2GPUA

Estrogen related receptor-gamma ligand binding domain complexed with 4-hydroxy-tamoxifen
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
222
structure length
222
Chain Sequence
YNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structures of the estrogen-related receptor-gamma ligand binding domain in three functional states reveal the molecular basis of small molecule regulation.
pubmed doi rcsb
molecule keywords Estrogen-related receptor gamma
molecule tags Transcription
source organism Homo sapiens
total genus 87
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 2gpuA00
5KCTA 4PP3A 1RKHA 5DWIA 1K74D 2HFPA 1NQ0A 1ZEOA 5KRJA 3CDPA 1XIUA 4PRGA 2G0HA 3A2IA 2OCFA 2P1UA 4PLDA 2ZK6A 4OKTA 2Q3YA 3RLJA 5L7GA 4JAZA 1E3GA 4ZI1A 5HYKA 4DM8A 1X78A 3FLIA 3VTCA 3CQVA 3VTDA 5E0WA 5IZ0A 3VT8A 5JJMA 5KYAA 2P7GA 3BC5A 4XI3A 4HLWA 2ZNOA 2AA5A 1Q4XA 5DZ3A 3V9YA 2YJAB 3P0UA 1Y0XX 2ZY0A 4ZN7A 4IVYA 3H0AA 5DRMA 4OKWA 4IWCA 4WVDA 4OH5A 5IAWA 3GWSX 2PJLA 2AA2A 3AURA 1XDKA 4QK4A 2ZMHA 3OLFA 4TUZB 5F9BA 4YPQA 5ACCA 5K13A 2QTUA 2V7CA 2ZNQA 4IS8A 4PVUA 2XHSA 1OSVA 3AN4A 5DSHA 4MG5A 2PRGA 4APUA 2R6WA 4IUIA 5DWGA 2J4AA 3U9QA 3UUAB 1UOMA 3FEIA 3FXVA 4G1YA 3W0JA 5DI7A 4UDCA 3IXPA 2B1VA 2Q5GA 4X1FA 4N8RA 1UHLB 2LBDA 4OIVA 1DKFA 3AUNA 4ZNWA 5E14A 5AWKA 3TY0A 2Q59A 1XNNA 3IMYA 4ITEA 2EWPA 2GIUA 3IA6A 3ZR7A 3UP0A 3HC6A 5EITA 3QT0A 4J5WA 1U9EA 1ILHA 1XAPA 3SP6A 5DP0A 4RMDA 2HB8A 2ZVTA 3W0GA 1XQ3A 1R6GA 2P4YA 3KMZA 4NY9A 3GN8A 3VI8A 2YJDA 4FNEA 3NSPA 3VT4A 5DVCA 5KR9A 4REFA 1UPVA 1XLSA 2Q6RA 4G1ZA 5DYBA 3AN3A 1PRGA 3H0AD 5DMCA 5DZIA 3D57A 3O1DA 2OVMA 5DK9A 3RLLA 3VRWA 3VT7A 2ABIA 2QXSA 3VJSA 1GS4A 1YMTA 3A3ZX 1PQCA 4IA2A 1LV2A 1RK3A 2QGWA 3NOAA 3VT3A 3WFFA 2GPOA 4IA1A 1I7GA 4MGBB 4XAOA 1YINA 4J5WC 3IXPD 3OZ0A 2AO6A 3WJ4A 4ZO1B 1FM9A 3F7DA 4WPFA 3ADWA 2AX6A 3G8OA 4OK1A 4PWLA 4Q13A 5E15A 4QE6A 3D24A 3W0YA 4NB6A 4K6IA 4S0SA 3VT5A 4OJ9A 3KYTA 1NDEA 3BEJA 5AAVA 2G44A 4G20A 3R8AA 5KCUA 1R1KA 4LBDA 1KNUA 4ITFA 5DWJA 1BSXA 2VV0A 2XYWA 1L2JA 1MVCA 5DXEA 3W5TA 1I38A 1KKQA 4ZOMA 2ZKCA 1XP9A 3L3XA 3FALA 4LTWA 1IE8A 2GL8A 1P93A 2J7XA 4DOSA 2B23A 3N00A 5KCCA 1RDTA 2ZXNA 4OLMA 1YJEA 2ACLA 2Q5PA 2QSEA 3AUQA 4XLDA 2HAMA 4OKXA 3GBKA 1QKMA 5DXMA 2PIPL 4QL8A 5FQSA 3GD2A 3OMPA 2AMAA 2Q6SA 2VV1A 4ONIA 1L2IA 1PQ6A 4TV1B 1LBDA 5DVVA 1SJ0A 2OM9A 3EYBA 1SQNA 3ET2A 2YLYA 2OZ7A 2Q60A 3M7RA 4POJA 5KCDA 1XVPA 3ADUA 4RFWA 5EI1A 3ZRBA 5DVSA 5L7HA 4CI5A 3VJIA 2QW4A 3DCUA 3CS4A 4XHDA 4QE8A 2Q7LA 3BQDA 5C4OA 4WQPA 5FQVA 4MG7B 1FM9D 1XP1A 3R8DA 2HC4A 2ZNPA 3OOFA 4OKBA 4R6SA 4ZNUA 3OSIA 2IOKA 1R1KD 1FM6D 5DWEA 4ZNSA 2ZK5A 4MDDA 2BJ4B 2IOGA 1X76A 1X7JA 1I7IA 5B5BA 3W0AA 2ZLCA 4OZRE 2H77A 5H1EA 2VV4B 1RDTD 4IA3A 5DMFA 3DY6A 2QA6A 4Q50A 5AAUA 1XV9B 3KPZA 5DY8A 1ZKYA 2Q6JA 4KZMA 1G50A 4TUZA 5L7EA 4ZN9A 1MV9A 2AMBA 2B1ZA 2AB2A 4OJBA 3VHVA 4IQRA 1FCXA 2QH6A 4JYGA 4L96A 5DZHA 3LBDA 4OARA 3CS8A 5DXRA 3R2AA 3B68A 4PXMA 3W5RA 1NHZA 2J14A 2ZBSA 3UUAA 3CTBA 3A78A 3ADTA 2PINA 4OC7A 4XUMA 4F9MA 1MZNA 3B0QA 3HVLA 3PEQA 1Y0SA 2Q7JA 3VTBA 5KRLA 3S9SA 2ZMJA 5IXKA 1UHLA 1E3KA 3ADSA 4OGHA 2Q1HA 4OJ4A 5KRIA 4XUHA 5GICA 4OH6A 1Z5XE 5AZVA 4RZFA 3B3KA 2O4RA 4RMEA 5AVIA 3K22A 3PCUA 3HC5A 2ZK4A 2YLOA 3TX7B 4YT1A 2ZK1A 5DXGA 1Y9RA 2FVJA 4LNXA 1A52A 5DWLA 3T03A 2AYRA 2HCDA 4IVWA 3H52A 3W0CA 3V9VA 2ATHA 3HQ5A 4Q0AC 5C4SA 3OKIA 3X1IA 4A2JA 1H9UA 4RUPA 3ET1A 3TKMA 4DQMA 1U3SA 1OVLB 3VJTA 1YOKA 3ILZA 5DXKA 3UU7B 2FSZA 5DRJA 3VRUA 3X36A 5KRMA 5KRFA 3CJWA 1ZAFA 1R5KA 2PIWA 5FQTA 4E2JA 2HB7A 3B5RA 4JYIA 4PPPA 1X7BA 5DIEA 1ILGA 4G1DA 2GP7A 4OEZA 5LWPA 2R6YA 5G46A 2QABA 1FCZA 3OS8A 