1X7RA

Crystal structure of estrogen receptor alpha complexed with genistein
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
242
structure length
235
Chain Sequence
LALSLTADQMVSALLDAEPPILYSESEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPVKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Understanding the Selectivity of Genistein for Human Estrogen Receptor-Beta Using X-Ray Crystallography and Computational Methods
pubmed doi rcsb
molecule keywords Estrogen receptor 1 (alpha)
molecule tags Transcription
source organism Homo sapiens
total genus 92
structure length 235
sequence length 242
ec nomenclature
pdb deposition date 2004-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 1x7rA00
1RKHA 3AN3A 3V3QA 3RLJA 5DV3A 1XV9B 3UUDA 3WGPA 2I4PA 2Z4BA 3B3KA 5GT4A 4YMQA 1UHLB 3OS8A 4PP3A 5FQTA 3O1EA 2OVMA 4QM0A 4HEEX 5CJ6A 3ADXA 4XHDA 5APKA 5L7HA 2LBDA 1Y0XX 5KCFA 3IPQA 3UVVA 4XAOA 5DXRA 4S0SA 4POHA 1MVCA 1TXIA 4OGHA 1Y0SA 2ZLAA 3ET0A 2XHSA 3OSAA 4IW6A 4TV1B 4Y29A 5L7EA 5KCUA 2Q6JA 2J4AA 4OC7A 3X36A 3W5RA 3KDUA 1NQ2A 3P8XA 5ACCA 3D6DA 2ACLB 3W5QA 2XYWA 3H52A 5C4UA 3KDTA 3BQDA 1SQNA 2VV1A 5DXPA 5KCWA 4J5WA 2AO6A 4OJ9A 2J14A 5C4OA 4PLEA 1NHZA 2Q60A 1I37A 2REWA 2HVCA 2V0VA 3E7CA 2QGTA 1N46A 3F7DA 3OSWA 1XJ7A 2HB7A 5B5BA 3ERDA 4LNXA 4OJBA 1FM6A 3BEJA 1OVLA 2Q3YA 4M8HA 3IPUA 5KCCA 1YP0A 1U3SA 2R40D 4J26A 4S15A 2O9IA 1T76A 3PRGA 4TUZB 1NUOA 3VRVA 3DCUA 2HB8A 3GYTA 5HJPB 4ZNHA 2AX6A 4L96A 5E0WA 4ZOMA 4E4KA 4E4QA 1YIMA 3VRUA 2YLYA 3OKHA 3KBAA 1HJ1A 5DLRA 3FALA 3SP6A 5AWJA 3VSOA 4JGVA 4KZIA 2GWXA 3UP3A 4OEDA 4OK1A 4RZGA 5KRIA 4KZJA 4OEYA 4R06A 1FBYA 3OLSA 2AA7A 1NQ0A 2Q6RA 4RWVA 4UDAA 4ITFA 2R6WA 2F4BA 1LV2A 5DUGA 1Z5XE 4MG7A 3E00A 3DT3A 3VT6A 3PO9A 5DKBA 5AAVA 3CS8A 3VT5A 3G8OA 5AVIA 4K4JA 5EC9A 5DZHA 5K13A 2PIWA 2ZXZA 4RAKA 3CLDA 4P6WA 3G8IA 5EGVA 2ZK2A 2ZNNA 3F5CB 2IOKA 4FHHA 3FC6B 1NYXA 3HZFA 4RFWA 4RUJA 4MG9A 4DMAA 2PIXA 4MGAB 4ZNVA 1UOMA 3VTCA 4N5GA 4ZJWA 3DZUD 3FEIA 3R8DA 1PQ9A 1Z5XU 3B1MA 3W0YA 2I4ZA 2QA8B 3HVLA 3NSQA 2AX8A 3DR1A 5DK9A 3PBAA 4QK4A 1E3GA 2PITA 1FM6D 3O1DA 3GD2A 4ITEA 2P1UA 4G21A 4ZO1B 3AZ2A 5KRJA 5G42A 4PXMA 1NQ7A 3FS1A 1XQ3A 4MG8A 2ZVTA 3WTQA 1RKGA 3CS6A 4OZRE 5DYDA 1X7JA 3KWYA 1ZH7A 2GP7A 4PP5A 2GPVA 1XDKA 3QT0A 2EWPA 3L3XA 3OZ0A 1ZUCA 3ZRAA 4YPQA 1KNUA 3X1IA 2OVHA 2QPYA 3K8SA 1G1UA 3R29A 4RZEA 3VHVA 5JJMA 5L7GA 4IVYA 1M7WA 2B1ZA 2ZL9A 3L0EA 1RDTA 5DZ0A 3H0AA 5AYGA 3TKCA 1Q4XA 4G2IA 3B65A 2YJDA 2HAMA 5KRCA 4XUHA 1R20D 3IPSA 3JZBA 4IS8A 5E19A 4A2JA 4J5XC 5G3JA 3B0RA 4G20A 3W0AA 5DVSA 3PCUA 2H79A 4REEA 1QKMA 3NOAA 4ZO1X 2Q7IA 5C4TA 3Q95A 4WHFA 2IOGA 4LSJA 1FCZA 2ZMJA 5GIDA 3SZ1A 1Y9RA 2VV3A 4OZRU 5LGAA 2AWHA 1K74A 1XVPB 3VJHA 1SKXA 3X1HA 1S9QA 3G0WA 1YY4A 4RE8A 4RUPA 4IV2A 4DK7A 2YFEA 2HFPA 3ET1A 3HODA 4G1ZA 1EXXA 5DIEA 1XB7A 4ONIA 4QJRA 5DKSA 2HBHA 3A3ZX 2PIVA 3A9EA 4IW8A 3V49A 3V4AA 3W0HA 5DUEA 1I7IA 2OM9A 3HC6A 3AURA 4JYIA 3GYUA 4TV1A 1XP9A 5E0XA 4OEZA 3BC5A 2P7GA 3U9QA 4WQPA 4ZNSA 4IWFA 1DKFA 1R6GA 3VT8A 5DZ3A 3ADVA 2P1TA 5KRKA 5JY3A 3ADUA 3P0UA 2O4JA 1ZKYA 3NSPA 4FNEA 5KRFA 5KROA 4ZI1A 3R8IA 4MGCA 3RUUA 4OFRA 1YINA 3V9VA 3VHUA 3VTDA 1FM9A 5DZ1A 1WM0X 5C4SA 5DV8A 2OUZA 4MGDB 3VT9A 1GWRA 2PIRA 2PIPL 3HM1A 2NXXE 4Q13A 5DI7A 1ILHA 5DU5A 3UP0A 5IXKA 3TKMA 3AFRA 4JYGA 4WLBA 3OKIA 2AM9A 3B67A 2PNUA 3FURA 4PWLA 3ZR7A 3A2IA 4LBDA 4MGBB 3ZRBA 4HLWA 3UUDB 3P88A 1G2NA 5HJPA 1SR7A 1R1KD 4DK8A 5AWKA 4IQRA 2B50A 4X1FA 4NIEA 4ZN9A 3VT4A 3ADWA 4M8EA 3D57A 4OH5A 4X1GA 2V7CA 2HASA 2PIUA 3OMKA 4IWCA 3RVFA 3SP9A 3VJSA 5HYRA 2BJ4A 3PLZA 3DZYD 1N83A 3E94A 5DV6A 3UU7A 5KRAA 2ZNOA 3IXPA 3UVVB 3KYTA 5DKEA 2FSZA 2PINA 4OARA 3W0GA 2AX7A 5DMFA 1SJ0A 1TFCA 1X78A 3WMHA 5DWGA 1OSVA 2PRGA 1XIUA 2HCDA 2AMAA 1Z95A 1ZGYA 1P8DA 1RJKA 2Q7LA 2J7YA 4N73A 2HWQA 1NAVA 3KMGA 2E2RA 5DWEA 4J24A 1FCXA 1X7EA 5KD9A 2J7XA 3R2AA 4P6XA 3OMPA 1PZLA 3KMZA 4IA1A 1T73A 2ZK0A 2JFAB 2QZOB 2ZK6A 2HARA 3RLLA 3W5PA 1T63A 2GPPA 4JAZA 5B41A 4L98A 1L2IA 5AZVA 3FC6A 1ERRA 3RY9A 3W0JA 4NQAB 1G50A 2Q59A 4MGAA 5H1EA 2Q5GA 1N4HA 1YUCA 2P54A 4NUFA 3OSIA 4RMDA 5DL4A 3ILZA 1ZDUA 2QSEA 1KV6A 3T03A 2QXMA 2GPOA 3A40X 3FLIA 2PIOA 2QXSA 2P7AA 5KRMA 3L03A 4G1YA 1MZNA 5DXEA 3K23A 2AA5A 4IUIA 1U9EA 5GICA 4OHAA 4UDCA 5KRHA 5DIDA 3S9SA 3B66A 3W0CA 5IAWA 4XT9A 5DXBB 4RZFA 3KMRA 1NAXA 4ZNWA 3AX8A 4MDDA 5I4VA 5FQPA 5G44A 3D24A 5EJVA 1QKNA 4MG7B 5HZCA 5AAVB 1A28A 1S0XA 1XP6A 3B0WA 2AX9A 3CQVA 4LTWA 4RMCA 3GWSX 1YA3A 4XI3A 3MNPA 4CI4A 3UUAA 3OOKA 4OFUA 4MG6A 3VHWA 2QMVA 1UPVA 4Q0AC 5DKGA 5IZ0A 3G9EA 5DYBA 5DXQA 1GS4A 3IMYA 3WJ5A 2JJ3A 4A4VA 4OEAA 3V3EA 2BAWA 2R6YA 2Z4JA 5DX3B 5HJSA 4MG9B 3VI8A 4PP6A 1I7GA 5FQSA 3ADSA 2AMBA 5EITA 3CDSA 3L1BA 2Q7JA 2P7ZA 5ICKA 3TY0A 1FD0A 3VTBA 5HYKA 5KCDA 1NQ1A 3B0TA 3E00D 4J5XA 3B5RA 2Q5SA 3UUCA 4B7WA 2GPUA 5E15A 5DRJA 1XZXX 2VV4B 2XYXA 4OIUA 1XP1A 4EMAA 3N00A 5DVVA 4ZJRA 1M13A 4R2UA 1EREA 1XV9A 2NW4A 3CS4A 2QW4A 2Q61A 5DY8A 5AZTA 5FQRA 3VJIA 1S9PA 4KZMA 4PPPA 2P15A 2FAIA 1UHLA 1XAPA 3B0QA 3HO0A 3WT5A 4DQMA 3OLFA 1OT7A 5M96A 1YMTA 3GZ9A 1S19A 2PIQA 2Q7KA 3IA6A 2GL8A 3CWDA 1XQCA 4MG5A 4OKTA 2R40A 4S0TA 2NV7A 4EM9A 2G5OA 2OZ7A 1DB1A 3RUTA 5AAUA 3WT7A 4S14A 1UPWA 2ACLA 4RUOX 1ZEOA 1RK3A 4POJA 3WWRA 1XOWA 3MNEA 1T7MA 3LMPA 3MNOA 1E3KA 5LWPA 2IHQA 3PEQA 1X7RA 2A3IA 3W5TA 3DY6A 4IV4A 1PDUA 3OS8C 4MGBA 5EI1A 5KYJA 3DCTA 1R5KA 3A2HA 2OCFA 1VJBA 1M2ZA 5DUHA 2B1VA 3KFCA 4OZTE 3B68A 3W0IA 2POBA 1RDTD 1L2JA 3FUGA 3H0AD 4XUMA 2I4JA 5DSHA 4K7AA 3OGTA 2ZMIA 2ZY0A 4BCRA 5DVCA 3A9EB 4TUZA 2OAXA 4G2HA 2XYJA 2YLPA 4ZNUA 4A4WA 1YYEA 4DOSA 3WFGA 3K22A 3HC5A 2ZLCA 2QA6A 3OAPA 3L0JA 1BSXA 1T74A 4XLDA 4N1YA 2Q1VA 1A52A 2PKLA 4JL4A 1H9UA 2QABA 4J5WC 1DKFB 3FXVA 3ET2A 2G44A 3LBDA 2QR9A 1GWQA 4WPFA 5APHA 5KR9A 3DZUA 1K74D 1MV9A 4FN9A 1PK5A 3OLLA 4FHIA 1XNNA 1YOWA 1HG4A 3OMQA 4O8FA 1PRGA 1OSHA 4YNKA 3AZ3A 4IU7A 4OZTU 1NRLA 2JFAA 2QZOA 1PQ6A 2ABIA 3CTBA 3R5NA 2YHDA 1X76A 1YJEA 3ET3A 2ATHA 2VV1B 3HQ5A 1XLSA 2NPAA 3WJ4A 2P4YA 3ZQTA 3A78A 4CI5A 4N8RA 4OH6A 3TX7B 3V9YA 1IE8A 4UDBA 3L0LA 3HLVA 4DORA 5SYZA 4CSJA 1GWXA 1QKTA 1X7BA 4QE8A 1T65A 5KCEA 2ZASA 2Q8SA 4F9MA 3F5CA 4R6SA 3AUQA 4OJ4A 1KKQA 1T79A 1OVLB 3VRWA 3VN2A 2JF9A 2YLOA 1YOKA 4ZNTA 4WVDA 4NY9A 1I38A 1G5YA 2Q70A 2BJ4B 5DWLA 3UU7B 4DM6A 5DXBA 2O4RA 1FM9D 2QA8A 1R20A 3OZJA 5G43A 2YATA 3M7RA 2P1VA 3R5MA 4OLMA 3FALB 1FCYA 5DWJA 2QNVA 3L3ZA 5E14A 4PPSA 3VJTA 3VRTA 4G1DA 3VSPA 2ZNPA 1IE9A 5AVLA 2ZK3A 1NDEA 2XKWA 1K4WA 3GN8A 5DTVA 