  2POG A;  3A78 A;  1S9P A;  5DZH A;  3VI8 A;  3VRW A;  2P54 A;  3W5P A;  3X1I A;  2GP7 A;  3VTD A;  3X31 A;  3G0W A;  1T74 A;  3LMP A;  1Q4X A;  5DZ1 A;  3ILZ A;  4ITF A;  1H9U A;  3A9E A;  3E00 A;  3HM1 A;  3R8A A;  5DKG A;  5GIE A;  1HG4 A;  4MG8 A;  4A4W A;  5KCU A;  1GS4 A;  4QE6 A;  4XLD A;  1NDE A;  3D6D A;  2AX7 A;  1XB7 A;  4MGC A;  4NY9 A;  4IW8 A;  4KZJ A;  4IWF A;  3DZY A;  2PIO A;  4EM9 A;  1N83 A;  4P6X A;  4G2I A;  3A9E B;  3V49 A;  2B1Z A;  3W0I A;  4MG8 B;  5HJP A;  3HC6 A;  1PDU A;  3P8X A;  3MNO A;  1P93 A;  2QGT A;  4N8R A;  3RLL A;  2Q3Y A;  3PCU A;  3OMQ A;  3R5N A;  4OKT A;  4N1Y A;  2YLY A;  1T7R A;  3GBK A;  3JZB A;  5L7H A;  4OKB A;  3VJS A;  1NUO A;  4S15 A;  2ZK2 A;  3HLV A;  2J7X A;  4RMC A;  5HJP B;  4XAO A;  1PCG A;  3FUR A;  1Y0X X;  1S0X A;  3OGT A;  5FQV A;  3AFR A;  4REE A;  4S0S A;  5KCC A;  5APH A;  5HYK A;  1A28 A;  5KCF A;  2JF9 A;  2ATH A;  4JGV A;  3OMK A;  3RUU A;  5DXK A;  2PIU A;  4YT1 A;  3VT4 A;  3AN3 A;  2P1T A;  5I4V A;  4IVW A;  1XOW A;  3EYB A;  3NSP A;  4DK7 A;  1NQ0 A;  5C4T A;  4DMA A;  5KRJ A;  2W8Y A;  3VRV A;  5H1E A;  3ET0 A;  3CS6 A;  3OLL A;  1PZL A;  4MDD A;  1I7I A;  3FUG A;  4OLM A;  3KFC A;  2ZXM A;  5DXE A;  4G1D A;  3CQV A;  5AZT A;  4IA1 A;  2ZK5 A;  4RUP A;  3CS4 A;  4K4J A;  4RUJ A;  5E14 A;  5DXQ A;  5F9B A;  3ZRB A;  4TV1 A;  2G44 A;  2OVM A;  2GPO A;  3G8O A;  3AZ3 A;  3WJ4 A;  4IWC A;  1FCZ A;  2HWQ A;  5DWE A;  5AWK A;  3OLF A;  1KNU A;  3KWY A;  3OOF A;  4RZG A;  2Q5P A;  4TUZ A;  5DK9 A;  2LBD A;  3ZRA A;  4QE8 A;  5KYA A;  4PP5 A;  4TV1 B;  3SP6 A;  1UHL A;  1ZUC A;  2R40 A;  2J4A A;  1P8D A;  4OFU A;  3FLI A;  3OS8 C;  4E4K A;  2P4Y A;  2HAM A;  3HC5 A;  4R2U A;  3TKC A;  2QPY A;  2AX8 A;  2PIR A;  4XHD A;  4DOR A;  1TXI A;  4TUZ B;  1TFC A;  4F9M A;  3AZ2 A;  2AA6 A;  3P0U A;  2IOK A;  1Z5X E;  4REF A;  2OM9 A;  5GID A;  1N46 A;  1XV9 A;  2AA5 A;  1UHL B;  5DIG A;  4L96 A;  2Q8S A;  1PRG A;  2V7C A;  2AM9 A;  2YLQ A;  4ZN7 A;  3L3X A;  2QW4 A;  5DID A;  2QH6 A;  4JYH A;  2OAX A;  1XNN A;  1T7F A;  4LBD A;  4FN9 A;  2Q7J