4B7WA 1K4WA 4DM6A 5KCWA 4MGBA 1GWRA 2GWXA 5M96A 3TKCA 2QGTA 1T74A 2P1TA 3AZ1A 3KDUA 1ZUCA 2HASA 1NAXA 3L0EA 4UDDA 5DIGA 4OEDA 3E00A 3V49A 2JFAB 2QXMA 3V9TA 4MGAB 3L1BA 1N83A 4WLBA 5AZTA 3UUDB 4S14A 4YNKA 3E7CA 3KDTA 3P88A 5HJSA 2AX8A 2BAWA 3WTQA 4IV2A 1RKGA 2V0VA 4Y29A 3V4AA 4NUFA 1S0XA 2PIXA 4FGYA 1U3RA 5DXBB 5E0XA 1KV6A 3UVVB 5FQPA 2R40A 1Z95A 4OEYA 4P6WA 5DKSA 4OFUA 4S15A 5C4TA 4DK7A 4TV1A 3HODA 4JL4A 2Z4JA 2O9IA 2QPYA 2XYXA 3OOKA 3A2JA 3FC6B 1I37A 3VHUA 3JZCA 1T73A 4PP6A 3RUUA 2AXAA 3K23A 3A9EB 1M2ZA 5EHJA 3OLSA 2XYJA 2G5OA 4HEEX 1XJ7A 4FN9A 5JY3A 3PRGA 4ZNHA 3MNEA 4MG7A 1S9QA 3OKHA 2FAIA 3E00D 1S0ZA 4PLEA 4UDBA 3R29A 5LGAA 1QKNA 5JI0D 5ICKA 3WFGA 3X1HA 2AAXA 4IW8A 2QNVA 3ET3A 1S9PA 2OVHA 1XOWA 2BJ4A 1RJKA 3IPUA 3L0JA 4J5XA 4L98A 5AK2A 5HJPB 1NUOA 3OSWA 3HLVA 3F5CB 1QKTA 3K8SA 3OMQA 1FCYA 3OSAA 3DR1A 4EM9A 5I4VA 2VV4A 2P7AA 3FS1A 3D6DA 1XV9A 5EJVA 2VSTA 4G2HA 1NRLA 2P7ZA 5HCVA 3VSOA 1NAVA 1YIMA 2VV2A 1YOWA 2Q1VA 4MG8B 4A4WA 1GWXA 1N46A 5G44A 1T79A 2P1VA 3KMGA 3WT5A 1T7TA 3A2HA 4A4VA 2G0GA 5KRKA 4WHFA 3OMKA 4N5GA 4OHAA 3UP3A 1YUCA 3GWXA 3CDSA 3DCTA 4EMAA 5E1CA 3VRTA 1NYXA 2XKWA 3V3EA 3R5NA 3ZQTA 3B0WA 1SKXA 2ZK0A 1QKUA 5G3JA 3IPQA 3DZYA 4DMAA 4N73A 1NQ1A 1ZGYA 3FEJA 4J5XC 4JYHA 2I0JA 2IHQA 2ZASA 5DKEA 3WWRA 2HBHA 5DUGA 2YHDA 1T65A 2ZMIA 5E7VA 4MGDB 4MG9B 4S0TA 2QE4A 3VN2A 2P15A 2QZOB 5FQRA 1OT7A 4RE8A 4YMQA 2PIOA 5G42A 3WMHA 4BCRA 5DXQA 2ZXMA 5DTVA 1OVLA 3UU7A 3SP9A 2PIVA 5GIEA 3HZFA 4PPSA 2VV3A 2PIRA 4QM0A 2Q7KA 5DU5A 1T7MA 1HG4A 3ERDA 2VSRA 3FURA 5DX3B 2ZNNA 4RWVA 5G5WA 4OZTE 1TXIA 5HYRA 2NXXE 5CJ6A 1S19A 4ZNVA 3SZ1A 3ZRAA 2I0GA 3UUCA 4REEA 5APKA 4E4KA 3KFCA 3OLLA 3B0TA 4K4JA 3OMMA 4NIEA 5C4UA 2W8YA 1FBYA 4UDAA 3AFRA 2JFAA 4PP5A 4M8EA 5G43A 2HWRA 4MGAA 2QA8B 3JZBA 3NSQA 3UUDA 3KMRA 3R5MA 4J26A 3VHWA 4KZIA 3DZYD 1IE9A 2HARA 4IU7A 2J7YA 1R20A 3WT7A 1SR7A 1PK5A 3RUTA 4IW6A 3OAPA 3O1EA 4FHIA 3W5PA 3PLZA 2REWA 5KROA 1YA3A 2OAXA 2OUZA 5DXBA 2PIUA 3UVVA 1TFCA 2PNUA 3D5FA 4ZJWA 2QMVA 3A40X 3AZ3A 3Q95B 1X7RA 1U3QA 3GYUA 3KBAA 4MG6A 2E2RA 5DKGA 2AA7A 1T7FA 2POBA 3MNPA 3DZUA 3RY9A 4RZGA 1ZDTA 1G2NA 4OZRU 3VT6A 5AWJA 3FC6A 2ZFXA 2HVCA 2Q61A 3WT6A 4CI4A 3B0RA 3L03A 4PF3A 2AA6A 3A9EA 5DL4A 2PITA 2Q8SA 3OZJA 4R2UA 5HZCA 1EREA 1GWQA 5KCFA 1M7WA 1YP0A 4IV4A 5DV6A 1P8DA 5AYGA 5DXPA 5GT4A 5JJMB 1XNXA 2GTKA 1NQ7A 3VT9A 3K6PA 4R06A 3P8XA 5DZ1A 5APJA 5KCEA 3KWYA 2I4JA 2YFEA 2ZXZA 4IWFA 4JGVA 1R20D 1UPWA 2AX7A 4OILA 5ETHA 1Z5XU 5HJPA 2Q70A 3OS8C 1G1UA 4KZJA 1WM0X 1XDKB 2B50A 2YATA 3G8IA 4POHA 3F5CA 2AM9A 3B1MA 4OZTU 5G45A 3G9EA 3GYTA 5GIDA 5KRAA 1PZLA 1A28A 4ZO1X 2NPAA 4P6XA 2GPVA 1XB7A 2NXXA 1PQ9A 2POGA 5DYDA 2AX9A 4RZEA 5DUHA 3WGPA 4MG8A 3CWDA 5A86A 3DZUD 1DKFB 1NQ2A 2YLQA 2Q59B 3PO9A 4ZJRA 5AVLA 1M13A 4RAKA 4XT9A 1PCGA 2QR9A 2A3IA 2O4JA 4LNWA 3L3ZA 3R8IA 2JJ3A 3G0WA 1ZDUA 1ZH7A 1T7RA 2YLPA 1XQCA 3B65A 1YY4A 3B66A 2ZL9A 4OIUA 4X1GA 3CLDA 4OEAA 3OGTA 4NQAB 4MGCA 4J24A 1X7EA 1YYEA 2R40D 4WHGA 3HO0A 1FM6A 3VRVA 5SYZA 4G21A 5E19A 2GPUA 2JF9A 3D90A 4K7AA 5DIDA 5KD9A 2ZK3A 3ERTA 1EXXA 4FHHA 4MGDA 4MG9A 4RUOX 5DLRA 3VJHA 2NV7A 2QZOA 2ZK2A 3W5QA 3L0LA 3DT3A 2PKLA 4OFRA 1T5ZA 3CS6A 3LMPA 2P54A 5DV3A 4CSJA 4ZNTA 3GZ9A 3MNOA 2GPPA 4IA7A 2Q7IA 1ERRA 3OMOA 4M8HA 1K74A 1XZXX 4O8FA 3ADXA 1T76A 5EGVA 4E4QA 5KRCA 3RVFA 2I4ZA 5DZ0A 5DX3A 2I4PA 5AAVB 5APHA 3HM1A 1G5YA 2Q5SA 3B67A 1FD0A 1XPCA 1PDUA 1VJBA 2QA8A 4XTAA 3FALB 4LSJA 1N4HA 3W0HA 5B41A 5KYJA 2Z4BA 2NW4A 4DORA 5L11A 1K7LA 2ZLAA 4RMCA 3ADVA 2ACLB 1T63A 1DB1A 4DK8A 2HWQA 2AWHA 4RUJA 5DKBA 5DV8A 3V3QA 1OSHA 3X31A 3ET0A 3E94A 1XP6A 2VV1B 3AZ2A 3IPSA 3W0IA 3WJ5A 1EXAA 3P89A 3Q95A 3VSPA 4N1YA 1XVPB 1HJ1A 5KRHA 1XLSE 2PIQA 2H79A 4QJRA 3OS9A 2F4BA 3PBAA 4G2IA 5EC9A 3FUGA 5DUEA 3AX8A