2ZK1A 4YT1A 2YJAB 5DXKA 3EYBA 5L11A 4JYHA 3VT3A 4XTAA 3VT7A 5DP0A 5DXGA 2B23A 2I0GA 2ZNQA 5APJA 2ZMHA 2ZK5A 5G5WA 1QKUA 2PJLA 2VV0A 3P89A 5G46A 1P93A 1XLSE 5DX3A 2G0GA 3AZ1A 2HC4A 1T7RA 2Q59B 2ZBSA 2QGWA 3IXPD 3V9TA 2GTKA 3A2JA 4E2JA 1T5ZA 3D5FA 4ZN7A 2AB2A 2AAXA 5DMCA 1ILGA 2ZK4A 2Q5PA 2VSRA 3OMOA 2H77A 5E7VA 2AXAA 5ETHA 5GIEA 4IA2A 1EXAA 5FQVA 3X31A 2VSTA 5DXMA 5DRMA 5G45A 3WT6A 3GWXA 1XPCA 5DIGA 2Q6SA 2QTUA 4UDDA 3JZCA 4REFA 4K6IA 1T7TA 4QL8A 2VV4A 5DZIA 4WHGA 5KCTA 3AUNA 1XVPA 4IA3A 4PVUA 5AK2A 4RMEA 3CDPA 5KRLA 2GIUA 4FGYA 4OKBA 5JI0D 4IA7A 2HWRA 4Q50A 2AYRA 1S0ZA 2Q1HA 3ADTA 3CJWA 3FEJA 4OIVA 4PLDA 2W8YA 3OMMA 2POGA 2ZXMA 2ZKCA 4MG8B 4APUA 5KYAA 4PRGA 3OS9A 3UUAB 1PQCA 1XNXA 2G0HA 3ERTA 1PCGA 5E1CA 1XDKB 3OOFA 5DWIA 1ZDTA 3WFFA 2QE4A 5JJMB 1R1KA 1ZAFA 2AA2A 2I0JA 4OKXA 5F9BA 4OILA 3KPZA 2NXXA 2ZFXA 4LNWA 2YLQA 5A86A 1U3RA 4OKWA 3DZYA 1K7LA 3R8AA 3D90A 2FVJA 2QH6A 4NB6A 5EHJA 1LBDA 2ZXNA 4PF3A 3K6PA 2AA6A 4MGDA 1U3QA 4QE6A 2VV2A 3Q95B 5HCVA 4IVWA 3GBKA 1T7FA 4DM8A 3AN4A
chains in the Genus database with same CATH superfamily
1RKHA 3AN3A 3V3QA 3RLJA 5DV3A 1XV9B 3UUDA 3WGPA 2I4PA 2Z4BA 3B3KA 5GT4A 4YMQA 1UHLB 3OS8A 4PP3A 5FQTA 3O1EA 2OVMA 4QM0A 4HEEX 5CJ6A 3ADXA 4XHDA 5APKA 5L7HA 2LBDA 1Y0XX 5KCFA 3IPQA 3UVVA 4XAOA 5DXRA 4S0SA 4POHA 1MVCA 1TXIA 4OGHA 1Y0SA 2ZLAA 3ET0A 2XHSA 3OSAA 4IW6A 4TV1B 4Y29A 5L7EA 5KCUA 2Q6JA 2J4AA 4OC7A 3X36A 3W5RA 3KDUA 1NQ2A 3P8XA 5ACCA 3D6DA 2ACLB 3W5QA 2XYWA 3H52A 5C4UA 3KDTA 3BQDA 1SQNA 2VV1A 5DXPA 5KCWA 4J5WA 2AO6A 4OJ9A 2J14A 5C4OA 4PLEA 1NHZA 2Q60A 1I37A 2REWA 2HVCA 2V0VA 3E7CA 2QGTA 1N46A 3F7DA 3OSWA 1XJ7A 2HB7A 5B5BA 3ERDA 4LNXA 4OJBA 1FM6A 3BEJA 1OVLA 2Q3YA 4M8HA 3IPUA 5KCCA 1YP0A 1U3SA 2R40D 4J26A 4S15A 2O9IA 1T76A 3PRGA 4TUZB 1NUOA 3VRVA 3DCUA 2HB8A 3GYTA 5HJPB 4ZNHA 2AX6A 4L96A 5E0WA 4ZOMA 4E4KA 4E4QA 1YIMA 3VRUA 2YLYA 3OKHA 3KBAA 1HJ1A 5DLRA 3FALA 3SP6A 5AWJA 3VSOA 4JGVA 4KZIA 2GWXA 3UP3A 4OEDA 4OK1A 4RZGA 5KRIA 4KZJA 4OEYA 4R06A 1FBYA 3OLSA 2AA7A 1NQ0A 2Q6RA 4RWVA 4UDAA 4ITFA 2R6WA 2F4BA 1LV2A 5DUGA 1Z5XE 4MG7A 3E00A 3DT3A 3VT6A 3PO9A 5DKBA 5AAVA 3CS8A 3VT5A 3G8OA 5AVIA 4K4JA 5EC9A 5DZHA 5K13A 2PIWA 2ZXZA 4RAKA 3CLDA 4P6WA 3G8IA 5EGVA 2ZK2A 2ZNNA 3F5CB 2IOKA 4FHHA 3FC6B 1NYXA 3HZFA 4RFWA 4RUJA 4MG9A 4DMAA 2PIXA 4MGAB 4ZNVA 1UOMA 3VTCA 4N5GA 4ZJWA 3DZUD 3FEIA 3R8DA 1PQ9A 1Z5XU 3B1MA 3W0YA 2I4ZA 2QA8B 3HVLA 3NSQA 2AX8A 3DR1A 5DK9A 3PBAA 4QK4A 1E3GA 2PITA 1FM6D 3O1DA 3GD2A 4ITEA 2P1UA 4G21A 4ZO1B 3AZ2A 5KRJA 5G42A 4PXMA 1NQ7A 3FS1A 1XQ3A 4MG8A 2ZVTA 3WTQA 1RKGA 3CS6A 4OZRE 5DYDA 1X7JA 3KWYA 1ZH7A 2GP7A 4PP5A 2GPVA 1XDKA 3QT0A 2EWPA 3L3XA 3OZ0A 1ZUCA 3ZRAA 4YPQA 1KNUA 3X1IA 2OVHA 2QPYA 3K8SA 1G1UA 3R29A 4RZEA 3VHVA 5JJMA 5L7GA 4IVYA 1M7WA 2B1ZA 2ZL9A 3L0EA 1RDTA 5DZ0A 3H0AA 5AYGA 3TKCA 1Q4XA 4G2IA 3B65A 2YJDA 2HAMA 5KRCA 4XUHA 1R20D 3IPSA 3JZBA 4IS8A 5E19A 4A2JA 4J5XC 5G3JA 3B0RA 4G20A 3W0AA 5DVSA 3PCUA 2H79A 4REEA 1QKMA 3NOAA 4ZO1X 2Q7IA 5C4TA 3Q95A 4WHFA 2IOGA 4LSJA 1FCZA 2ZMJA 5GIDA 3SZ1A 1Y9RA 2VV3A 4OZRU 5LGAA 2AWHA 1K74A 1XVPB 3VJHA 1SKXA 3X1HA 1S9QA 3G0WA 1YY4A 4RE8A 4RUPA 4IV2A 4DK7A 2YFEA 2HFPA 3ET1A 3HODA 4G1ZA 1EXXA 5DIEA 1XB7A 4ONIA 4QJRA 5DKSA 2HBHA 3A3ZX 2PIVA 3A9EA 4IW8A 3V49A 3V4AA 3W0HA 5DUEA 1I7IA 2OM9A 3HC6A 3AURA 4JYIA 3GYUA 4TV1A 1XP9A 5E0XA 4OEZA 3BC5A 2P7GA 3U9QA 4WQPA 4ZNSA 4IWFA 1DKFA 1R6GA 3VT8A 5DZ3A 3ADVA 2P1TA 5KRKA 5JY3A 3ADUA 3P0UA 2O4JA 1ZKYA 3NSPA 4FNEA 5KRFA 5KROA 4ZI1A 3R8IA 4MGCA 3RUUA 4OFRA 1YINA 3V9VA 3VHUA 3VTDA 1FM9A 5DZ1A 1WM0X 5C4SA 5DV8A 2OUZA 4MGDB 3VT9A 1GWRA 2PIRA 2PIPL 3HM1A 2NXXE 4Q13A 5DI7A 1ILHA 5DU5A 3UP0A 5IXKA 3TKMA 3AFRA 4JYGA 4WLBA 3OKIA 2AM9A 3B67A 2PNUA 3FURA 4PWLA 3ZR7A 3A2IA 4LBDA 4MGBB 3ZRBA 4HLWA 3UUDB 3P88A 1G2NA 5HJPA 1SR7A 1R1KD 4DK8A 5AWKA 4IQRA 2B50A 4X1FA 4NIEA 4ZN9A 3VT4A 3ADWA 4M8EA 3D57A 4OH5A 4X1GA 2V7CA 2HASA 2PIUA 3OMKA 4IWCA 3RVFA 3SP9A 3VJSA 5HYRA 2BJ4A 3PLZA 3DZYD 1N83A 3E94A 5DV6A 3UU7A 5KRAA 2ZNOA 3IXPA 3UVVB 3KYTA 5DKEA 2FSZA 2PINA 4OARA 3W0GA 2AX7A 5DMFA 1SJ0A 1TFCA 1X78A 3WMHA 5DWGA 1OSVA 2PRGA 1XIUA 2HCDA 2AMAA 1Z95A 1ZGYA 1P8DA 1RJKA 2Q7LA 2J7YA 4N73A 2HWQA 1NAVA 3KMGA 2E2RA 5DWEA 4J24A 1FCXA 1X7EA 5KD9A 2J7XA 3R2AA 4P6XA 3OMPA 1PZLA 3KMZA 4IA1A 1T73A 2ZK0A 2JFAB 2QZOB 2ZK6A 2HARA 3RLLA 3W5PA 1T63A 2GPPA 4JAZA 5B41A 4L98A 1L2IA 5AZVA 3FC6A 1ERRA 3RY9A 3W0JA 4NQAB 1G50A 2Q59A 4MGAA 5H1EA 2Q5GA 1N4HA 1YUCA 2P54A 4NUFA 3OSIA 4RMDA 5DL4A 3ILZA 1ZDUA 2QSEA 1KV6A 3T03A 2QXMA 2GPOA 3A40X 3FLIA 2PIOA 2QXSA 2P7AA 5KRMA 3L03A 4G1YA 1MZNA 5DXEA 3K23A 2AA5A 4IUIA 1U9EA 5GICA 4OHAA 4UDCA 5KRHA 5DIDA 3S9SA 3B66A 3W0CA 5IAWA 4XT9A 5DXBB 4RZFA 3KMRA 1NAXA 4ZNWA 3AX8A 4MDDA 5I4VA 5FQPA 5G44A 3D24A 5EJVA 1QKNA 4MG7B 5HZCA 5AAVB 1A28A 1S0XA 1XP6A 3B0WA 2AX9A 3CQVA 4LTWA 4RMCA 3GWSX 1YA3A 4XI3A 3MNPA 4CI4A 3UUAA 3OOKA 4OFUA 4MG6A 3VHWA 2QMVA 1UPVA 4Q0AC 5DKGA 5IZ0A 3G9EA 5DYBA 5DXQA 1GS4A 3IMYA 3WJ5A 2JJ3A 4A4VA 4OEAA 3V3EA 2BAWA 2R6YA 2Z4JA 5DX3B 5HJSA 4MG9B 3VI8A 4PP6A 1I7GA 5FQSA 3ADSA 2AMBA 5EITA 3CDSA 3L1BA 2Q7JA 2P7ZA 5ICKA 3TY0A 1FD0A 3VTBA 5HYKA 5KCDA 1NQ1A 3B0TA 3E00D 4J5XA 3B5RA 2Q5SA 3UUCA 4B7WA 2GPUA 5E15A 5DRJA 1XZXX 2VV4B 2XYXA 4OIUA 1XP1A 4EMAA 3N00A 5DVVA 4ZJRA 1M13A 4R2UA 1EREA 1XV9A 2NW4A 3CS4A 2QW4A 2Q61A 5DY8A 5AZTA 5FQRA 3VJIA 1S9PA 4KZMA 4PPPA 2P15A 2FAIA 1UHLA 1XAPA 3B0QA 3HO0A 3WT5A 4DQMA 3OLFA 1OT7A 5M96A 1YMTA 3GZ9A 1S19A 2PIQA 2Q7KA 3IA6A 2GL8A 3CWDA 1XQCA 4MG5A 4OKTA 2R40A 4S0TA 2NV7A 4EM9A 2G5OA 2OZ7A 1DB1A 3RUTA 5AAUA 3WT7A 4S14A 1UPWA 2ACLA 4RUOX 1ZEOA 1RK3A 4POJA 3WWRA 1XOWA 3MNEA 1T7MA 3LMPA 3MNOA 1E3KA 5LWPA 2IHQA 3PEQA 1X7RA 2A3IA 3W5TA 3DY6A 4IV4A 1PDUA 3OS8C 4MGBA 5EI1A 5KYJA 3DCTA 1R5KA 3A2HA 2OCFA 1VJBA 1M2ZA 5DUHA 2B1VA 3KFCA 4OZTE 3B68A 3W0IA 2POBA 1RDTD 1L2JA 3FUGA 3H0AD 4XUMA 2I4JA 5DSHA 4K7AA 3OGTA 2ZMIA 2ZY0A 4BCRA 5DVCA 3A9EB 4TUZA 2OAXA 4G2HA 2XYJA 2YLPA 4ZNUA 4A4WA 1YYEA 4DOSA 3WFGA 3K22A 3HC5A 2ZLCA 2QA6A 3OAPA 3L0JA 1BSXA 1T74A 4XLDA 4N1YA 2Q1VA 1A52A 2PKLA 4JL4A 1H9UA 2QABA 4J5WC 1DKFB 3FXVA 3ET2A 2G44A 3LBDA 2QR9A 1GWQA 4WPFA 5APHA 5KR9A 3DZUA 1K74D 1MV9A 4FN9A 1PK5A 3OLLA 4FHIA 1XNNA 1YOWA 1HG4A 3OMQA 4O8FA 1PRGA 1OSHA 4YNKA 3AZ3A 4IU7A 4OZTU 1NRLA 2JFAA 2QZOA 1PQ6A 2ABIA 3CTBA 3R5NA 2YHDA 1X76A 1YJEA 3ET3A 2ATHA 2VV1B 3HQ5A 1XLSA 2NPAA 3WJ4A 2P4YA 3ZQTA 3A78A 4CI5A 4N8RA 4OH6A 3TX7B 3V9YA 1IE8A 4UDBA 3L0LA 3HLVA 4DORA 5SYZA 4CSJA 1GWXA 1QKTA 1X7BA 4QE8A 1T65A 5KCEA 2ZASA 2Q8SA 4F9MA 