A;  1SQN A;  5IXK A;  1XV9 B;  3HVL A;  4OED A;  1KKQ A;  1G50 A;  5DLR A;  2NW4 A;  3VSO A;  3VHW A;  4IW6 A;  2QNV A;  1K74 D;  3WMH A;  3WFF A;  5KRK A;  2OVH A;  3F5C A;  4PP3 A;  4QM0 A;  4CI5 A;  2GTK A;  4PLE A;  5DVC A;  3K23 A;  1K4W A;  3F7D A;  3UU7 A;  1SR7 A;  3V4A A;  2XYW A;  4XI3 A;  2HC4 A;  3AZ1 A;  3G8I A;  2R6Y A;  3V9Y A;  3IPQ A;  3FEI A;  5G44 A;  4ZNW A;  4KZI A;  5KRA A;  1I38 A;  2GPP A;  2YHD A;  1M13 A;  3F5C B;  3KMR A;  4A2J A;  5KCD A;  3VN2 A;  5DUG A;  3DZU A;  2QTU A;  2PKL A;  3B67 A;  3N00 A;  1SKX A;  3VJI A;  1T73 A;  1UPV A;  2QMV A;  4ONI A;  3D57 A;  5KD9 A;  4RWV A;  1XP1 A;  3VTB A;  1FM9 A;  2Q6J A;  5DVS A;  1XZX X;  2I0G A;  2FAI A;  2QE4 A;  4RUO X;  1I37 A;  1T63 A;  2HB7 A;  2QSE A;  2ZLA A;  3B65 A;  5HYR A;  2AA7 A;  2FVJ A;  4HLW A;  3CWD A;  5KYJ A;  3OMP A;  1X7R A;  1YMT A;  4XTA A;  4YPQ A;  1R1K A;  4OIV A;  2Q61 A;  3V3Q A;  1X7B A;  1FD0 A;  1RKG A;  1G1U A;  2AB2 A;  3WT5 A;  4FHI A;  5EGV A;  2XKW A;  3WTQ A;  3CJW A;  1K7L A;  1EXX A;  3A2J A;  4OGH A;  3RY9 A;  5KRM A;  4RMD A;  2HB8 A;  1FM6 A;  2VSR A;  4OZR E;  4FGY A;  1YIM A;  4POH A;  2PJL A;  5C4O A;  2JFA A;  2Q60 A;  3WT6 A;  4BCR A;  3ADW A;  4DK8 A;  3DY6 A;  3DR1 A;  4MG7 A;  3K8S A;  1GWQ A;  2O9I A;  2PIX A;  2VV4 A;  3B0T A;  4MG6 A;  1UPW A;  3B68 A;  3T03 A;  2AA2 A;  1XAP A;  5C4S A;  3B0R A;  3PBA A;  5DI7 A;  4XUH A;  2JFA B;  2I4Z A;  2VV3 A;  4OZT E;  3B0W A;  4IV2 A;  3VHV A;  4RZE A;  4UDA A;  2QR9 A;  2YJA B;  3OSA A;  2OUZ A;  3MNE A;  3B3K A;  4MG7 B;  3L1B A;  4OEA A;  5JJM A;  1MVC A;  4OJ4 A;  3GD2 A;  3OAP A;  3IMY A;  2VV4 B;  2ZK4 A;  2ZK1 A;  2IOG A;  3H52 A;  1DKF A;  4K6I A;  3ADV A;  3G9E A;  2B23 A;  4UDC A;  4A4V A;  5AZV A;  2ZNQ A;  1ERR A;  4ZNV A;  5DMF A;  2ZKC A;  3VRU A;  2ZMH A;  2ZMI A;  1NQ1 A;  3SP9 A;  5GT4 A;  2O4R A;  2QAB A;  3OKI A;  2HBH A;  5JJM B;  3GWS X;  2VST A;  3KDU A;  3DZY D;  2ZK0 A;  1DKF B;  2QGW A;  2ZXN A;  3L3Z A;  3P89 A;  3S9S A;  3DCU A;  2AYR A;  3X36 A;  4G1Z A;  5APK A;  5AWJ A;  4NB6 A;  3E94 A;  5C4U A;  3ZQT