chains in the Genus database with same CATH superfamily
5KCTA 4PP3A 1RKHA 5DWIA 1K74D 2HFPA 1NQ0A 1ZEOA 5KRJA 3CDPA 1XIUA 4PRGA 2G0HA 3A2IA 2OCFA 2P1UA 4PLDA 2ZK6A 4OKTA 2Q3YA 3RLJA 5L7GA 4JAZA 1E3GA 4ZI1A 5HYKA 4DM8A 1X78A 3FLIA 3VTCA 3CQVA 3VTDA 5E0WA 5IZ0A 3VT8A 5JJMA 5KYAA 2P7GA 3BC5A 4XI3A 4HLWA 2ZNOA 2AA5A 1Q4XA 5DZ3A 3V9YA 2YJAB 3P0UA 1Y0XX 2ZY0A 4ZN7A 4IVYA 3H0AA 5DRMA 4OKWA 4IWCA 4WVDA 4OH5A 5IAWA 3GWSX 2PJLA 2AA2A 3AURA 1XDKA 4QK4A 2ZMHA 3OLFA 4TUZB 5F9BA 4YPQA 5ACCA 5K13A 2QTUA 2V7CA 2ZNQA 4IS8A 4PVUA 2XHSA 1OSVA 3AN4A 5DSHA 4MG5A 2PRGA 4APUA 2R6WA 4IUIA 5DWGA 2J4AA 3U9QA 3UUAB 1UOMA 3FEIA 3FXVA 4G1YA 3W0JA 5DI7A 4UDCA 3IXPA 2B1VA 2Q5GA 4X1FA 4N8RA 1UHLB 2LBDA 4OIVA 1DKFA 3AUNA 4ZNWA 5E14A 5AWKA 3TY0A 2Q59A 1XNNA 3IMYA 4ITEA 2EWPA 2GIUA 3IA6A 3ZR7A 3UP0A 3HC6A 5EITA 3QT0A 4J5WA 1U9EA 1ILHA 1XAPA 3SP6A 5DP0A 4RMDA 2HB8A 2ZVTA 3W0GA 1XQ3A 1R6GA 2P4YA 3KMZA 4NY9A 3GN8A 3VI8A 2YJDA 4FNEA 3NSPA 3VT4A 5DVCA 5KR9A 4REFA 1UPVA 1XLSA 2Q6RA 4G1ZA 5DYBA 3AN3A 1PRGA 3H0AD 5DMCA 5DZIA 3D57A 3O1DA 2OVMA 5DK9A 3RLLA 3VRWA 3VT7A 2ABIA 2QXSA 3VJSA 1GS4A 1YMTA 3A3ZX 1PQCA 4IA2A 1LV2A 1RK3A 2QGWA 3NOAA 3VT3A 3WFFA 2GPOA 4IA1A 1I7GA 4MGBB 4XAOA 1YINA 4J5WC 3IXPD 3OZ0A 2AO6A 3WJ4A 4ZO1B 1FM9A 3F7DA 4WPFA 3ADWA 2AX6A 3G8OA 4OK1A 4PWLA 4Q13A 5E15A 4QE6A 3D24A 3W0YA 4NB6A 4K6IA 4S0SA 3VT5A 4OJ9A 3KYTA 1NDEA 3BEJA 5AAVA 2G44A 4G20A 3R8AA 5KCUA 1R1KA 4LBDA 1KNUA 4ITFA 5DWJA 1BSXA 2VV0A 2XYWA 1L2JA 1MVCA 5DXEA 3W5TA 1I38A 1KKQA 4ZOMA 2ZKCA 1XP9A 3L3XA 3FALA 4LTWA 1IE8A 2GL8A 1P93A 2J7XA 4DOSA 2B23A 3N00A 5KCCA 1RDTA 2ZXNA 4OLMA 1YJEA 2ACLA 2Q5PA 2QSEA 3AUQA 4XLDA 2HAMA 4OKXA 3GBKA 1QKMA 5DXMA 2PIPL 4QL8A 5FQSA 3GD2A 3OMPA 2AMAA 2Q6SA 2VV1A 4ONIA 1L2IA 1PQ6A 4TV1B 1LBDA 5DVVA 1SJ0A 2OM9A 3EYBA 1SQNA 3ET2A 2YLYA 2OZ7A 2Q60A 3M7RA 4POJA 5KCDA 1XVPA 3ADUA 4RFWA 5EI1A 3ZRBA 5DVSA 5L7HA 4CI5A 3VJIA 2QW4A 3DCUA 3CS4A 4XHDA 4QE8A 2Q7LA 3BQDA 5C4OA 4WQPA 5FQVA 4MG7B 1FM9D 1XP1A 3R8DA 2HC4A 2ZNPA 3OOFA 4OKBA 4R6SA 4ZNUA 3OSIA 2IOKA 1R1KD 1FM6D 5DWEA 4ZNSA 2ZK5A 4MDDA 2BJ4B 2IOGA 1X76A 1X7JA 1I7IA 5B5BA 3W0AA 2ZLCA 4OZRE 2H77A 5H1EA 2VV4B 1RDTD 4IA3A 5DMFA 3DY6A 2QA6A 4Q50A 5AAUA 1XV9B 3KPZA 5DY8A 1ZKYA 2Q6JA 4KZMA 1G50A 4TUZA 5L7EA 4ZN9A 1MV9A 2AMBA 2B1ZA 2AB2A 4OJBA 3VHVA 4IQRA 1FCXA 2QH6A 4JYGA 4L96A 5DZHA 3LBDA 4OARA 3CS8A 5DXRA 3R2AA 3B68A 4PXMA 3W5RA 1NHZA 2J14A 2ZBSA 3UUAA 3CTBA 3A78A 3ADTA 2PINA 4OC7A 4XUMA 4F9MA 1MZNA 3B0QA 3HVLA 3PEQA 1Y0SA 2Q7JA 3VTBA 5KRLA 3S9SA 2ZMJA 5IXKA 1UHLA 1E3KA 3ADSA 4OGHA 2Q1HA 4OJ4A 5KRIA 4XUHA 5GICA 4OH6A 1Z5XE 5AZVA 4RZFA 3B3KA 2O4RA 4RMEA 5AVIA 3K22A 3PCUA 3HC5A 2ZK4A 2YLOA 3TX7B 4YT1A 2ZK1A 5DXGA 1Y9RA 2FVJA 4LNXA 1A52A 5DWLA 3T03A 2AYRA 2HCDA 4IVWA 3H52A 3W0CA 3V9VA 2ATHA 3HQ5A 4Q0AC 5C4SA 3OKIA 3X1IA 4A2JA 1H9UA 4RUPA 3ET1A 3TKMA 4DQMA 1U3SA 1OVLB 3VJTA 1YOKA 3ILZA 5DXKA 3UU7B 2FSZA 5DRJA 3VRUA 3X36A 5KRMA 5KRFA 3CJWA 1ZAFA 1R5KA 2PIWA 5FQTA 4E2JA 2HB7A 3B5RA 4JYIA 4PPPA 1X7BA 5DIEA 1ILGA 4G1DA 2GP7A 4OEZA 5LWPA 2R6YA 5G46A 2QABA 1FCZA 3OS8A 4B7WA 1K4WA 4DM6A 5KCWA 4MGBA 1GWRA 2GWXA 5M96A 3TKCA 2QGTA 1T74A 2P1TA 3AZ1A 3KDUA 1ZUCA 2HASA 1NAXA 3L0EA 4UDDA 5DIGA 4OEDA 3E00A 3V49A 2JFAB 2QXMA 3V9TA 4MGAB 3L1BA 1N83A 4WLBA 5AZTA 3UUDB 4S14A 4YNKA 3E7CA 3KDTA 3P88A 5HJSA 2AX8A 2BAWA 3WTQA 4IV2A 1RKGA 2V0VA 4Y29A 3V4AA 4NUFA 1S0XA 2PIXA 4FGYA 1U3RA 5DXBB 5E0XA 1KV6A 3UVVB 5FQPA 2R40A 1Z95A 4OEYA 4P6WA 5DKSA 4OFUA 4S15A 5C4TA 4DK7A 4TV1A 3HODA 4JL4A 2Z4JA 2O9IA 2QPYA 2XYXA 3OOKA 