3F5CA 4R6SA 3AUQA 4OJ4A 1KKQA 1T79A 1OVLB 3VRWA 3VN2A 2JF9A 2YLOA 1YOKA 4ZNTA 4WVDA 4NY9A 1I38A 1G5YA 2Q70A 2BJ4B 5DWLA 3UU7B 4DM6A 5DXBA 2O4RA 1FM9D 2QA8A 1R20A 3OZJA 5G43A 2YATA 3M7RA 2P1VA 3R5MA 4OLMA 3FALB 1FCYA 5DWJA 2QNVA 3L3ZA 5E14A 4PPSA 3VJTA 3VRTA 4G1DA 3VSPA 2ZNPA 1IE9A 5AVLA 2ZK3A 1NDEA 2XKWA 1K4WA 3GN8A 5DTVA 2ZK1A 4YT1A 2YJAB 5DXKA 3EYBA 5L11A 4JYHA 3VT3A 4XTAA 3VT7A 5DP0A 5DXGA 2B23A 2I0GA 2ZNQA 5APJA 2ZMHA 2ZK5A 5G5WA 1QKUA 2PJLA 2VV0A 3P89A 5G46A 1P93A 1XLSE 5DX3A 2G0GA 3AZ1A 2HC4A 1T7RA 2Q59B 2ZBSA 2QGWA 3IXPD 3V9TA 2GTKA 3A2JA 4E2JA 1T5ZA 3D5FA 4ZN7A 2AB2A 2AAXA 5DMCA 1ILGA 2ZK4A 2Q5PA 2VSRA 3OMOA 2H77A 5E7VA 2AXAA 5ETHA 5GIEA 4IA2A 1EXAA 5FQVA 3X31A 2VSTA 5DXMA 5DRMA 5G45A 3WT6A 3GWXA 1XPCA 5DIGA 2Q6SA 2QTUA 4UDDA 3JZCA 4REFA 4K6IA 1T7TA 4QL8A 2VV4A 5DZIA 4WHGA 5KCTA 3AUNA 1XVPA 4IA3A 4PVUA 5AK2A 4RMEA 3CDPA 5KRLA 2GIUA 4FGYA 4OKBA 5JI0D 4IA7A 2HWRA 4Q50A 2AYRA 1S0ZA 2Q1HA 3ADTA 3CJWA 3FEJA 4OIVA 4PLDA 2W8YA 3OMMA 2POGA 2ZXMA 2ZKCA 4MG8B 4APUA 5KYAA 4PRGA 3OS9A 3UUAB 1PQCA 1XNXA 2G0HA 3ERTA 1PCGA 5E1CA 1XDKB 3OOFA 5DWIA 1ZDTA 3WFFA 2QE4A 5JJMB 1R1KA 1ZAFA 2AA2A 2I0JA 4OKXA 5F9BA 4OILA 3KPZA 2NXXA 2ZFXA 4LNWA 2YLQA 5A86A 1U3RA 4OKWA 3DZYA 1K7LA 3R8AA 3D90A 2FVJA 2QH6A 4NB6A 5EHJA 1LBDA 2ZXNA 4PF3A 3K6PA 2AA6A 4MGDA 1U3QA 4QE6A 2VV2A 3Q95B 5HCVA 4IVWA 3GBKA 1T7FA 4DM8A 3AN4A
chains in the Genus database with same CATH topology
1RKHA 3AN3A 3V3QA 3RLJA 5DV3A 1XV9B 3UUDA 3WGPA 2I4PA 2Z4BA 3B3KA 5GT4A 4YMQA 1UHLB 3OS8A 4PP3A 5FQTA 3O1EA 2OVMA 4QM0A 4HEEX 5CJ6A 3ADXA 4XHDA 5APKA 5L7HA 2LBDA 1Y0XX 5KCFA 3IPQA 3UVVA 4XAOA 5DXRA 4S0SA 4POHA 1MVCA 1TXIA 4OGHA 1Y0SA 2ZLAA 3ET0A 2XHSA 3OSAA 4IW6A 4TV1B 4Y29A 5L7EA 5KCUA 2Q6JA 2J4AA 4OC7A 3X36A 3W5RA 3KDUA 1NQ2A 3P8XA 5ACCA 3D6DA 2ACLB 3W5QA 2XYWA 3H52A 5C4UA 3KDTA 3BQDA 1SQNA 2VV1A 5DXPA 5KCWA 4J5WA 2AO6A 4OJ9A 2J14A 5C4OA 4PLEA 1NHZA 2Q60A 1I37A 2REWA 2HVCA 2V0VA 3E7CA 2QGTA 1N46A 3F7DA 3OSWA 1XJ7A 2HB7A 5B5BA 3ERDA 4LNXA 4OJBA 1FM6A 3BEJA 1OVLA 2Q3YA 4M8HA 3IPUA 5KCCA 1YP0A 1U3SA 2R40D 4J26A 4S15A 2O9IA 1T76A 3PRGA 4TUZB 1NUOA 3VRVA 3DCUA 2HB8A 3GYTA 5HJPB 4ZNHA 2AX6A 4L96A 5E0WA 4ZOMA 4E4KA 4E4QA 1YIMA 3VRUA 2YLYA 3OKHA 3KBAA 1HJ1A 5DLRA 3FALA 3SP6A 5AWJA 3VSOA 4JGVA 4KZIA 2GWXA 3UP3A 4OEDA 4OK1A 4RZGA 5KRIA 4KZJA 4OEYA 4R06A 1FBYA 3OLSA 2AA7A 1NQ0A 2Q6RA 4RWVA 4UDAA 4ITFA 2R6WA 2F4BA 1LV2A 5DUGA 1Z5XE 4MG7A 3E00A 3DT3A 3VT6A 3PO9A 5DKBA 5AAVA 3CS8A 3VT5A 3G8OA 5AVIA 4K4JA 5EC9A 5DZHA 5K13A 2PIWA 2ZXZA 4RAKA 3CLDA 4P6WA 3G8IA 5EGVA 2ZK2A 2ZNNA 3F5CB 2IOKA 4FHHA 3FC6B 1NYXA 3HZFA 4RFWA 4RUJA 4MG9A 4DMAA 2PIXA 4MGAB 4ZNVA 1UOMA 3VTCA 4N5GA 4ZJWA 3DZUD 3FEIA 3R8DA 1PQ9A 1Z5XU 3B1MA 3W0YA 2I4ZA 2QA8B 3HVLA 3NSQA 2AX8A 3DR1A 5DK9A 3PBAA 4QK4A 1E3GA 2PITA 1FM6D 3O1DA 3GD2A 4ITEA 2P1UA 4G21A 4ZO1B 3AZ2A 5KRJA 5G42A 4PXMA 1NQ7A 3FS1A 1XQ3A 4MG8A 2ZVTA 3WTQA 1RKGA 3CS6A 4OZRE 5DYDA 1X7JA 3KWYA 1ZH7A 2GP7A 4PP5A 2GPVA 1XDKA 3QT0A 2EWPA 3L3XA 3OZ0A 1ZUCA 3ZRAA 4YPQA 1KNUA 3X1IA 2OVHA 2QPYA 3K8SA 1G1UA 3R29A 4RZEA 3VHVA 5JJMA 5L7GA 4IVYA 1M7WA 2B1ZA 2ZL9A 3L0EA 1RDTA 5DZ0A 3H0AA 5AYGA 3TKCA 1Q4XA 4G2IA 3B65A 2YJDA 2HAMA 5KRCA 4XUHA 1R20D 3IPSA 3JZBA 4IS8A 5E19A 4A2JA 4J5XC 5G3JA 3B0RA 4G20A 3W0AA 5DVSA 3PCUA 2H79A 4REEA 1QKMA 3NOAA 4ZO1X 2Q7IA 5C4TA 3Q95A 4WHFA 2IOGA 4LSJA 1FCZA 2ZMJA 5GIDA 3SZ1A 1Y9RA 2VV3A 4OZRU 5LGAA 2AWHA 1K74A 1XVPB 3VJHA 1SKXA 3X1HA 1S9QA 3G0WA 1YY4A 4RE8A 4RUPA 4IV2A 4DK7A 2YFEA 2HFPA 3ET1A 3HODA 4G1ZA 1EXXA 5DIEA 1XB7A 4ONIA 4QJRA 5DKSA 2HBHA 3A3ZX 2PIVA 3A9EA 4IW8A 3V49A 3V4AA 3W0HA 5DUEA 1I7IA 2OM9A 3HC6A 3AURA 4JYIA 3GYUA 4TV1A 1XP9A 5E0XA 4OEZA 3BC5A 2P7GA 3U9QA 4WQPA 4ZNSA 4IWFA 1DKFA 1R6GA 3VT8A 5DZ3A 3ADVA 2P1TA 5KRKA 5JY3A 3ADUA 3P0UA 2O4JA 1ZKYA 3NSPA 4FNEA 5KRFA 5KROA 4ZI1A 3R8IA 4MGCA 3RUUA 4OFRA 1YINA 3V9VA 3VHUA 3VTDA 1FM9A 5DZ1A 1WM0X 5C4SA 5DV8A 2OUZA 4MGDB 3VT9A 1GWRA 2PIRA 2PIPL 3HM1A 2NXXE 4Q13A 5DI7A 1ILHA 5DU5A 3UP0A 5IXKA 3TKMA 3AFRA 4JYGA 4WLBA 3OKIA 2AM9A 3B67A 2PNUA 3FURA 4PWLA 3ZR7A 3A2IA 4LBDA 4MGBB 3ZRBA 4HLWA 3UUDB 3P88A 1G2NA 5HJPA 1SR7A 1R1KD 4DK8A 5AWKA 4IQRA 2B50A 4X1FA 4NIEA 4ZN9A 3VT4A 3ADWA 4M8EA 3D57A 4OH5A 4X1GA 2V7CA 2HASA 2PIUA 3OMKA 4IWCA 3RVFA 3SP9A 3VJSA 5HYRA 2BJ4A 3PLZA 3DZYD 1N83A 3E94A 5DV6A 3UU7A 5KRAA 2ZNOA 3IXPA 3UVVB 3KYTA 5DKEA 2FSZA 2PINA 4OARA 3W0GA 2AX7A 5DMFA 1SJ0A 1TFCA 1X78A 3WMHA 5DWGA 1OSVA 2PRGA 1XIUA 2HCDA 2AMAA 1Z95A 1ZGYA 1P8DA 1RJKA 2Q7LA 2J7YA 4N73A 2HWQA 1NAVA 3KMGA 2E2RA 5DWEA 4J24A 1FCXA 1X7EA 5KD9A 2J7XA 3R2AA 4P6XA 3OMPA 1PZLA 3KMZA 4IA1A 1T73A 2ZK0A 2JFAB 2QZOB 2ZK6A 2HARA 3RLLA 3W5PA 1T63A 2GPPA 4JAZA 5B41A 4L98A 1L2IA 5AZVA 3FC6A 1ERRA 3RY9A 3W0JA 4NQAB 1G50A 2Q59A 4MGAA 5H1EA 2Q5GA 1N4HA 1YUCA 2P54A 4NUFA 3OSIA 4RMDA 5DL4A 3ILZA 1ZDUA 2QSEA 1KV6A 3T03A 2QXMA 2GPOA 3A40X 3FLIA 2PIOA 2QXSA 2P7AA 5KRMA 3L03A 4G1YA 1MZNA 5DXEA 3K23A 2AA5A 4IUIA 1U9EA 5GICA 4OHAA 4UDCA 5KRHA 5DIDA 3S9SA 3B66A 3W0CA 5IAWA 4XT9A 5DXBB 4RZFA 3KMRA 1NAXA 4ZNWA 3AX8A 4MDDA 5I4VA 5FQPA 5G44A 3D24A 5EJVA 1QKNA 4MG7B 5HZCA 5AAVB 1A28A 1S0XA 1XP6A 3B0WA 2AX9A 3CQVA 4LTWA 4RMCA 3GWSX 1YA3A 4XI3A 3MNPA 4CI4A 3UUAA 3OOKA 4OFUA 4MG6A 3VHWA 2QMVA 1UPVA 4Q0AC 5DKGA 5IZ0A 3G9EA 5DYBA 5DXQA 1GS4A 3IMYA 3WJ5A 2JJ3A 4A4VA 4OEAA 3V3EA 2BAWA 2R6YA 2Z4JA 5DX3B 5HJSA 4MG9B 3VI8A 4PP6A 1I7GA 5FQSA 3ADSA 2AMBA 5EITA 3CDSA 3L1BA 2Q7JA 2P7ZA 5ICKA 3TY0A 1FD0A 3VTBA 5HYKA 5KCDA 1NQ1A 3B0TA 3E00D 4J5XA 3B5RA 2Q5SA 3UUCA 4B7WA 2GPUA 5E15A 5DRJA 1XZXX 2VV4B 2XYXA 4OIUA 1XP1A 4EMAA 3N00A 5DVVA 4ZJRA 1M13A 4R2UA 1EREA 1XV9A 2NW4A 3CS4A 2QW4A 2Q61A 5DY8A 5AZTA 5FQRA 3VJIA 1S9PA 4KZMA 4PPPA 2P15A 2FAIA 1UHLA 1XAPA 3B0QA 3HO0A 3WT5A 4DQMA 3OLFA 1OT7A 5M96A 1YMTA 3GZ9A 1S19A 2PIQA 2Q7KA 3IA6A 2GL8A 3CWDA 1XQCA 4MG5A 4OKTA 2R40A 4S0TA 2NV7A 4EM9A 2G5OA 2OZ7A 1DB1A 3RUTA 5AAUA 3WT7A 4S14A 1UPWA 2ACLA 4RUOX 1ZEOA 1RK3A 4POJA 3WWRA 1XOWA 3MNEA 1T7MA 3LMPA 3MNOA 1E3KA 5LWPA 2IHQA 3PEQA 1X7RA 2A3IA 3W5TA 3DY6A 4IV4A 1PDUA 3OS8C 4MGBA 5EI1A 5KYJA 3DCTA 1R5KA 3A2HA 2OCFA 1VJBA 1M2ZA 5DUHA 2B1VA 3KFCA 4OZTE 3B68A 3W0IA 2POBA 1RDTD 1L2JA 3FUGA 3H0AD 4XUMA 2I4JA 5DSHA 4K7AA 3OGTA 2ZMIA 2ZY0A 4BCRA 5DVCA 3A9EB 4TUZA 2OAXA 4G2HA 2XYJA 2YLPA 4ZNUA 4A4WA 1YYEA 4DOSA 3WFGA 3K22A 3HC5A 2ZLCA 2QA6A 3OAPA 3L0JA 1BSXA 1T74A 4XLDA 4N1YA 2Q1VA 1A52A 2PKLA 4JL4A 1H9UA 2QABA 4J5WC 1DKFB 3FXVA 3ET2A 2G44A 3LBDA 2QR9A 1GWQA 4WPFA 5APHA 5KR9A 3DZUA 1K74D 1MV9A 4FN9A 1PK5A 