A;  5DXP A;  5ICK A;  3E7C A;  2QA8 A;  3HO0 A;  3CS8 A;  5DUH A;  1R6G A;  1NAX A;  2H79 A;  4UDD A;  5JI0 D;  2HVC A;  4J5X C;  4R6S A;  3VT6 A;  4QL8 A;  3WT7 A;  3ADX A;  3LBD A;  1G5Y A;  2AX9 A;  2Q7I A;  4JYG A;  3GN8 A;  4ZOM A;  3W0H A;  1KV6 A;  3OSI A;  4FHH A;  1ZKY A;  3SZ1 A;  2B1V A;  2QA8 B;  4NQA B;  3D24 A;  2AX6 A;  4J5W C;  4KZM A;  5DXR A;  4NIE A;  3O1D A;  1Z95 A;  2ZNN A;  4DOS A;  1T79 A;  5APJ A;  4YMQ A;  5B41 A;  5K13 A;  1S9Q A;  3IXP A;  2AXA A;  2Q5G A;  3R5M A;  3CLD A;  1QKN A;  1NHZ A;  4MG9 A;  2GIU A;  5KRI A;  3DT3 A;  1MZN A;  2PIQ A;  2VV0 A;  3HQ5 A;  3KMZ A;  4MG5 A;  3GZ9 A;  4N73 A;  2P1V A;  1YOK A;  4IQR A;  2ZMJ A;  2ZAS A;  5DKS A;  4Y29 A;  2YFE A;  3VT8 A;  1YIN A;  2ZBS A;  5ACC A;  5DYD A;  1SJ0 A;  3CDS A;  4MG9 B;  2YAT A;  4X1G A;  4MGB A;  4OH5 A;  1XQ3 A;  2J14 A;  2Z4J A;  5DL4 A;  4ZN9 A;  1L2I A;  5EI1 A;  3L0J A;  5AAU A;  4DM8 A;  5FQP A;  3P88 A;  2PIN A;  3U9Q A;  1LBD A;  2ACL A;  5DXB A;  2JJ3 A;  4N5G A;  4MGB B;  1U3Q A;  2I4P A;  4IUI A;  2Q59 A;  3AUR A;  2NXX A;  3DCT A;  5GIC A;  2EWP A;  3W5T A;  2NXX E;  2P7G A;  5G43 A;  4ZJW A;  5DKB A;  4POJ A;  4WPF A;  1Z5X U;  3ET3 A;  3L0E A;  2ACL B;  5DXB B;  5DVV A;  4J24 A;  3V9V A;  4EMA A;  4PWL A;  3VRT A;  2Q59 B;  2ABI A;  1UOM A;  3KDT A;  5DKE A;  2PIT A;  5DTV A;  5E19 A;  5A86 A;  5LGA A;  4M8H A;  3FEJ A;  3KPZ A;  3MNP A;  2ZNP A;  2Q5S A;  5L7E A;  1R20 A;  1T7T A;  2G5O A;  2GPV A;  3OSW A;  2G0G A;  3ADT A;  4IA3 A;  3CTB A;  5JY3 A;  4YNK A;  5EC9 A;  2OCF A;  1PK5 A;  5G45 A;  1MV9 A;  2XHS A;  4G2H A;  5DV6 A;  2Q7L A;  5B5B A;  3R8I A;  2Q6S A;  1ZEO A;  3FS1 A;  3IPS A;  5DZI A;  3GWX A;  5E1C A;  5KCT A;  3HOD A;  3AUQ A;  3ADU A;  3KYT A;  2NV7 A;  3B1M A;  3VSP A;  2AAX A;  3NOA A;  4ZNU A;  1XNX A;  5DWJ A;  3H0A D;  4WVD A;  2OZ7 A;  2PRG A;  3W0A A;  3ADS A;  3R8D A;  3X1H A;  3ZR7 A;  3JZC A;  5HCV A;  3UUA A;  1BSX A;  3CDP A;  2O4J A;  2FSZ A;  2PNU A;  3DZU D;  3IPU A;  3NSQ A;  2BAW A;  1R5K A;  4B7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...