3A2JA 3FC6B 1I37A 3VHUA 3JZCA 1T73A 4PP6A 3RUUA 2AXAA 3K23A 3A9EB 1M2ZA 5EHJA 3OLSA 2XYJA 2G5OA 4HEEX 1XJ7A 4FN9A 5JY3A 3PRGA 4ZNHA 3MNEA 4MG7A 1S9QA 3OKHA 2FAIA 3E00D 1S0ZA 4PLEA 4UDBA 3R29A 5LGAA 1QKNA 5JI0D 5ICKA 3WFGA 3X1HA 2AAXA 4IW8A 2QNVA 3ET3A 1S9PA 2OVHA 1XOWA 2BJ4A 1RJKA 3IPUA 3L0JA 4J5XA 4L98A 5AK2A 5HJPB 1NUOA 3OSWA 3HLVA 3F5CB 1QKTA 3K8SA 3OMQA 1FCYA 3OSAA 3DR1A 4EM9A 5I4VA 2VV4A 2P7AA 3FS1A 3D6DA 1XV9A 5EJVA 2VSTA 4G2HA 1NRLA 2P7ZA 5HCVA 3VSOA 1NAVA 1YIMA 2VV2A 1YOWA 2Q1VA 4MG8B 4A4WA 1GWXA 1N46A 5G44A 1T79A 2P1VA 3KMGA 3WT5A 1T7TA 3A2HA 4A4VA 2G0GA 5KRKA 4WHFA 3OMKA 4N5GA 4OHAA 3UP3A 1YUCA 3GWXA 3CDSA 3DCTA 4EMAA 5E1CA 3VRTA 1NYXA 2XKWA 3V3EA 3R5NA 3ZQTA 3B0WA 1SKXA 2ZK0A 1QKUA 5G3JA 3IPQA 3DZYA 4DMAA 4N73A 1NQ1A 1ZGYA 3FEJA 4J5XC 4JYHA 2I0JA 2IHQA 2ZASA 5DKEA 3WWRA 2HBHA 5DUGA 2YHDA 1T65A 2ZMIA 5E7VA 4MGDB 4MG9B 4S0TA 2QE4A 3VN2A 2P15A 2QZOB 5FQRA 1OT7A 4RE8A 4YMQA 2PIOA 5G42A 3WMHA 4BCRA 5DXQA 2ZXMA 5DTVA 1OVLA 3UU7A 3SP9A 2PIVA 5GIEA 3HZFA 4PPSA 2VV3A 2PIRA 4QM0A 2Q7KA 5DU5A 1T7MA 1HG4A 3ERDA 2VSRA 3FURA 5DX3B 2ZNNA 4RWVA 5G5WA 4OZTE 1TXIA 5HYRA 2NXXE 5CJ6A 1S19A 4ZNVA 3SZ1A 3ZRAA 2I0GA 3UUCA 4REEA 5APKA 4E4KA 3KFCA 3OLLA 3B0TA 4K4JA 3OMMA 4NIEA 5C4UA 2W8YA 1FBYA 4UDAA 3AFRA 2JFAA 4PP5A 4M8EA 5G43A 2HWRA 4MGAA 2QA8B 3JZBA 3NSQA 3UUDA 3KMRA 3R5MA 4J26A 3VHWA 4KZIA 3DZYD 1IE9A 2HARA 4IU7A 2J7YA 1R20A 3WT7A 1SR7A 1PK5A 3RUTA 4IW6A 3OAPA 3O1EA 4FHIA 3W5PA 3PLZA 2REWA 5KROA 1YA3A 2OAXA 2OUZA 5DXBA 2PIUA 3UVVA 1TFCA 2PNUA 3D5FA 4ZJWA 2QMVA 3A40X 3AZ3A 3Q95B 1X7RA 1U3QA 3GYUA 3KBAA 4MG6A 2E2RA 5DKGA 2AA7A 1T7FA 2POBA 3MNPA 3DZUA 3RY9A 4RZGA 1ZDTA 1G2NA 4OZRU 3VT6A 5AWJA 3FC6A 2ZFXA 2HVCA 2Q61A 3WT6A 4CI4A 3B0RA 3L03A 4PF3A 2AA6A 3A9EA 5DL4A 2PITA 2Q8SA 3OZJA 4R2UA 5HZCA 1EREA 1GWQA 5KCFA 1M7WA 1YP0A 4IV4A 5DV6A 1P8DA 5AYGA 5DXPA 5GT4A 5JJMB 1XNXA 2GTKA 1NQ7A 3VT9A 3K6PA 4R06A 3P8XA 5DZ1A 5APJA 5KCEA 3KWYA 2I4JA 2YFEA 2ZXZA 4IWFA 4JGVA 1R20D 1UPWA 2AX7A 4OILA 5ETHA 1Z5XU 5HJPA 2Q70A 3OS8C 1G1UA 4KZJA 1WM0X 1XDKB 2B50A 2YATA 3G8IA 4POHA 3F5CA 2AM9A 3B1MA 4OZTU 5G45A 3G9EA 3GYTA 5GIDA 5KRAA 1PZLA 1A28A 4ZO1X 2NPAA 4P6XA 2GPVA 1XB7A 2NXXA 1PQ9A 2POGA 5DYDA 2AX9A 4RZEA 5DUHA 3WGPA 4MG8A 3CWDA 5A86A 3DZUD 1DKFB 1NQ2A 2YLQA 2Q59B 3PO9A 4ZJRA 5AVLA 1M13A 4RAKA 4XT9A 1PCGA 2QR9A 2A3IA 2O4JA 4LNWA 3L3ZA 3R8IA 2JJ3A 3G0WA 1ZDUA 1ZH7A 1T7RA 2YLPA 1XQCA 3B65A 1YY4A 3B66A 2ZL9A 4OIUA 4X1GA 3CLDA 4OEAA 3OGTA 4NQAB 4MGCA 4J24A 1X7EA 1YYEA 2R40D 4WHGA 3HO0A 1FM6A 3VRVA 5SYZA 4G21A 5E19A 2GPUA 2JF9A 3D90A 4K7AA 5DIDA 5KD9A 2ZK3A 3ERTA 1EXXA 4FHHA 4MGDA 4MG9A 4RUOX 5DLRA 3VJHA 2NV7A 2QZOA 2ZK2A 3W5QA 3L0LA 3DT3A 2PKLA 4OFRA 1T5ZA 3CS6A 3LMPA 2P54A 5DV3A 4CSJA 4ZNTA 3GZ9A 3MNOA 2GPPA 4IA7A 2Q7IA 1ERRA 3OMOA 4M8HA 1K74A 1XZXX 4O8FA 3ADXA 1T76A 5EGVA 4E4QA 5KRCA 3RVFA 2I4ZA 5DZ0A 5DX3A 2I4PA 5AAVB 5APHA 3HM1A 1G5YA 2Q5SA 3B67A 1FD0A 1XPCA 1PDUA 1VJBA 2QA8A 4XTAA 3FALB 4LSJA 1N4HA 3W0HA 5B41A 5KYJA 2Z4BA 2NW4A 4DORA 5L11A 1K7LA 2ZLAA 4RMCA 3ADVA 2ACLB 1T63A 1DB1A 4DK8A 2HWQA 2AWHA 4RUJA 5DKBA 5DV8A 3V3QA 1OSHA 3X31A 3ET0A 3E94A 1XP6A 2VV1B 3AZ2A 3IPSA 3W0IA 3WJ5A 1EXAA 3P89A 3Q95A 3VSPA 4N1YA 1XVPB 1HJ1A 5KRHA 1XLSE 2PIQA 2H79A 4QJRA 3OS9A 2F4BA 3PBAA 4G2IA 5EC9A 3FUGA 5DUEA 3AX8A
chains in the Genus database with same CATH topology