3OLLA 4FHIA 1XNNA 1YOWA 1HG4A 3OMQA 4O8FA 1PRGA 1OSHA 4YNKA 3AZ3A 4IU7A 4OZTU 1NRLA 2JFAA 2QZOA 1PQ6A 2ABIA 3CTBA 3R5NA 2YHDA 1X76A 1YJEA 3ET3A 2ATHA 2VV1B 3HQ5A 1XLSA 2NPAA 3WJ4A 2P4YA 3ZQTA 3A78A 4CI5A 4N8RA 4OH6A 3TX7B 3V9YA 1IE8A 4UDBA 3L0LA 3HLVA 4DORA 5SYZA 4CSJA 1GWXA 1QKTA 1X7BA 4QE8A 1T65A 5KCEA 2ZASA 2Q8SA 4F9MA 3F5CA 4R6SA 3AUQA 4OJ4A 1KKQA 1T79A 1OVLB 3VRWA 3VN2A 2JF9A 2YLOA 1YOKA 4ZNTA 4WVDA 4NY9A 1I38A 1G5YA 2Q70A 2BJ4B 5DWLA 3UU7B 4DM6A 5DXBA 2O4RA 1FM9D 2QA8A 1R20A 3OZJA 5G43A 2YATA 3M7RA 2P1VA 3R5MA 4OLMA 3FALB 1FCYA 5DWJA 2QNVA 3L3ZA 5E14A 4PPSA 3VJTA 3VRTA 4G1DA 3VSPA 2ZNPA 1IE9A 5AVLA 2ZK3A 1NDEA 2XKWA 1K4WA 3GN8A 5DTVA 2ZK1A 4YT1A 2YJAB 5DXKA 3EYBA 5L11A 4JYHA 3VT3A 4XTAA 3VT7A 5DP0A 5DXGA 2B23A 2I0GA 2ZNQA 5APJA 2ZMHA 2ZK5A 5G5WA 1QKUA 2PJLA 2VV0A 3P89A 5G46A 1P93A 1XLSE 5DX3A 2G0GA 3AZ1A 2HC4A 1T7RA 2Q59B 2ZBSA 2QGWA 3IXPD 3V9TA 2GTKA 3A2JA 4E2JA 1T5ZA 3D5FA 4ZN7A 2AB2A 2AAXA 5DMCA 1ILGA 2ZK4A 2Q5PA 2VSRA 3OMOA 2H77A 5E7VA 2AXAA 5ETHA 5GIEA 4IA2A 1EXAA 5FQVA 3X31A 2VSTA 5DXMA 5DRMA 5G45A 3WT6A 3GWXA 1XPCA 5DIGA 2Q6SA 2QTUA 4UDDA 3JZCA 4REFA 4K6IA 1T7TA 4QL8A 2VV4A 5DZIA 4WHGA 5KCTA 3AUNA 1XVPA 4IA3A 4PVUA 5AK2A 4RMEA 3CDPA 5KRLA 2GIUA 4FGYA 4OKBA 5JI0D 4IA7A 2HWRA 4Q50A 2AYRA 1S0ZA 2Q1HA 3ADTA 3CJWA 3FEJA 4OIVA 4PLDA 2W8YA 3OMMA 2POGA 2ZXMA 2ZKCA 4MG8B 4APUA 5KYAA 4PRGA 3OS9A 3UUAB 1PQCA 1XNXA 2G0HA 3ERTA 1PCGA 5E1CA 1XDKB 3OOFA 5DWIA 1ZDTA 3WFFA 2QE4A 5JJMB 1R1KA 1ZAFA 2AA2A 2I0JA 4OKXA 5F9BA 4OILA 3KPZA 2NXXA 2ZFXA 4LNWA 2YLQA 5A86A 1U3RA 4OKWA 3DZYA 1K7LA 3R8AA 3D90A 2FVJA 2QH6A 4NB6A 5EHJA 1LBDA 2ZXNA 4PF3A 3K6PA 2AA6A 4MGDA 1U3QA 4QE6A 2VV2A 3Q95B 5HCVA 4IVWA 3GBKA 1T7FA 4DM8A 3AN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKH A;  3AN3 A;  3V3Q A;  3RLJ A;  5DV3 A;  1XV9 B;  3UUD A;  3WGP A;  2I4P A;  2Z4B A;  3B3K A;  5GT4 A;  4YMQ A;  1UHL B;  3OS8 A;  4PP3 A;  5FQT A;  3O1E A;  2OVM A;  4QM0 A;  4HEE X;  5CJ6 A;  3ADX A;  4XHD A;  5APK A;  5L7H A;  2LBD A;  1Y0X X;  5KCF A;  3IPQ A;  3UVV A;  4XAO A;  5DXR A;  4S0S A;  4POH A;  1MVC A;  1TXI A;  4OGH A;  1Y0S A;  2ZLA A;  3ET0 A;  2XHS A;  3OSA A;  4IW6 A;  4TV1 B;  4Y29 A;  5L7E A;  5KCU A;  2Q6J A;  2J4A A;  4OC7 A;  3X36 A;  3W5R A;  3KDU A;  1NQ2 A;  3P8X A;  5ACC A;  3D6D A;  2ACL B;  3W5Q A;  2XYW A;  3H52 A;  5C4U A;  3KDT A;  3BQD A;  1SQN A;  2VV1 A;  5DXP A;  5KCW A;  4J5W A;  2AO6 A;  4OJ9 A;  2J14 A;  5C4O A;  4PLE A;  1NHZ A;  2Q60 A;  1I37 A;  2REW A;  2HVC A;  2V0V A;  3E7C A;  2QGT A;  1N46 A;  3F7D A;  3OSW A;  1XJ7 A;  2HB7 A;  5B5B A;  3ERD A;  4LNX A;  4OJB A;  1FM6 A;  3BEJ A;  1OVL A;  2Q3Y A;  4M8H A;  3IPU A;  5KCC A;  1YP0 A;  1U3S A;  2R40 D;  4J26 A;  4S15 A;  2O9I A;  1T76 A;  3PRG A;  4TUZ B;  1NUO A;  3VRV A;  3DCU A;  2HB8 A;  3GYT A;  5HJP B;  4ZNH A;  2AX6 A;  4L96 A;  5E0W A;  4ZOM A;  4E4K A;  4E4Q A;  1YIM A;  3VRU A;  2YLY A;  3OKH A;  3KBA A;  1HJ1 A;  5DLR A;  3FAL A;  3SP6 A;  5AWJ A;  3VSO A;  4JGV A;  4KZI A;  2GWX A;  3UP3 A;  4OED A;  4OK1 A;  4RZG A;  5KRI A;  4KZJ A;  4OEY A;  4R06 A;  1FBY A;  3OLS A;  2AA7 A;  1NQ0 A;  2Q6R A;  4RWV A;  4UDA A;  4ITF A;  2R6W A;  2F4B A;  1LV2 A;  5DUG A;  1Z5X E;  4MG7 A;  3E00 A;  3DT3 A;  3VT6 A;  3PO9 A;  5DKB A;  5AAV A;  3CS8 A;  3VT5 A;  3G8O A;  5AVI A;  4K4J A;  5EC9 A;  5DZH A;  5K13 A;  2PIW A;  2ZXZ A;  4RAK A;  3CLD A;  4P6W A;  3G8I A;  5EGV A;  2ZK2 A;  2ZNN A;  3F5C B;  2IOK A;  4FHH A;  3FC6 B;  1NYX A;  3HZF A;  4RFW A;  4RUJ A;  4MG9 A;  4DMA A;  2PIX A;  4MGA B;  4ZNV A;  1UOM A;  3VTC A;  4N5G A;  4ZJW A;  3DZU D;  3FEI A;  3R8D A;  1PQ9 A;  1Z5X U;  3B1M A;  3W0Y A;  2I4Z A;  2QA8 B;  3HVL A;  3NSQ A;  2AX8 A;  3DR1 A;  5DK9 A;  3PBA A;  4QK4 A;  1E3G A;  2PIT A;  1FM6 D;  3O1D A;  3GD2 A;  4ITE A;  2P1U A;  4G21 A;  4ZO1 B;  3AZ2 A;  5KRJ A;  5G42 A;  4PXM A;  1NQ7 A;  3FS1 A;  1XQ3 A;  4MG8 A;  2ZVT A;  3WTQ A;  1RKG A;  3CS6 A;  4OZR E;  5DYD A;  1X7J A;  3KWY A;  1ZH7 A;  2GP7 A;  4PP5 A;  2GPV A;  1XDK A;  3QT0 A;  2EWP A;  3L3X A;  3OZ0 A;  1ZUC A;  3ZRA A;  4YPQ A;  1KNU A;  3X1I A;  2OVH A;  2QPY A;  3K8S A;  1G1U A;  3R29 A;  4RZE A;  3VHV A;  5JJM A;  5L7G A;  4IVY A;  1M7W A;  2B1Z A;  2ZL9 A;  3L0E A;  1RDT A;  5DZ0 A;  3H0A A;  5AYG A;  3TKC A;  1Q4X A;  4G2I A;  3B65 A;  2YJD A;  2HAM A;  5KRC A;  4XUH A;  1R20 D;  3IPS A;  3JZB A;  4IS8 A;  5E19 A;  4A2J A;  4J5X C;  5G3J A;  3B0R A;  4G20 A;  3W0A A;  5DVS A;  3PCU A;  2H79 A;  4REE A;  1QKM A;  3NOA A;  4ZO1 X;  2Q7I A;  5C4T A;  3Q95 A;  4WHF A;  2IOG A;  4LSJ A;  1FCZ A;  2ZMJ A;  5GID A;  3SZ1 A;  1Y9R A;  2VV3 A;  4OZR U;  5LGA A;  2AWH A;  1K74 A;  1XVP B;  3VJH A;  1SKX A;  3X1H A;  1S9Q A;  3G0W A;  1YY4 A;  4RE8 A;  4RUP A;  4IV2 A;  4DK7 A;  2YFE A;  2HFP A;  3ET1 A;  3HOD A;  4G1Z A;  1EXX A;  5DIE A;  1XB7 A;  4ONI A;  4QJR A;  5DKS A;  2HBH A;  3A3Z X;  2PIV A;  3A9E A;  4IW8 A;  3V49 A;  3V4A A;  3W0H A;  5DUE A;  1I7I A;  2OM9 A;  3HC6 A;  3AUR A;  4JYI A;  3GYU A;  4TV1 A;  1XP9 A;  5E0X A;  4OEZ A;  3BC5 A;  2P7G A;  3U9Q A;  4WQP A;  4ZNS A;  4IWF A;  1DKF A;  1R6G A;  3VT8 A;  5DZ3 A;  3ADV A;  2P1T A;  5KRK A;  5JY3 A;  3ADU A;  3P0U A;  2O4J A;  1ZKY A;  3NSP A;  4FNE A;  5KRF A;  5KRO A;  4ZI1 A;  3R8I A;  4MGC A;  3RUU A;  4OFR A;  1YIN A;  3V9V A;  3VHU A;  3VTD A;  1FM9 A;  5DZ1 A;  1WM0 X;  5C4S A;  5DV8 A;  2OUZ A;  4MGD B;  3VT9 A;  1GWR A;  2PIR A;  2PIP L;  3HM1 A;  2NXX E;  4Q13 A;  5DI7 A;  1ILH A;  5DU5 A;  3UP0 A;  5IXK A;  3TKM A;  3AFR A;  4JYG A;  4WLB A;  3OKI A;  2AM9 A;  3B67 A;  2PNU A;  3FUR A;  4PWL A;  3ZR7 A;  3A2I A;  4LBD A;  4MGB B;  3ZRB A;  4HLW A;  3UUD B;  3P88 A;  1G2N A;  5HJP A;  1SR7 A;  1R1K D;  4DK8 A;  5AWK A;  4IQR A;  2B50 A;  4X1F A;  4NIE A;  4ZN9 A;  3VT4 A;  3ADW A;  4M8E A;  3D57 A;  4OH5 A;  4X1G A;  2V7C A;  2HAS A;  2PIU A;  3OMK A;  4IWC A;  3RVF A;  3SP9 A;  3VJS A;  5HYR A;  2BJ4 A;  3PLZ A;  3DZY D;  1N83 A;  3E94 A;  5DV6 A;  3UU7 A;  5KRA A;  2ZNO A;  3IXP A;  3UVV B;  3KYT A;  5DKE A;  2FSZ A;  2PIN A;  4OAR A;  3W0G A;  2AX7 A;  5DMF A;  1SJ0 A;  1TFC A;  1X78 A;  3WMH A;  5DWG A;  1OSV A;  2PRG A;  1XIU A;  2HCD A;  2AMA A;  1Z95 A;  1ZGY A;  1P8D A;  1RJK A;  2Q7L A;  2J7Y A;  4N73 A;  2HWQ A;  1NAV A;  3KMG A;  2E2R A;  5DWE A;  4J24 A;  1FCX A;  1X7E A;  5KD9 A;  2J7X A;  3R2A A;  4P6X A;  3OMP A;  1PZL A;  3KMZ A;  4IA1 A;  1T73 A;  2ZK0 A;  2JFA B;  2QZO B;  2ZK6 A;  2HAR A;  3RLL A;  3W5P A;  1T63 A;  2GPP A;  4JAZ A;  5B41 A;  4L98 A;  1L2I A;  5AZV A;  3FC6 A;  1ERR A;  3RY9 A;  3W0J A;  4NQA B;  1G50 A;  2Q59 A;  4MGA A;  5H1E A;  2Q5G A;  1N4H A;  1YUC A;  2P54 A;  4NUF A;  3OSI A;  4RMD A;  5DL4 A;  3ILZ A;  1ZDU A;  2QSE A;  1KV6 A;  3T03 A;  2QXM A;  2GPO A;  3A40 X;  3FLI A;  2PIO A;  2QXS A;  2P7A A;  5KRM A;  3L03 A;  4G1Y A;  1MZN A;  5DXE A;  3K23 A;  2AA5 A;  4IUI A;  1U9E A;  5GIC A;  4OHA A;  4UDC A;  5KRH A;  5DID A;  3S9S A;  3B66 A;  3W0C A;  5IAW A;  4XT9 A;  5DXB B;  4RZF A;  3KMR A;  1NAX A;  4ZNW A;  3AX8 A;  4MDD A;  5I4V A;  5FQP A;  5G44 A;  3D24 A;  5EJV A;  1QKN A;  4MG7 B;  5HZC A;  5AAV B;  1A28 A;  1S0X A;  1XP6 A;  3B0W A;  2AX9 A;  3CQV A;  4LTW A;  4RMC A;  3GWS X;  1YA3 A;  4XI3 A;  3MNP A;  4CI4 A;  3UUA A;  3OOK A;  4OFU A;  4MG6 A;  3VHW A;  2QMV A;  1UPV A;  4Q0A C;  5DKG A;  5IZ0 A;  3G9E A;  5DYB A;  5DXQ A;  1GS4 A;  3IMY A;  3WJ5 A;  2JJ3 A;  4A4V A;  4OEA A;  3V3E A;  2BAW A;  2R6Y A;  2Z4J A;  5DX3 B;  5HJS A;  4MG9 B;  3VI8 A;  4PP6 A;  1I7G A;  5FQS A;  3ADS A;  2AMB A;  5EIT A;  3CDS A;  3L1B A;  2Q7J A;  2P7Z A;  5ICK A;  3TY0 A;  1FD0 A;  3VTB A;  5HYK A;  5KCD A;  1NQ1 A;  3B0T A;  3E00 D;  4J5X A;  3B5R A;  2Q5S A;  3UUC A;  4B7W A;  2GPU A;  5E15 A;  5DRJ A;  1XZX X;  2VV4 B;  2XYX A;  4OIU A;  1XP1 A;  4EMA A;  3N00 A;  5DVV A;  4ZJR A;  1M13 A;  4R2U A;  1ERE A;  1XV9 A;  2NW4 A;  3CS4 A;  2QW4 A;  2Q61 A;  5DY8 A;  5AZT A;  5FQR A;  3VJI A;  1S9P A;  4KZM A;  4PPP A;  2P15 A;  2FAI A;  1UHL A;  1XAP A;  3B0Q A;  3HO0 A;  3WT5 A;  4DQM A;  3OLF A;  1OT7 A;  5M96 A;  1YMT A;  3GZ9 A;  1S19 A;  2PIQ A;  2Q7K A;  3IA6 A;  2GL8 A;  3CWD A;  1XQC A;  4MG5 A;  4OKT A;  2R40 A;  4S0T A;  2NV7 A;  4EM9 A;  2G5O A;  2OZ7 A;  1DB1 A;  3RUT A;  5AAU A;  3WT7 A;  4S14 A;  1UPW A;  2ACL A;  4RUO X;  1ZEO A;  1RK3 A;  4POJ A;  3WWR A;  1XOW A;  3MNE A;  1T7M A;  3LMP A;  3MNO A;  1E3K A;  5LWP A;  2IHQ A;  3PEQ A;  1X7R A;  2A3I A;  3W5T A;  3DY6 A;  4IV4 A;  1PDU A;  3OS8 C;  4MGB A;  5EI1 A;  5KYJ A;  3DCT A;  1R5K A;  3A2H A;  2OCF A;  1VJB A;  1M2Z A;  5DUH A;  2B1V A;  3KFC A;  4OZT E;  3B68 A;  3W0I A;  2POB A;  1RDT D;  1L2J A;  3FUG A;  3H0A D;  4XUM A;  2I4J A;  5DSH A;  4K7A A;  3OGT A;  2ZMI A;  2ZY0 A;  4BCR A;  5DVC A;  3A9E B;  4TUZ A;  2OAX A;  4G2H A;  2XYJ A;  2YLP A;  4ZNU A;  4A4W A;  1YYE A;  4DOS A;  3WFG A;  3K22 A;  3HC5 A;  2ZLC A;  2QA6 A;  3OAP A;  3L0J A;  1BSX A;  1T74 A;  4XLD A;  4N1Y A;  2Q1V A;  1A52 A;  2PKL A;  4JL4 A;  1H9U A;  2QAB A;  4J5W C;  1DKF B;  3FXV A;  3ET2 A;  2G44 A;  3LBD A;  2QR9 A;  1GWQ A;  4WPF A;  5APH A;  5KR9 A;  3DZU A;  1K74 D;  1MV9 A;  4FN9 A;  1PK5 A;  3OLL A;  4FHI A;  1XNN A;  1YOW A;  1HG4 A;  3OMQ A;  4O8F A;  1PRG A;  1OSH A;  4YNK A;  3AZ3 A;  4IU7 A;  4OZT U;  1NRL A;  2JFA A;  2QZO A;  1PQ6 A;  2ABI A;  3CTB A;  3R5N A;  2YHD A;  1X76 A;  1YJE A;  3ET3 A;  2ATH A;  2VV1 B;  3HQ5 A;  1XLS A;  2NPA A;  3WJ4 A;  2P4Y A;  3ZQT A;  3A78 A;  4CI5 A;  4N8R A;  4OH6 A;  3TX7 B;  3V9Y A;  1IE8 A;  4UDB A;  3L0L A;  3HLV A;  4DOR A;  5SYZ A;  4CSJ A;  1GWX A;  1QKT A;  1X7B A;  4QE8 A;  1T65 A;  5KCE A;  2ZAS A;  2Q8S A;  4F9M A;  3F5C A;  4R6S A;  3AUQ A;  4OJ4 A;  1KKQ A;  1T79 A;  1OVL B;  3VRW A;  3VN2 A;  2JF9 A;  2YLO A;  1YOK A;  4ZNT A;  4WVD A;  4NY9 A;  1I38 A;  1G5Y A;  2Q70 A;  2BJ4 B;  5DWL A;  3UU7 B;  4DM6 A;  5DXB A;  2O4R A;  1FM9 D;  2QA8 A;  1R20 A;  3OZJ A;  5G43 A;  2YAT A;  3M7R A;  2P1V A;  3R5M A;  4OLM A;  3FAL B;  1FCY A;  5DWJ A;  2QNV A;  3L3Z A;  5E14 A;  4PPS A;  3VJT A;  3VRT A;  4G1D A;  3VSP A;  2ZNP A;  1IE9 A;  5AVL A;  2ZK3 A;  1NDE A;  2XKW A;  1K4W A;  3GN8 A;  5DTV A;  2ZK1 A;  4YT1 A;  2YJA B;  5DXK A;  3EYB A;  5L11 A;  4JYH A;  3VT3 A;  4XTA A;  3VT7 A;  5DP0 A;  5DXG A;  2B23 A;  2I0G A;  2ZNQ A;  5APJ A;  2ZMH A;  2ZK5 A;  5G5W A;  1QKU A;  2PJL A;  2VV0 A;  3P89 A;  5G46 A;  1P93 A;  1XLS E;  5DX3 A;  2G0G A;  3AZ1 A;  2HC4 A;  1T7R A;  2Q59 B;  2ZBS A;  2QGW A;  3IXP D;  3V9T A;  2GTK A;  3A2J A;  4E2J A;  1T5Z A;  3D5F A;  4ZN7 A;  2AB2 A;  2AAX A;  5DMC A;  1ILG A;  2ZK4 A;  2Q5P A;  2VSR A;  3OMO A;  2H77 A;  5E7V A;  2AXA A;  5ETH A;  5GIE A;  4IA2 A;  1EXA A;  5FQV A;  3X31 A;  2VST A;  5DXM A;  5DRM A;  5G45 A;  3WT6 A;  3GWX A;  1XPC A;  5DIG A;  2Q6S A;  2QTU A;  4UDD A;  3JZC A;  4REF A;  4K6I A;  1T7T A;  4QL8 A;  2VV4 A;  5DZI A;  4WHG A;  5KCT A;  3AUN A;  1XVP A;  4IA3 A;  4PVU A;  5AK2 A;  4RME A;  3CDP A;  5KRL A;  2GIU A;  4FGY A;  4OKB A;  5JI0 D;  4IA7 A;  2HWR A;  4Q50 A;  2AYR A;  1S0Z A;  2Q1H A;  3ADT A;  3CJW A;  3FEJ A;  4OIV A;  4PLD A;  2W8Y A;  3OMM A;  2POG A;  2ZXM A;  2ZKC A;  4MG8 B;  4APU A;  5KYA A;  4PRG A;  3OS9 A;  3UUA B;  1PQC A;  1XNX A;  2G0H A;  3ERT A;  1PCG A;  5E1C A;  1XDK B;  3OOF A;  5DWI A;  1ZDT A;  3WFF A;  2QE4 A;  5JJM B;  1R1K A;  1ZAF A;  2AA2 A;  2I0J A;  4OKX A;  5F9B A;  4OIL A;  3KPZ A;  2NXX A;  2ZFX A;  4LNW A;  2YLQ A;  5A86 A;  1U3R A;  4OKW A;  3DZY A;  1K7L A;  3R8A A;  3D90 A;  2FVJ A;  2QH6 A;  4NB6 A;  5EHJ A;  1LBD A;  2ZXN A;  4PF3 A;  3K6P A;  2AA6 A;  4MGD A;  1U3Q A;  4QE6 A;  2VV2 A;  3Q95 B;  5HCV A;  4IVW A;  3GBK A;  1T7F A;  4DM8 A;  3AN4 A; 
#chains in the Genus database with same CATH topology
 1RKH A;  3AN3 A;  3V3Q A;  3RLJ A;  5DV3 A;  1XV9 B;  3UUD A;  3WGP A;  2I4P A;  2Z4B A;  3B3K A;  5GT4 A;  4YMQ A;  1UHL B;  3OS8 A;  4PP3 A;  5FQT A;  3O1E A;  2OVM A;  4QM0 A;  4HEE X;  5CJ6 A;  3ADX A;  4XHD A;  5APK A;  5L7H A;  2LBD A;  1Y0X X;  5KCF A;  3IPQ A;  3UVV A;  4XAO A;  5DXR A;  4S0S A;  4POH A;  1MVC A;  1TXI A;  4OGH A;  1Y0S A;  2ZLA A;  3ET0 A;  2XHS A;  3OSA A;  4IW6 A;  4TV1 B;  4Y29 A;  5L7E A;  5KCU A;  2Q6J A;  2J4A A;  4OC7 A;  3X36 A;  3W5R A;  3KDU A;  1NQ2 A;  3P8X A;  5ACC A;  3D6D A;  2ACL B;  3W5Q A;  2XYW A;  3H52 A;  5C4U A;  3KDT A;  3BQD A;  1SQN A;  2VV1 A;  5DXP A;  5KCW A;  4J5W A;  2AO6 A;  4OJ9 A;  2J14 A;  5C4O A;  4PLE A;  1NHZ A;  2Q60 A;  1I37 A;  2REW A;  2HVC A;  2V0V A;  3E7C A;  2QGT A;  1N46 A;  3F7D A;  3OSW A;  1XJ7 A;  2HB7 A;  5B5B A;  3ERD A;  4LNX A;  4OJB A;  1FM6 A;  3BEJ A;  1OVL A;  2Q3Y A;  4M8H A;  3IPU A;  5KCC A;  1YP0 A;  1U3S A;  2R40 D;  4J26 