5KCTA 4PP3A 1RKHA 5DWIA 1K74D 2HFPA 1NQ0A 1ZEOA 5KRJA 3CDPA 1XIUA 4PRGA 2G0HA 3A2IA 2OCFA 2P1UA 4PLDA 2ZK6A 4OKTA 2Q3YA 3RLJA 5L7GA 4JAZA 1E3GA 4ZI1A 5HYKA 4DM8A 1X78A 3FLIA 3VTCA 3CQVA 3VTDA 5E0WA 5IZ0A 3VT8A 5JJMA 5KYAA 2P7GA 3BC5A 4XI3A 4HLWA 2ZNOA 2AA5A 1Q4XA 5DZ3A 3V9YA 2YJAB 3P0UA 1Y0XX 2ZY0A 4ZN7A 4IVYA 3H0AA 5DRMA 4OKWA 4IWCA 4WVDA 4OH5A 5IAWA 3GWSX 2PJLA 2AA2A 3AURA 1XDKA 4QK4A 2ZMHA 3OLFA 4TUZB 5F9BA 4YPQA 5ACCA 5K13A 2QTUA 2V7CA 2ZNQA 4IS8A 4PVUA 2XHSA 1OSVA 3AN4A 5DSHA 4MG5A 2PRGA 4APUA 2R6WA 4IUIA 5DWGA 2J4AA 3U9QA 3UUAB 1UOMA 3FEIA 3FXVA 4G1YA 3W0JA 5DI7A 4UDCA 3IXPA 2B1VA 2Q5GA 4X1FA 4N8RA 1UHLB 2LBDA 4OIVA 1DKFA 3AUNA 4ZNWA 5E14A 5AWKA 3TY0A 2Q59A 1XNNA 3IMYA 4ITEA 2EWPA 2GIUA 3IA6A 3ZR7A 3UP0A 3HC6A 5EITA 3QT0A 4J5WA 1U9EA 1ILHA 1XAPA 3SP6A 5DP0A 4RMDA 2HB8A 2ZVTA 3W0GA 1XQ3A 1R6GA 2P4YA 3KMZA 4NY9A 3GN8A 3VI8A 2YJDA 4FNEA 3NSPA 3VT4A 5DVCA 5KR9A 4REFA 1UPVA 1XLSA 2Q6RA 4G1ZA 5DYBA 3AN3A 1PRGA 3H0AD 5DMCA 5DZIA 3D57A 3O1DA 2OVMA 5DK9A 3RLLA 3VRWA 3VT7A 2ABIA 2QXSA 3VJSA 1GS4A 1YMTA 3A3ZX 1PQCA 4IA2A 1LV2A 1RK3A 2QGWA 3NOAA 3VT3A 3WFFA 2GPOA 4IA1A 1I7GA 4MGBB 4XAOA 1YINA 4J5WC 3IXPD 3OZ0A 2AO6A 3WJ4A 4ZO1B 1FM9A 3F7DA 4WPFA 3ADWA 2AX6A 3G8OA 4OK1A 4PWLA 4Q13A 5E15A 4QE6A 3D24A 3W0YA 4NB6A 4K6IA 4S0SA 3VT5A 4OJ9A 3KYTA 1NDEA 3BEJA 5AAVA 2G44A 4G20A 3R8AA 5KCUA 1R1KA 4LBDA 1KNUA 4ITFA 5DWJA 1BSXA 2VV0A 2XYWA 1L2JA 1MVCA 5DXEA 3W5TA 1I38A 1KKQA 4ZOMA 2ZKCA 1XP9A 3L3XA 3FALA 4LTWA 1IE8A 2GL8A 1P93A 2J7XA 4DOSA 2B23A 3N00A 5KCCA 1RDTA 2ZXNA 4OLMA 1YJEA 2ACLA 2Q5PA 2QSEA 3AUQA 4XLDA 2HAMA 4OKXA 3GBKA 1QKMA 5DXMA 2PIPL 4QL8A 5FQSA 3GD2A 3OMPA 2AMAA 2Q6SA 2VV1A 4ONIA 1L2IA 1PQ6A 4TV1B 1LBDA 5DVVA 1SJ0A 2OM9A 3EYBA 1SQNA 3ET2A 2YLYA 2OZ7A 2Q60A 3M7RA 4POJA 5KCDA 1XVPA 3ADUA 4RFWA 5EI1A 3ZRBA 5DVSA 5L7HA 4CI5A 3VJIA 2QW4A 3DCUA 3CS4A 4XHDA 4QE8A 2Q7LA 3BQDA 5C4OA 4WQPA 5FQVA 4MG7B 1FM9D 1XP1A 3R8DA 2HC4A 2ZNPA 3OOFA 4OKBA 4R6SA 4ZNUA 3OSIA 2IOKA 1R1KD 1FM6D 5DWEA 4ZNSA 2ZK5A 4MDDA 2BJ4B 2IOGA 1X76A 1X7JA 1I7IA 5B5BA 3W0AA 2ZLCA 4OZRE 2H77A 5H1EA 2VV4B 1RDTD 4IA3A 5DMFA 3DY6A 2QA6A 4Q50A 5AAUA 1XV9B 3KPZA 5DY8A 1ZKYA 2Q6JA 4KZMA 1G50A 4TUZA 5L7EA 4ZN9A 1MV9A 2AMBA 2B1ZA 2AB2A 4OJBA 3VHVA 4IQRA 1FCXA 2QH6A 4JYGA 4L96A 5DZHA 3LBDA 4OARA 3CS8A 5DXRA 3R2AA 3B68A 4PXMA 3W5RA 1NHZA 2J14A 2ZBSA 3UUAA 3CTBA 3A78A 3ADTA 2PINA 4OC7A 4XUMA 4F9MA 1MZNA 3B0QA 3HVLA 3PEQA 1Y0SA 2Q7JA 3VTBA 5KRLA 3S9SA 2ZMJA 5IXKA 1UHLA 1E3KA 3ADSA 4OGHA 2Q1HA 4OJ4A 5KRIA 4XUHA 5GICA 4OH6A 1Z5XE 5AZVA 4RZFA 3B3KA 2O4RA 4RMEA 5AVIA 3K22A 3PCUA 3HC5A 2ZK4A 2YLOA 3TX7B 4YT1A 2ZK1A 5DXGA 1Y9RA 2FVJA 4LNXA 1A52A 5DWLA 3T03A 2AYRA 2HCDA 4IVWA 3H52A 3W0CA 3V9VA 2ATHA 3HQ5A 4Q0AC 5C4SA 3OKIA 3X1IA 4A2JA 1H9UA 4RUPA 3ET1A 3TKMA 4DQMA 1U3SA 1OVLB 3VJTA 1YOKA 3ILZA 5DXKA 3UU7B 2FSZA 5DRJA 3VRUA 3X36A 5KRMA 5KRFA 3CJWA 1ZAFA 1R5KA 2PIWA 5FQTA 4E2JA 2HB7A 3B5RA 4JYIA 4PPPA 1X7BA 5DIEA 1ILGA 4G1DA 2GP7A 4OEZA 5LWPA 2R6YA 5G46A 2QABA 1FCZA 3OS8A 4B7WA 1K4WA 4DM6A 5KCWA 4MGBA 1GWRA 2GWXA 5M96A 3TKCA 2QGTA 1T74A 2P1TA 3AZ1A 3KDUA 1ZUCA 2HASA 1NAXA 3L0EA 4UDDA 5DIGA 4OEDA 3E00A 3V49A 2JFAB 2QXMA 3V9TA 4MGAB 3L1BA 1N83A 4WLBA 5AZTA 3UUDB 4S14A 4YNKA 3E7CA 3KDTA 3P88A 5HJSA 2AX8A 2BAWA 3WTQA 4IV2A 1RKGA 2V0VA 4Y29A 3V4AA 4NUFA 1S0XA 2PIXA 4FGYA 1U3RA 5DXBB 5E0XA 1KV6A 3UVVB 5FQPA 2R40A 1Z95A 4OEYA 4P6WA 5DKSA 4OFUA 4S15A 5C4TA 4DK7A 4TV1A 3HODA 4JL4A 2Z4JA 2O9IA 2QPYA 2XYXA 3OOKA 3A2JA 3FC6B 1I37A 3VHUA 3JZCA 1T73A 4PP6A 3RUUA 2AXAA 3K23A 3A9EB 1M2ZA 5EHJA 3OLSA 2XYJA 2G5OA 4HEEX 1XJ7A 4FN9A 5JY3A 3PRGA 4ZNHA 3MNEA 4MG7A 1S9QA 3OKHA 2FAIA 3E00D 1S0ZA 4PLEA 4UDBA 3R29A 5LGAA 1QKNA 5JI0D 5ICKA 3WFGA 3X1HA 2AAXA 4IW8A 2QNVA 3ET3A 1S9PA 2OVHA 1XOWA 2BJ4A 1RJKA 3IPUA 3L0JA 4J5XA 4L98A 5AK2A 5HJPB 1NUOA 3OSWA 3HLVA 3F5CB 1QKTA 3K8SA 3OMQA 1FCYA 3OSAA 3DR1A 4EM9A 5I4VA 2VV4A 2P7AA 3FS1A 3D6DA 1XV9A 5EJVA 2VSTA 4G2HA 