A;  4S15 A;  2O9I A;  1T76 A;  3PRG A;  4TUZ B;  1NUO A;  3VRV A;  3DCU A;  2HB8 A;  3GYT A;  5HJP B;  4ZNH A;  2AX6 A;  4L96 A;  5E0W A;  4ZOM A;  4E4K A;  4E4Q A;  1YIM A;  3VRU A;  2YLY A;  3OKH A;  3KBA A;  1HJ1 A;  5DLR A;  3FAL A;  3SP6 A;  5AWJ A;  3VSO A;  4JGV A;  4KZI A;  2GWX A;  3UP3 A;  4OED A;  4OK1 A;  4RZG A;  5KRI A;  4KZJ A;  4OEY A;  4R06 A;  1FBY A;  3OLS A;  2AA7 A;  1NQ0 A;  2Q6R A;  4RWV A;  4UDA A;  4ITF A;  2R6W A;  2F4B A;  1LV2 A;  5DUG A;  1Z5X E;  4MG7 A;  3E00 A;  3DT3 A;  3VT6 A;  3PO9 A;  5DKB A;  5AAV A;  3CS8 A;  3VT5 A;  3G8O A;  5AVI A;  4K4J A;  5EC9 A;  5DZH A;  5K13 A;  2PIW A;  2ZXZ A;  4RAK A;  3CLD A;  4P6W A;  3G8I A;  5EGV A;  2ZK2 A;  2ZNN A;  3F5C B;  2IOK A;  4FHH A;  3FC6 B;  1NYX A;  3HZF A;  4RFW A;  4RUJ A;  4MG9 A;  4DMA A;  2PIX A;  4MGA B;  4ZNV A;  1UOM A;  3VTC A;  4N5G A;  4ZJW A;  3DZU D;  3FEI A;  3R8D A;  1PQ9 A;  1Z5X U;  3B1M A;  3W0Y A;  2I4Z A;  2QA8 B;  3HVL A;  3NSQ A;  2AX8 A;  3DR1 A;  5DK9 A;  3PBA A;  4QK4 A;  1E3G A;  2PIT A;  1FM6 D;  3O1D A;  3GD2 A;  4ITE A;  2P1U A;  4G21 A;  4ZO1 B;  3AZ2 A;  5KRJ A;  5G42 A;  4PXM A;  1NQ7 A;  3FS1 A;  1XQ3 A;  4MG8 A;  2ZVT A;  3WTQ A;  1RKG A;  3CS6 A;  4OZR E;  5DYD A;  1X7J A;  3KWY A;  1ZH7 A;  2GP7 A;  4PP5 A;  2GPV A;  1XDK A;  3QT0 A;  2EWP A;  3L3X A;  3OZ0 A;  1ZUC A;  3ZRA A;  4YPQ A;  1KNU A;  3X1I A;  2OVH A;  2QPY A;  3K8S A;  1G1U A;  3R29 A;  4RZE A;  3VHV A;  5JJM A;  5L7G A;  4IVY A;  1M7W A;  2B1Z A;  2ZL9 A;  3L0E A;  1RDT A;  5DZ0 A;  3H0A A;  5AYG A;  3TKC A;  1Q4X A;  4G2I A;  3B65 A;  2YJD A;  2HAM A;  5KRC A;  4XUH A;  1R20 D;  3IPS A;  3JZB A;  4IS8 A;  5E19 A;  4A2J A;  4J5X C;  5G3J A;  3B0R A;  4G20 A;  3W0A A;  5DVS A;  3PCU A;  2H79 A;  4REE A;  1QKM A;  3NOA A;  4ZO1 X;  2Q7I A;  5C4T A;  3Q95 A;  4WHF A;  2IOG A;  4LSJ A;  1FCZ A;  2ZMJ A;  5GID A;  3SZ1 A;  1Y9R A;  2VV3 A;  4OZR U;  5LGA A;  2AWH A;  1K74 A;  1XVP B;  3VJH A;  1SKX A;  3X1H A;  1S9Q A;  3G0W A;  1YY4 A;  4RE8 A;  4RUP A;  4IV2 A;  4DK7 A;  2YFE A;  2HFP A;  3ET1 A;  3HOD A;  4G1Z A;  1EXX A;  5DIE A;  1XB7 A;  4ONI A;  4QJR A;  5DKS A;  2HBH A;  3A3Z X;  2PIV A;  3A9E A;  4IW8 A;  3V49 A;  3V4A A;  3W0H A;  5DUE A;  1I7I A;  2OM9 A;  3HC6 A;  3AUR A;  4JYI A;  3GYU A;  4TV1 A;  1XP9 A;  5E0X A;  4OEZ A;  3BC5 A;  2P7G A;  3U9Q A;  4WQP A;  4ZNS A;  4IWF A;  1DKF A;  1R6G A;  3VT8 A;  5DZ3 A;  3ADV A;  2P1T A;  5KRK A;  5JY3 A;  3ADU A;  3P0U A;  2O4J A;  1ZKY A;  3NSP A;  4FNE A;  5KRF A;  5KRO A;  4ZI1 A;  3R8I A;  4MGC A;  3RUU A;  4OFR A;  1YIN A;  3V9V A;  3VHU A;  3VTD A;  1FM9 A;  5DZ1 A;  1WM0 X;  5C4S A;  5DV8 A;  2OUZ A;  4MGD B;  3VT9 A;  1GWR A;  2PIR A;  2PIP L;  3HM1 A;  2NXX E;  4Q13 A;  5DI7 A;  1ILH A;  5DU5 A;  3UP0 A;  5IXK A;  3TKM A;  3AFR A;  4JYG A;  4WLB A;  3OKI A;  2AM9 A;  3B67 A;  2PNU A;  3FUR A;  4PWL A;  3ZR7 A;  3A2I A;  4LBD A;  4MGB B;  3ZRB A;  4HLW A;  3UUD B;  3P88 A;  1G2N A;  5HJP A;  1SR7 A;  1R1K D;  4DK8 A;  5AWK A;  4IQR A;  2B50 A;  4X1F A;  4NIE A;  4ZN9 A;  3VT4 A;  3ADW A;  4M8E A;  3D57 A;  4OH5 A;  4X1G A;  2V7C A;  2HAS A;  2PIU A;  3OMK A;  4IWC A;  3RVF A;  3SP9 A;  3VJS A;  5HYR A;  2BJ4 A;  3PLZ A;  3DZY D;  1N83 A;  3E94 A;  5DV6 A;  3UU7 A;  5KRA A;  2ZNO A;  3IXP A;  3UVV B;  3KYT A;  5DKE A;  2FSZ A;  2PIN A;  4OAR A;  3W0G A;  2AX7 A;  5DMF A;  1SJ0 A;  1TFC A;  1X78 A;  3WMH A;  5DWG A;  1OSV A;  2PRG A;  1XIU A;  2HCD A;  2AMA A;  1Z95 A;  1ZGY A;  1P8D A;  1RJK A;  2Q7L A;  2J7Y A;  4N73 A;  2HWQ A;  1NAV A;  3KMG A;  2E2R A;  5DWE A;  4J24 A;  1FCX A;  1X7E A;  5KD9 A;  2J7X A;  3R2A A;  4P6X A;  3OMP A;  1PZL A;  3KMZ A;  4IA1 A;  1T73 A;  2ZK0 A;  2JFA B;  2QZO B;  2ZK6 A;  2HAR A;  3RLL A;  3W5P A;  1T63 A;  2GPP A;  4JAZ A;  5B41 A;  4L98 A;  1L2I A;  5AZV A;  3FC6 A;  1ERR A;  3RY9 A;  3W0J A;  4NQA B;  1G50 A;  2Q59 A;  4MGA A;  5H1E A;  2Q5G A;  1N4H A;  1YUC A;  2P54 A;  4NUF A;  3OSI A;  4RMD A;  5DL4 A;  3ILZ A;  1ZDU A;  2QSE A;  1KV6 A;  3T03 A;  2QXM A;  2GPO A;  3A40 X;  3FLI A;  2PIO A;  2QXS A;  2P7A A;  5KRM A;  3L03 A;  4G1Y A;  1MZN A;  5DXE A;  3K23 A;  2AA5 A;  4IUI A;  1U9E A;  5GIC A;  4OHA A;  4UDC A;  5KRH A;  5DID A;  3S9S A;  3B66 A;  3W0C A;  5IAW A;  4XT9 A;  5DXB B;  4RZF A;  3KMR A;  1NAX A;  4ZNW A;  3AX8 A;  4MDD A;  5I4V A;  5FQP A;  5G44 A;  3D24 A;  5EJV A;  1QKN A;  4MG7 B;  5HZC A;  5AAV B;  1A28 A;  1S0X A;  1XP6 A;  3B0W A;  2AX9 A;  3CQV A;  4LTW A;  4RMC A;  3GWS X;  1YA3 A;  4XI3 A;  3MNP A;  4CI4 A;  3UUA A;  3OOK A;  4OFU A;  4MG6 A;  3VHW A;  2QMV A;  1UPV A;  4Q0A C;  5DKG A;  5IZ0 A;  3G9E A;  5DYB A;  5DXQ A;  1GS4 A;  3IMY A;  3WJ5 A;  2JJ3 A;  4A4V A;  4OEA A;  3V3E A;  2BAW A;  2R6Y A;  2Z4J A;  5DX3 B;  5HJS A;  4MG9 B;  3VI8 A;  4PP6 A;  1I7G A;  5FQS A;  3ADS A;  2AMB A;  5EIT A;  3CDS A;  3L1B A;  2Q7J A;  2P7Z A;  5ICK A;  3TY0 A;  1FD0 A;  3VTB A;  5HYK A;  5KCD A;  1NQ1 A;  3B0T A;  3E00 D;  4J5X A;  3B5R A;  2Q5S A;  3UUC A;  4B7W A;  2GPU A;  5E15 A;  5DRJ A;  1XZX X;  2VV4 B;  2XYX A;  4OIU A;  1XP1 A;  4EMA A;  3N00 A;  5DVV A;  4ZJR A;  1M13 A;  4R2U A;  1ERE A;  1XV9 A;  2NW4 A;  3CS4 A;  2QW4 A;  2Q61 A;  5DY8 A;  5AZT A;  5FQR A;  3VJI A;  1S9P A;  4KZM A;  4PPP A;  2P15 A;  2FAI A;  1UHL A;  1XAP A;  3B0Q A;  3HO0 A;  3WT5 A;  4DQM A;  3OLF A;  1OT7 A;  5M96 A;  1YMT A;  3GZ9 A;  1S19 A;  2PIQ A;  2Q7K A;  3IA6 A;  2GL8 A;  3CWD A;  1XQC A;  4MG5 A;  4OKT A;  2R40 A;  4S0T A;  2NV7 A;  4EM9 A;  2G5O A;  2OZ7 A;  1DB1 A;  3RUT A;  5AAU A;  3WT7 A;  4S14 A;  1UPW A;  2ACL A;  4RUO X;  1ZEO A;  1RK3 A;  4POJ A;  3WWR A;  1XOW A;  3MNE A;  1T7M A;  3LMP A;  3MNO A;  1E3K A;  5LWP A;  2IHQ A;  3PEQ A;  1X7R A;  2A3I A;  3W5T A;  3DY6 A;  4IV4 A;  1PDU A;  3OS8 C;  4MGB A;  5EI1 A;  5KYJ A;  3DCT A;  1R5K A;  3A2H A;  2OCF A;  1VJB A;  1M2Z A;  5DUH A;  2B1V A;  3KFC A;  4OZT E;  3B68 A;  3W0I A;  2POB A;  1RDT D;  1L2J A;  3FUG A;  3H0A D;  4XUM A;  2I4J A;  5DSH A;  4K7A A;  3OGT A;  2ZMI A;  2ZY0 A;  4BCR A;  5DVC A;  3A9E B;  4TUZ A;  2OAX A;  4G2H A;  2XYJ A;  2YLP A;  4ZNU A;  4A4W A;  1YYE A;  4DOS A;  3WFG A;  3K22 A;  3HC5 A;  2ZLC A;  2QA6 A;  3OAP A;  3L0J A;  1BSX A;  1T74 A;  4XLD A;  4N1Y A;  2Q1V A;  1A52 A;  2PKL A;  4JL4 A;  1H9U A;  2QAB A;  4J5W C;  1DKF B;  3FXV A;  3ET2 A;  2G44 