1NRLA 2P7ZA 5HCVA 3VSOA 1NAVA 1YIMA 2VV2A 1YOWA 2Q1VA 4MG8B 4A4WA 1GWXA 1N46A 5G44A 1T79A 2P1VA 3KMGA 3WT5A 1T7TA 3A2HA 4A4VA 2G0GA 5KRKA 4WHFA 3OMKA 4N5GA 4OHAA 3UP3A 1YUCA 3GWXA 3CDSA 3DCTA 4EMAA 5E1CA 3VRTA 1NYXA 2XKWA 3V3EA 3R5NA 3ZQTA 3B0WA 1SKXA 2ZK0A 1QKUA 5G3JA 3IPQA 3DZYA 4DMAA 4N73A 1NQ1A 1ZGYA 3FEJA 4J5XC 4JYHA 2I0JA 2IHQA 2ZASA 5DKEA 3WWRA 2HBHA 5DUGA 2YHDA 1T65A 2ZMIA 5E7VA 4MGDB 4MG9B 4S0TA 2QE4A 3VN2A 2P15A 2QZOB 5FQRA 1OT7A 4RE8A 4YMQA 2PIOA 5G42A 3WMHA 4BCRA 5DXQA 2ZXMA 5DTVA 1OVLA 3UU7A 3SP9A 2PIVA 5GIEA 3HZFA 4PPSA 2VV3A 2PIRA 4QM0A 2Q7KA 5DU5A 1T7MA 1HG4A 3ERDA 2VSRA 3FURA 5DX3B 2ZNNA 4RWVA 5G5WA 4OZTE 1TXIA 5HYRA 2NXXE 5CJ6A 1S19A 4ZNVA 3SZ1A 3ZRAA 2I0GA 3UUCA 4REEA 5APKA 4E4KA 3KFCA 3OLLA 3B0TA 4K4JA 3OMMA 4NIEA 5C4UA 2W8YA 1FBYA 4UDAA 3AFRA 2JFAA 4PP5A 4M8EA 5G43A 2HWRA 4MGAA 2QA8B 3JZBA 3NSQA 3UUDA 3KMRA 3R5MA 4J26A 3VHWA 4KZIA 3DZYD 1IE9A 2HARA 4IU7A 2J7YA 1R20A 3WT7A 1SR7A 1PK5A 3RUTA 4IW6A 3OAPA 3O1EA 4FHIA 3W5PA 3PLZA 2REWA 5KROA 1YA3A 2OAXA 2OUZA 5DXBA 2PIUA 3UVVA 1TFCA 2PNUA 3D5FA 4ZJWA 2QMVA 3A40X 3AZ3A 3Q95B 1X7RA 1U3QA 3GYUA 3KBAA 4MG6A 2E2RA 5DKGA 2AA7A 1T7FA 2POBA 3MNPA 3DZUA 3RY9A 4RZGA 1ZDTA 1G2NA 4OZRU 3VT6A 5AWJA 3FC6A 2ZFXA 2HVCA 2Q61A 3WT6A 4CI4A 3B0RA 3L03A 4PF3A 2AA6A 3A9EA 5DL4A 2PITA 2Q8SA 3OZJA 4R2UA 5HZCA 1EREA 1GWQA 5KCFA 1M7WA 1YP0A 4IV4A 5DV6A 1P8DA 5AYGA 5DXPA 5GT4A 5JJMB 1XNXA 2GTKA 1NQ7A 3VT9A 3K6PA 4R06A 3P8XA 5DZ1A 5APJA 5KCEA 3KWYA 2I4JA 2YFEA 2ZXZA 4IWFA 4JGVA 1R20D 1UPWA 2AX7A 4OILA 5ETHA 1Z5XU 5HJPA 2Q70A 3OS8C 1G1UA 4KZJA 1WM0X 1XDKB 2B50A 2YATA 3G8IA 4POHA 3F5CA 2AM9A 3B1MA 4OZTU 5G45A 3G9EA 3GYTA 5GIDA 5KRAA 1PZLA 1A28A 4ZO1X 2NPAA 4P6XA 2GPVA 1XB7A 2NXXA 1PQ9A 2POGA 5DYDA 2AX9A 4RZEA 5DUHA 3WGPA 4MG8A 3CWDA 5A86A 3DZUD 1DKFB 1NQ2A 2YLQA 2Q59B 3PO9A 4ZJRA 5AVLA 1M13A 4RAKA 4XT9A 1PCGA 2QR9A 2A3IA 2O4JA 4LNWA 3L3ZA 3R8IA 2JJ3A 3G0WA 1ZDUA 1ZH7A 1T7RA 2YLPA 1XQCA 3B65A 1YY4A 3B66A 2ZL9A 4OIUA 4X1GA 3CLDA 4OEAA 3OGTA 4NQAB 4MGCA 4J24A 1X7EA 1YYEA 2R40D 4WHGA 3HO0A 1FM6A 3VRVA 5SYZA 4G21A 5E19A 2GPUA 2JF9A 3D90A 4K7AA 5DIDA 5KD9A 2ZK3A 3ERTA 1EXXA 4FHHA 4MGDA 4MG9A 4RUOX 5DLRA 3VJHA 2NV7A 2QZOA 2ZK2A 3W5QA 3L0LA 3DT3A 2PKLA 4OFRA 1T5ZA 3CS6A 3LMPA 2P54A 5DV3A 4CSJA 4ZNTA 3GZ9A 3MNOA 2GPPA 4IA7A 2Q7IA 1ERRA 3OMOA 4M8HA 1K74A 1XZXX 4O8FA 3ADXA 1T76A 5EGVA 4E4QA 5KRCA 3RVFA 2I4ZA 5DZ0A 5DX3A 2I4PA 5AAVB 5APHA 3HM1A 1G5YA 2Q5SA 3B67A 1FD0A 1XPCA 1PDUA 1VJBA 2QA8A 4XTAA 3FALB 4LSJA 1N4HA 3W0HA 5B41A 5KYJA 2Z4BA 2NW4A 4DORA 5L11A 1K7LA 2ZLAA 4RMCA 3ADVA 2ACLB 1T63A 1DB1A 4DK8A 2HWQA 2AWHA 4RUJA 5DKBA 5DV8A 3V3QA 1OSHA 3X31A 3ET0A 3E94A 1XP6A 2VV1B 3AZ2A 3IPSA 3W0IA 3WJ5A 1EXAA 3P89A 3Q95A 3VSPA 4N1YA 1XVPB 1HJ1A 5KRHA 1XLSE 2PIQA 2H79A 4QJRA 3OS9A 2F4BA 3PBAA 4G2IA 5EC9A 3FUGA 5DUEA 3AX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KCT A;  4PP3 A;  1RKH A;  5DWI A;  1K74 D;  2HFP A;  1NQ0 A;  1ZEO A;  5KRJ A;  3CDP A;  1XIU A;  4PRG A;  2G0H A;  3A2I A;  2OCF A;  2P1U A;  4PLD A;  2ZK6 A;  4OKT A;  2Q3Y A;  3RLJ A;  5L7G A;  4JAZ A;  1E3G A;  4ZI1 A;  5HYK A;  4DM8 A;  1X78 A;  3FLI A;  3VTC A;  3CQV A;  3VTD A;  5E0W A;  5IZ0 A;  3VT8 A;  5JJM A;  5KYA A;  2P7G A;  3BC5 A;  4XI3 A;  4HLW A;  2ZNO A;  2AA5 A;  1Q4X A;  5DZ3 A;  3V9Y A;  2YJA B;  3P0U A;  1Y0X X;  2ZY0 A;  4ZN7 A;  4IVY A;  3H0A A;  5DRM A;  4OKW A;  4IWC A;  4WVD A;  4OH5 A;  5IAW A;  3GWS X;  2PJL A;  2AA2 A;  3AUR A;  1XDK A;  4QK4 A;  2ZMH A;  3OLF A;  4TUZ B;  5F9B A;  4YPQ A;  5ACC A;  5K13 A;  2QTU A;  2V7C A;  2ZNQ A;  4IS8 A;  4PVU A;  2XHS A;  1OSV A;  3AN4 A;  5DSH A;  4MG5 A;  2PRG A;  4APU A;  2R6W A;  4IUI A;  5DWG A;  2J4A A;  3U9Q A;  3UUA B;  1UOM A;  3FEI A;  3FXV A;  4G1Y A;  3W0J A;  5DI7 A;  4UDC A;  3IXP A;  2B1V A;  2Q5G A;  4X1F A;  4N8R A;  1UHL B;  2LBD A;  4OIV A;  1DKF A;  3AUN A;  4ZNW A;  5E14 A;  5AWK A;  3TY0 A;  2Q59 A;  1XNN A;  3IMY A;  4ITE A;  2EWP A;  2GIU A;  3IA6 A;  3ZR7 A;  3UP0 A;  3HC6 A;  5EIT A;  3QT0 A;  4J5W A;  1U9E A;  1ILH A;  1XAP A;  3SP6 A;  5DP0 A;  4RMD A;  2HB8 A;  2ZVT A;  3W0G A;  1XQ3 A;  1R6G A;  2P4Y A;  3KMZ A;  4NY9 A;  3GN8 A;  3VI8 A;  2YJD A;  4FNE A;  3NSP A;  3VT4 A;  5DVC A;  5KR9 A;  4REF A;  1UPV A;  1XLS A;  2Q6R A;  4G1Z A;  5DYB A;  3AN3 A;  1PRG A;  3H0A D;  5DMC A;  5DZI A;  3D57 A;  3O1D A;  2OVM A;  5DK9 A;  3RLL A;  3VRW A;  3VT7 A;  2ABI A;  2QXS A;  3VJS A;  1GS4 A;  1YMT A;  3A3Z X;  1PQC A;  4IA2 A;  1LV2 A;  1RK3 A;  2QGW A;  3NOA A;  3VT3 A;  3WFF A;  2GPO A;  4IA1 A;  1I7G A;  4MGB B;  4XAO A;  1YIN A;  4J5W C;  3IXP D;  3OZ0 A;  2AO6 A;  3WJ4 A;  4ZO1 B;  1FM9 A;  3F7D A;  4WPF A;  3ADW A;  2AX6 A;  3G8O A;  4OK1 A;  4PWL A;  4Q13 A;  5E15 A;  4QE6 A;  3D24 A;  3W0Y A;  4NB6 A;  4K6I A;  4S0S A;  3VT5 A;  4OJ9 A;  3KYT A;  1NDE A;  3BEJ A;  5AAV A;  2G44 A;  4G20 A;  3R8A A;  5KCU A;  1R1K A;  4LBD A;  1KNU A;  4ITF A;  5DWJ A;  1BSX A;  2VV0 A;  2XYW A;  1L2J A;  1MVC A;  5DXE A;  3W5T A;  1I38 A;  1KKQ A;  4ZOM A;  2ZKC A;  1XP9 A;  3L3X A;  3FAL A;  4LTW A;  1IE8 A;  2GL8 A;  1P93 A;  2J7X A;  4DOS A;  2B23 A;  3N00 A;  5KCC A;  1RDT A;  2ZXN A;  4OLM A;  1YJE A;  2ACL A;  2Q5P A;  2QSE A;  3AUQ A;  4XLD A;  2HAM A;  4OKX A;  3GBK A;  1QKM A;  5DXM A;  2PIP L;  4QL8 A;  5FQS A;  3GD2 A;  3OMP A;  2AMA A;  2Q6S A;  2VV1 A;  4ONI A;  1L2I A;  1PQ6 A;  4TV1 B;  1LBD A;  5DVV A;  1SJ0 A;  2OM9 A;  3EYB A;  1SQN A;  3ET2 A;  2YLY A;  2OZ7 A;  2Q60 A;  3M7R A;  4POJ A;  5KCD A;  1XVP A;  3ADU A;  4RFW A;  5EI1 A;  3ZRB A;  5DVS A;  5L7H A;  4CI5 A;  3VJI A;  2QW4 A;  3DCU A;  3CS4 A;  4XHD A;  4QE8 A;  2Q7L A;  3BQD A;  5C4O A;  4WQP A;  5FQV A;  4MG7 B;  1FM9 D;  1XP1 A;  3R8D A;  2HC4 A;  2ZNP A;  3OOF A;  4OKB A;  4R6S A;  4ZNU A;  3OSI A;  2IOK A;  1R1K D;  1FM6 D;  5DWE A;  4ZNS A;  2ZK5 A;  4MDD A;  2BJ4 B;  2IOG A;  1X76 A;  1X7J A;  1I7I A;  5B5B A;  3W0A A;  2ZLC A;  4OZR E;  2H77 A;  5H1E A;  2VV4 B;  1RDT D;  4IA3 A;  5DMF A;  3DY6 A;  2QA6 A;  4Q50 A;  5AAU A;  1XV9 B;  3KPZ A;  5DY8 A;  1ZKY A;  2Q6J A;  4KZM A;  1G50 A;  4TUZ A;  5L7E A;  4ZN9 A;  1MV9 A;  2AMB A;  2B1Z A;  2AB2 A;  4OJB A;  3VHV A;  4IQR A;  1FCX A;  2QH6 A;  4JYG A;  4L96 A;  5DZH A;  3LBD A;  4OAR A;  3CS8 A;  5DXR A;  3R2A A;  3B68 A;  4PXM A;  3W5R A;  1NHZ A;  2J14 A;  2ZBS A;  3UUA A;  3CTB A;  3A78 A;  3ADT A;  2PIN A;  4OC7 A;  4XUM A;  4F9M A;  1MZN A;  3B0Q A;  3HVL A;  3PEQ A;  1Y0S A;  2Q7J A;  3VTB A;  5KRL A;  3S9S A;  2ZMJ A;  5IXK A;  1UHL A;  1E3K A;  3ADS A;  4OGH A;  2Q1H A;  4OJ4 A;  5KRI A;  4XUH A;  5GIC A;  4OH6 A;  1Z5X E;  5AZV A;  4RZF A;  3B3K A;  2O4R A;  4RME A;  5AVI A;  3K22 A;  3PCU A;  3HC5 A;  2ZK4 A;  2YLO A;  3TX7 B;  4YT1 A;  2ZK1 A;  5DXG A;  1Y9R A;  2FVJ A;  4LNX A;  1A52 A;  5DWL A;  3T03 A;  2AYR A;  2HCD A;  4IVW A;  3H52 A;  3W0C A;  3V9V A;  2ATH A;  3HQ5 A;  4Q0A C;  5C4S A;  3OKI A;  3X1I A;  4A2J A;  1H9U A;  4RUP A;  3ET1 A;  3TKM A;  4DQM A;  1U3S A;  1OVL B;  3VJT A;  1YOK A;  3ILZ A;  5DXK A;  3UU7 B;  2FSZ A;  5DRJ A;  3VRU A;  3X36 A;  5KRM A;  5KRF A;  3CJW A;  1ZAF A;  1R5K A;  2PIW A;  5FQT A;  4E2J A;  2HB7 A;  3B5R A;  4JYI A;  4PPP A;  