A;  3LBD A;  2QR9 A;  1GWQ A;  4WPF A;  5APH A;  5KR9 A;  3DZU A;  1K74 D;  1MV9 A;  4FN9 A;  1PK5 A;  3OLL A;  4FHI A;  1XNN A;  1YOW A;  1HG4 A;  3OMQ A;  4O8F A;  1PRG A;  1OSH A;  4YNK A;  3AZ3 A;  4IU7 A;  4OZT U;  1NRL A;  2JFA A;  2QZO A;  1PQ6 A;  2ABI A;  3CTB A;  3R5N A;  2YHD A;  1X76 A;  1YJE A;  3ET3 A;  2ATH A;  2VV1 B;  3HQ5 A;  1XLS A;  2NPA A;  3WJ4 A;  2P4Y A;  3ZQT A;  3A78 A;  4CI5 A;  4N8R A;  4OH6 A;  3TX7 B;  3V9Y A;  1IE8 A;  4UDB A;  3L0L A;  3HLV A;  4DOR A;  5SYZ A;  4CSJ A;  1GWX A;  1QKT A;  1X7B A;  4QE8 A;  1T65 A;  5KCE A;  2ZAS A;  2Q8S A;  4F9M A;  3F5C A;  4R6S A;  3AUQ A;  4OJ4 A;  1KKQ A;  1T79 A;  1OVL B;  3VRW A;  3VN2 A;  2JF9 A;  2YLO A;  1YOK A;  4ZNT A;  4WVD A;  4NY9 A;  1I38 A;  1G5Y A;  2Q70 A;  2BJ4 B;  5DWL A;  3UU7 B;  4DM6 A;  5DXB A;  2O4R A;  1FM9 D;  2QA8 A;  1R20 A;  3OZJ A;  5G43 A;  2YAT A;  3M7R A;  2P1V A;  3R5M A;  4OLM A;  3FAL B;  1FCY A;  5DWJ A;  2QNV A;  3L3Z A;  5E14 A;  4PPS A;  3VJT A;  3VRT A;  4G1D A;  3VSP A;  2ZNP A;  1IE9 A;  5AVL A;  2ZK3 A;  1NDE A;  2XKW A;  1K4W A;  3GN8 A;  5DTV A;  2ZK1 A;  4YT1 A;  2YJA B;  5DXK A;  3EYB A;  5L11 A;  4JYH A;  3VT3 A;  4XTA A;  3VT7 A;  5DP0 A;  5DXG A;  2B23 A;  2I0G A;  2ZNQ A;  5APJ A;  2ZMH A;  2ZK5 A;  5G5W A;  1QKU A;  2PJL A;  2VV0 A;  3P89 A;  5G46 A;  1P93 A;  1XLS E;  5DX3 A;  2G0G A;  3AZ1 A;  2HC4 A;  1T7R A;  2Q59 B;  2ZBS A;  2QGW A;  3IXP D;  3V9T A;  2GTK A;  3A2J A;  4E2J A;  1T5Z A;  3D5F A;  4ZN7 A;  2AB2 A;  2AAX A;  5DMC A;  1ILG A;  2ZK4 A;  2Q5P A;  2VSR A;  3OMO A;  2H77 A;  5E7V A;  2AXA A;  5ETH A;  5GIE A;  4IA2 A;  1EXA A;  5FQV A;  3X31 A;  2VST A;  5DXM A;  5DRM A;  5G45 A;  3WT6 A;  3GWX A;  1XPC A;  5DIG A;  2Q6S A;  2QTU A;  4UDD A;  3JZC A;  4REF A;  4K6I A;  1T7T A;  4QL8 A;  2VV4 A;  5DZI A;  4WHG A;  5KCT A;  3AUN A;  1XVP A;  4IA3 A;  4PVU A;  5AK2 A;  4RME A;  3CDP A;  5KRL A;  2GIU A;  4FGY A;  4OKB A;  5JI0 D;  4IA7 A;  2HWR A;  4Q50 A;  2AYR A;  1S0Z A;  2Q1H A;  3ADT A;  3CJW A;  3FEJ A;  4OIV A;  4PLD A;  2W8Y A;  3OMM A;  2POG A;  2ZXM A;  2ZKC A;  4MG8 B;  4APU A;  5KYA A;  4PRG A;  3OS9 A;  3UUA B;  1PQC A;  1XNX A;  2G0H A;  3ERT A;  1PCG A;  5E1C A;  1XDK B;  3OOF A;  5DWI A;  1ZDT A;  3WFF A;  2QE4 A;  5JJM B;  1R1K A;  1ZAF A;  2AA2 A;  2I0J A;  4OKX A;  5F9B A;  4OIL A;  3KPZ A;  2NXX A;  2ZFX A;  4LNW A;  2YLQ A;  5A86 A;  1U3R A;  4OKW A;  3DZY A;  1K7L A;  3R8A A;  3D90 A;  2FVJ A;  2QH6 A;  4NB6 A;  5EHJ A;  1LBD A;  2ZXN A;  4PF3 A;  3K6P A;  2AA6 A;  4MGD A;  1U3Q A;  4QE6 A;  2VV2 A;  3Q95 B;  5HCV A;  4IVW A;  3GBK A;  1T7F A;  4DM8 A;  3AN4 A; 
#chains in the Genus database with same CATH homology
 1RKH A;  3AN3 A;  3V3Q A;  3RLJ A;  5DV3 A;  1XV9 B;  3UUD A;  3WGP A;  2I4P A;  2Z4B A;  3B3K A;  5GT4 A;  4YMQ A;  1UHL B;  3OS8 A;  4PP3 A;  5FQT A;  3O1E A;  2OVM A;  4QM0 A;  4HEE X;  5CJ6 A;  3ADX A;  4XHD A;  5APK A;  5L7H A;  2LBD A;  1Y0X X;  5KCF A;  3IPQ A;  3UVV A;  4XAO A;  5DXR A;  4S0S A;  4POH A;  1MVC A;  1TXI A;  4OGH A;  1Y0S A;  2ZLA A;  3ET0 A;  2XHS A;  3OSA A;  4IW6 A;  4TV1 B;  4Y29 A;  5L7E A;  5KCU A;  2Q6J A;  2J4A A;  4OC7 A;  3X36 A;  3W5R A;  3KDU A;  1NQ2 A;  3P8X A;  5ACC A;  3D6D A;  2ACL B;  3W5Q A;  2XYW A;  3H52 A;  5C4U A;  3KDT A;  3BQD A;  1SQN A;  2VV1 A;  5DXP A;  5KCW A;  4J5W A;  2AO6 A;  4OJ9 A;  2J14 A;  5C4O A;  4PLE A;  1NHZ A;  2Q60 A;  1I37 A;  2REW A;  2HVC A;  2V0V A;  3E7C A;  2QGT A;  1N46 A;  3F7D A;  3OSW A;  1XJ7 A;  2HB7 A;  5B5B A;  3ERD A;  4LNX A;  4OJB A;  1FM6 A;  3BEJ A;  1OVL A;  2Q3Y A;  4M8H A;  3IPU A;  5KCC A;  1YP0 A;  1U3S A;  2R40 D;  4J26 A;  4S15 A;  2O9I A;  1T76 A;  3PRG A;  4TUZ B;  1NUO A;  3VRV A;  3DCU A;  2HB8 A;  3GYT A;  5HJP B;  4ZNH A;  2AX6 A;  4L96 A;  5E0W A;  4ZOM A;  4E4K A;  4E4Q A;  1YIM A;  3VRU A;  2YLY A;  3OKH A;  3KBA A;  1HJ1 A;  5DLR A;  3FAL A;  3SP6 A;  5AWJ A;  3VSO A;  4JGV A;  4KZI A;  2GWX A;  3UP3 A;  4OED A;  4OK1 A;  4RZG A;  5KRI A;  4KZJ A;  4OEY A;  4R06 A;  1FBY A;  3OLS A;  2AA7 A;  1NQ0 A;  2Q6R A;  4RWV A;  4UDA A;  4ITF A;  2R6W A;  2F4B A;  1LV2 A;  5DUG A;  1Z5X E;  4MG7 A;  3E00 A;  3DT3 A;  3VT6 A;  3PO9 A;  5DKB A;  5AAV A;  3CS8 A;  3VT5 A;  3G8O A;  5AVI A;  4K4J A;  5EC9 A;  5DZH A;  5K13 A;  2PIW A;  2ZXZ A;  4RAK A;  3CLD A;  4P6W A;  3G8I A;  5EGV A;  2ZK2 A;  2ZNN A;  3F5C B;  2IOK A;  4FHH A;  3FC6 B;  1NYX A;  3HZF A;  4RFW A;  4RUJ A;  4MG9 A;  4DMA A;  2PIX A;  4MGA B;  4ZNV A;  1UOM A;  3VTC A;  4N5G A;  4ZJW A;  3DZU D;  3FEI A;  3R8D A;  1PQ9 A;  1Z5X U;  3B1M A;  3W0Y A;  2I4Z A;  2QA8 B;  3HVL A;  3NSQ A;  2AX8 A;  3DR1 A;  5DK9 A;  3PBA A;  4QK4 A;  1E3G A;  2PIT A;  1FM6 D;  3O1D A;  3GD2 A;  4ITE A;  2P1U A;  4G21 A;  4ZO1 B;  3AZ2 A;  5KRJ A;  5G42 A;  4PXM A;  1NQ7 A;  3FS1 A;  1XQ3 A;  4MG8 A;  2ZVT A;  3WTQ A;  1RKG A;  3CS6 A;  4OZR E;  5DYD A;  1X7J A;  3KWY A;  1ZH7 A;  2GP7 A;  4PP5 A;  2GPV A;  1XDK A;  3QT0 A;  2EWP A;  3L3X A;  3OZ0 A;  1ZUC A;  3ZRA A;  4YPQ A;  1KNU A;  3X1I A;  2OVH A;  2QPY A;  3K8S A;  1G1U A;  3R29 A;  4RZE A;  3VHV A;  5JJM A;  5L7G A;  4IVY A;  1M7W A;  2B1Z A;  2ZL9 A;  3L0E A;  1RDT A;  5DZ0 A;  3H0A A;  5AYG A;  3TKC A;  1Q4X A;  4G2I A;  3B65 A;  2YJD A;  2HAM A;  5KRC A;  4XUH A;  1R20 D;  3IPS A;  3JZB A;  4IS8 A;  5E19 A;  4A2J A;  4J5X C;  5G3J A;  3B0R A;  4G20 A;  3W0A A;  5DVS A;  3PCU A;  2H79 A;  4REE A;  1QKM A;  3NOA A;  4ZO1 X;  2Q7I A;  5C4T A;  3Q95 A;  4WHF A;  2IOG A;  4LSJ A;  1FCZ A;  2ZMJ A;  5GID A;  3SZ1 A;  1Y9R A;  2VV3 A;  4OZR U;  5LGA A;  2AWH A;  1K74 A;  1XVP B;  3VJH A;  1SKX A;  3X1H A;  1S9Q A;  3G0W A;  1YY4 A;  4RE8 A;  4RUP A;  4IV2 A;  4DK7 A;  2YFE A;  2HFP A;  3ET1 A;  3HOD A;  4G1Z A;  1EXX A;  5DIE A;  1XB7 A;  4ONI A;  4QJR A;  5DKS A;  2HBH A;  3A3Z X;  2PIV A;  3A9E A;  4IW8 A;  3V49 A;  3V4A A;  3W0H A;  5DUE A;  1I7I A;  2OM9 A;  3HC6 A;  3AUR A;  4JYI A;  3GYU A;  4TV1 A;  1XP9 A;  5E0X A;  4OEZ A;  3BC5 A;  2P7G A;  3U9Q A;  4WQP A;  4ZNS A;  4IWF A;  1DKF A;  1R6G A;  3VT8 A;  5DZ3 A;  3ADV A;  2P1T A;  5KRK A;  5JY3 A;  3ADU A;  3P0U A;  2O4J A;  1ZKY A;  3NSP A;  4FNE A;  5KRF A;  5KRO A;  4ZI1 A;  3R8I A;  4MGC A;  3RUU A;  4OFR A;  1YIN A;  3V9V A;  3VHU A;  3VTD A;  1FM9 A;  5DZ1 A;  1WM0 X;  5C4S A;  5DV8 A;  2OUZ A;  4MGD B;  3VT9 A;  1GWR A;  2PIR A;  2PIP L;  3HM1 A;  2NXX E;  4Q13 A;  5DI7 A;  1ILH A;  5DU5 A;  3UP0 A;  5IXK A;  3TKM A;  3AFR A;  4JYG A;  4WLB A;  3OKI A;  2AM9 A;  3B67 A;  2PNU A;  3FUR A;  4PWL A;  3ZR7 A;  3A2I A;  4LBD A;  4MGB B;  3ZRB A;  4HLW A;  3UUD B;  3P88 A;  1G2N A;  5HJP A;  1SR7 A;  1R1K D;  4DK8 A;  5AWK A;  4IQR A;  2B50 A;  4X1F A;  4NIE A;  4ZN9 A;  3VT4 A;  3ADW A;  4M8E A;  3D57 A;  4OH5 A;  4X1G A;  2V7C A;  2HAS A;  2PIU A;  3OMK A;  4IWC A;  3RVF A;  3SP9 A;  3VJS A;  5HYR A;  2BJ4 A;  3PLZ A;  3DZY D;  1N83 A;  3E94 A;  5DV6 A;  3UU7 A;  5KRA A;  2ZNO A;  3IXP A;  3UVV B;  3KYT A;  5DKE A;  2FSZ A;  2PIN A;  4OAR A;  3W0G A;  2AX7 A;  5DMF A;  1SJ0 A;  1TFC A;  1X78 A;  3WMH A;  5DWG A;  1OSV A;  2PRG A;  1XIU A;  2HCD A;  2AMA A;  1Z95 A;  1ZGY A;  1P8D A;  1RJK A;  2Q7L A;  2J7Y A;  4N73 A;  2HWQ A;  1NAV A;  3KMG A;  2E2R A;  5DWE A;  4J24 A;  1FCX A;  1X7E A;  5KD9 A;  2J7X A;  3R2A A;  4P6X A;  3OMP A;  1PZL A;  3KMZ A;  4IA1 A;  1T73 A;  2ZK0 A;  2JFA B;  2QZO B;  2ZK6 A;  2HAR A;  3RLL A;  3W5P A;  1T63 A;  2GPP A;  4JAZ A;  5B41 A;  4L98 A;  1L2I A;  5AZV A;  3FC6 A;  1ERR A;  3RY9 A;  3W0J A;  4NQA B;  1G50 A;  2Q59 A;  4MGA A;  5H1E A;  2Q5G A;  1N4H A;  1YUC A;  2P54 A;  4NUF A;  3OSI A;  4RMD A;  5DL4 A;  3ILZ A;  1ZDU A;  2QSE A;  1KV6 A;  3T03 A;  2QXM A;  2GPO A;  3A40 X;  3FLI A;  2PIO A;  2QXS A;  2P7A A;  5KRM A;  3L03 A;  4G1Y A;  1MZN A;  5DXE A;  3K23 A;  2AA5 A;  4IUI A;  1U9E A;  5GIC A;  4OHA A;  4UDC A;  5KRH A;  5DID A;  3S9S A;  3B66 A;  3W0C A;  5IAW A;  4XT9 A;  5DXB B;  4RZF A;  3KMR A;  1NAX A;  4ZNW A;  3AX8 A;  4MDD A;  5I4V A;  5FQP A;  5G44 A;  3D24 A;  5EJV A;  1QKN A;  4MG7 B;  5HZC A;  5AAV B;  1A28 A;  1S0X A;  1XP6 A;  3B0W A;  2AX9 A;  3CQV A;  4LTW A;  4RMC A;  3GWS X;  1YA3 A;  4XI3 A;  3MNP A;  4CI4 A;  3UUA A;  3OOK A;  4OFU A;  4MG6 A;  3VHW A;  2QMV A;  1UPV A;  4Q0A C;  5DKG A;  5IZ0 A;  3G9E A;  5DYB A;  5DXQ A;  1GS4 A;  3IMY A;  3WJ5 A;  2JJ3 A;  4A4V A;  4OEA A;  3V3E A;  2BAW A;  2R6Y A;  2Z4J A;  5DX3 B;  5HJS A;  4MG9 B;  3VI8 A;  4PP6 A;  1I7G A;  5FQS A;  3ADS A;  2AMB A;  5EIT A;  3CDS A;  3L1B A;  2Q7J A;  2P7Z A;  5ICK A;  3TY0 A;  1FD0 A;  3VTB A;  5HYK A;  5KCD A;  1NQ1 A;  3B0T A;  3E00 D;  4J5X A;  3B5R A;  2Q5S A;  3UUC A;  4B7W A;  2GPU A;  5E15 A;  5DRJ A;  1XZX X;  2VV4 B;  2XYX A;  4OIU A;  1XP1 A;  4EMA A;  3N00 A;  5DVV A;  4ZJR A;  1M13 A;  4R2U A;  1ERE A;  1XV9 A;  2NW4 A;  3CS4 A;  2QW4 A;  2Q61 A;  5DY8 A;  5AZT A;  5FQR A;  3VJI A;  1S9P A;  4KZM A;  4PPP A;  2P15 A;  2FAI A;  1UHL A;  1XAP A;  3B0Q A;  3HO0 A;  3WT5 A;  4DQM A;  3OLF A;  1OT7 A;  5M96 A;  1YMT A;  3GZ9 A;  1S19 A;  2PIQ A;  2Q7K A;  3IA6 A;  2GL8 A;  3CWD A;  1XQC A;  4MG5 A;  4OKT A;  2R40 A;  4S0T A;  2NV7 A;  4EM9 A;  2G5O A;  2OZ7 A;  1DB1 A;  3RUT A;  5AAU A;  3WT7 A;  4S14 A;  1UPW A;  2ACL A;  4RUO X;  1ZEO A;  1RK3 A;  4POJ A;  3WWR A;  1XOW A;  3MNE A;  1T7M A;  3LMP A;  3MNO A;  1E3K A;  5LWP A;  2IHQ A;  3PEQ A;  1X7R A;  2A3I A;  3W5T A;  3DY6 A;  4IV4 A;  1PDU A;  3OS8 C;  4MGB A;  5EI1 A;  5KYJ A;  3DCT A;  1R5K A;  3A2H A;  2OCF A;  1VJB A;  1M2Z A;  5DUH A;  2B1V A;  3KFC A;  4OZT E;  3B68 A;  3W0I A;  2POB A;  1RDT D;  1L2J A;  3FUG A;  3H0A D;  4XUM A;  2I4J A;  5DSH A;  4K7A A;  3OGT A;  2ZMI A;  2ZY0 A;  4BCR A;  5DVC A;  3A9E B;  4TUZ A;  2OAX A;  4G2H A;  2XYJ A;  2YLP A;  4ZNU A;  4A4W A;  1YYE A;  4DOS A;  3WFG A;  3K22 A;  3HC5 A;  2ZLC A;  2QA6 A;  3OAP A;  3L0J A;  1BSX A;  1T74 A;  4XLD A;  4N1Y A;  2Q1V A;  1A52 A;  2PKL A;  4JL4 A;  1H9U A;  2QAB A;  4J5W C;  1DKF B;  3FXV A;  3ET2 A;  2G44 A;  3LBD A;  2QR9 A;  1GWQ A;  4WPF A;  5APH A;  5KR9 A;  3DZU A;  1K74 D;  1MV9 A;  4FN9 A;  1PK5 A;  3OLL A;  4FHI A;  1XNN A;  1YOW A;  1HG4 A;  3OMQ A;  4O8F A;  1PRG A;  1OSH A;  4YNK A;  3AZ3 A;  4IU7 A;  4OZT U;  1NRL A;  2JFA A;  2QZO A;  1PQ6 A;  2ABI A;  3CTB A;  3R5N A;  2YHD A;  1X76 A;  1YJE A;  3ET3 A;  2ATH A;  2VV1 B;  3HQ5 A;  1XLS A;  2NPA A;  3WJ4 A;  2P4Y A;  3ZQT A;  3A78 A;  4CI5 A;  4N8R A;  4OH6 A;  3TX7 B;  3V9Y A;  1IE8 A;  4UDB A;  3L0L A;  3HLV A;  4DOR A;  5SYZ A;  4CSJ A;  1GWX A;  1QKT A;  1X7B A;  4QE8 A;  1T65 A;  5KCE A;  2ZAS A;  2Q8S A;  4F9M A;  3F5C A;  4R6S A;  3AUQ A;  4OJ4 A;  1KKQ A;  1T79 A;  1OVL B;  3VRW A;  3VN2 A;  2JF9 A;  2YLO A;  1YOK A;  4ZNT A;  4WVD A;  4NY9 A;  1I38 A;  1G5Y A;  2Q70 A;  2BJ4 B;  5DWL A;  3UU7 B;  4DM6 A;  5DXB A;  2O4R A;  1FM9 D;  2QA8 A;  1R20 A;  3OZJ A;  5G43 A;  2YAT A;  3M7R A;  2P1V A;  3R5M A;  4OLM A;  3FAL B;  1FCY A;  5DWJ A;  2QNV A;  3L3Z A;  5E14 A;  4PPS A;  3VJT A;  3VRT A;  4G1D A;  3VSP A;  2ZNP A;  1IE9 A;  5AVL A;  2ZK3 A;  1NDE A;  2XKW A;  1K4W A;  3GN8 A;  5DTV A;  2ZK1 A;  4YT1 A;  2YJA B;  5DXK A;  3EYB A;  5L11 A;  4JYH A;  3VT3 A;  4XTA A;  3VT7 A;  5DP0 A;  5DXG A;  2B23 A;  2I0G A;  2ZNQ A;  5APJ A;  2ZMH A;  2ZK5 A;  5G5W A;  1QKU A;  2PJL A;  2VV0 A;  3P89 A;  5G46 A;  1P93 A;  1XLS E;  5DX3 A;  2G0G A;  3AZ1 A;  2HC4 A;  1T7R A;  2Q59 B;  2ZBS A;  2QGW A;  3IXP D;  3V9T A;  2GTK A;  3A2J A;  4E2J A;  1T5Z A;  3D5F A;  4ZN7 A;  2AB2 A;  2AAX A;  5DMC A;  1ILG A;  2ZK4 A;  2Q5P A;  2VSR A;  3OMO A;  2H77 A;  5E7V A;  2AXA A;  5ETH A;  5GIE A;  4IA2 A;  1EXA A;  5FQV A;  3X31 A;  2VST A;  5DXM A;  5DRM A;  5G45 A;  3WT6 A;  3GWX A;  1XPC A;  5DIG A;  2Q6S A;  2QTU A;  4UDD A;  3JZC A;  4REF A;  4K6I A;  1T7T A;  4QL8 A;  2VV4 A;  5DZI A;  4WHG A;  5KCT A;  3AUN A;  1XVP A;  4IA3 A;  4PVU A;  5AK2 A;  4RME A;  3CDP A;  5KRL A;  2GIU A;  4FGY A;  4OKB A;  5JI0 D;  4IA7 A;  2HWR A;  4Q50 A;  2AYR A;  1S0Z A;  2Q1H A;  3ADT A;  3CJW A;  3FEJ A;  4OIV A;  4PLD A;  2W8Y A;  3OMM A;  2POG A;  2ZXM A;  2ZKC A;  4MG8 B;  4APU A;  5KYA A;  4PRG A;  3OS9 A;  3UUA B;  1PQC A;  1XNX A;  2G0H A;  3ERT A;  1PCG A;  5E1C A;  1XDK B;  3OOF A;  5DWI A;  1ZDT A;  3WFF A;  2QE4 A;  5JJM B;  1R1K A;  1ZAF A;  2AA2 A;  2I0J A;  4OKX A;  5F9B A;  4OIL A;  3KPZ A;  2NXX A;  2ZFX A;  4LNW A;  2YLQ A;  5A86 A;  1U3R A;  4OKW A;  3DZY A;  1K7L A;  3R8A A;  3D90 A;  2FVJ A;  2QH6 A;  4NB6 A;  5EHJ A;  1LBD A;  2ZXN A;  4PF3 A;  3K6P A;  2AA6 A;  4MGD A;  1U3Q A;  4QE6 A;  2VV2 A;  3Q95 B;  5HCV A;  4IVW A;  3GBK A;  1T7F A;  4DM8 A;  3AN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...