1X7B A;  5DIE A;  1ILG A;  4G1D A;  2GP7 A;  4OEZ A;  5LWP A;  2R6Y A;  5G46 A;  2QAB A;  1FCZ A;  3OS8 A;  4B7W A;  1K4W A;  4DM6 A;  5KCW A;  4MGB A;  1GWR A;  2GWX A;  5M96 A;  3TKC A;  2QGT A;  1T74 A;  2P1T A;  3AZ1 A;  3KDU A;  1ZUC A;  2HAS A;  1NAX A;  3L0E A;  4UDD A;  5DIG A;  4OED A;  3E00 A;  3V49 A;  2JFA B;  2QXM A;  3V9T A;  4MGA B;  3L1B A;  1N83 A;  4WLB A;  5AZT A;  3UUD B;  4S14 A;  4YNK A;  3E7C A;  3KDT A;  3P88 A;  5HJS A;  2AX8 A;  2BAW A;  3WTQ A;  4IV2 A;  1RKG A;  2V0V A;  4Y29 A;  3V4A A;  4NUF A;  1S0X A;  2PIX A;  4FGY A;  1U3R A;  5DXB B;  5E0X A;  1KV6 A;  3UVV B;  5FQP A;  2R40 A;  1Z95 A;  4OEY A;  4P6W A;  5DKS A;  4OFU A;  4S15 A;  5C4T A;  4DK7 A;  4TV1 A;  3HOD A;  4JL4 A;  2Z4J A;  2O9I A;  2QPY A;  2XYX A;  3OOK A;  3A2J A;  3FC6 B;  1I37 A;  3VHU A;  3JZC A;  1T73 A;  4PP6 A;  3RUU A;  2AXA A;  3K23 A;  3A9E B;  1M2Z A;  5EHJ A;  3OLS A;  2XYJ A;  2G5O A;  4HEE X;  1XJ7 A;  4FN9 A;  5JY3 A;  3PRG A;  4ZNH A;  3MNE A;  4MG7 A;  1S9Q A;  3OKH A;  2FAI A;  3E00 D;  1S0Z A;  4PLE A;  4UDB A;  3R29 A;  5LGA A;  1QKN A;  5JI0 D;  5ICK A;  3WFG A;  3X1H A;  2AAX A;  4IW8 A;  2QNV A;  3ET3 A;  1S9P A;  2OVH A;  1XOW A;  2BJ4 A;  1RJK A;  3IPU A;  3L0J A;  4J5X A;  4L98 A;  5AK2 A;  5HJP B;  1NUO A;  3OSW A;  3HLV A;  3F5C B;  1QKT A;  3K8S A;  3OMQ A;  1FCY A;  3OSA A;  3DR1 A;  4EM9 A;  5I4V A;  2VV4 A;  2P7A A;  3FS1 A;  3D6D A;  1XV9 A;  5EJV A;  2VST A;  4G2H A;  1NRL A;  2P7Z A;  5HCV A;  3VSO A;  1NAV A;  1YIM A;  2VV2 A;  1YOW A;  2Q1V A;  4MG8 B;  4A4W A;  1GWX A;  1N46 A;  5G44 A;  1T79 A;  2P1V A;  3KMG A;  3WT5 A;  1T7T A;  3A2H A;  4A4V A;  2G0G A;  5KRK A;  4WHF A;  3OMK A;  4N5G A;  4OHA A;  3UP3 A;  1YUC A;  3GWX A;  3CDS A;  3DCT A;  4EMA A;  5E1C A;  3VRT A;  1NYX A;  2XKW A;  3V3E A;  3R5N A;  3ZQT A;  3B0W A;  1SKX A;  2ZK0 A;  1QKU A;  5G3J A;  3IPQ A;  3DZY A;  4DMA A;  4N73 A;  1NQ1 A;  1ZGY A;  3FEJ A;  4J5X C;  4JYH A;  2I0J A;  2IHQ A;  2ZAS A;  5DKE A;  3WWR A;  2HBH A;  5DUG A;  2YHD A;  1T65 A;  2ZMI A;  5E7V A;  4MGD B;  4MG9 B;  4S0T A;  2QE4 A;  3VN2 A;  2P15 A;  2QZO B;  5FQR A;  1OT7 A;  4RE8 A;  4YMQ A;  2PIO A;  5G42 A;  3WMH A;  4BCR A;  5DXQ A;  2ZXM A;  5DTV A;  1OVL A;  3UU7 A;  3SP9 A;  2PIV A;  5GIE A;  3HZF A;  4PPS A;  2VV3 A;  2PIR A;  4QM0 A;  2Q7K A;  5DU5 A;  1T7M A;  1HG4 A;  3ERD A;  2VSR A;  3FUR A;  5DX3 B;  2ZNN A;  4RWV A;  5G5W A;  4OZT E;  1TXI A;  5HYR A;  2NXX E;  5CJ6 A;  1S19 A;  4ZNV A;  3SZ1 A;  3ZRA A;  2I0G A;  3UUC A;  4REE A;  5APK A;  4E4K A;  3KFC A;  3OLL A;  3B0T A;  4K4J A;  3OMM A;  4NIE A;  5C4U A;  2W8Y A;  1FBY A;  4UDA A;  3AFR A;  2JFA A;  4PP5 A;  4M8E A;  5G43 A;  2HWR A;  4MGA A;  2QA8 B;  3JZB A;  3NSQ A;  3UUD A;  3KMR A;  3R5M A;  4J26 A;  3VHW A;  4KZI A;  3DZY D;  1IE9 A;  2HAR A;  4IU7 A;  2J7Y A;  1R20 A;  3WT7 A;  1SR7 A;  1PK5 A;  3RUT A;  4IW6 A;  3OAP A;  3O1E A;  4FHI A;  3W5P A;  3PLZ A;  2REW A;  5KRO A;  1YA3 A;  2OAX A;  2OUZ A;  5DXB A;  2PIU A;  3UVV A;  1TFC A;  2PNU A;  3D5F A;  4ZJW A;  2QMV A;  3A40 X;  3AZ3 A;  3Q95 B;  1X7R A;  1U3Q A;  3GYU A;  3KBA A;  4MG6 A;  2E2R A;  5DKG A;  2AA7 A;  1T7F A;  2POB A;  3MNP A;  3DZU A;  3RY9 A;  4RZG A;  1ZDT A;  1G2N A;  4OZR U;  3VT6 A;  5AWJ A;  3FC6 A;  2ZFX A;  2HVC A;  2Q61 A;  3WT6 A;  4CI4 A;  3B0R A;  3L03 A;  4PF3 A;  2AA6 A;  3A9E A;  5DL4 A;  2PIT A;  2Q8S A;  3OZJ A;  4R2U A;  5HZC A;  1ERE A;  1GWQ A;  5KCF A;  1M7W A;  1YP0 A;  4IV4 A;  5DV6 A;  1P8D A;  5AYG A;  5DXP A;  5GT4 A;  5JJM B;  1XNX A;  2GTK A;  1NQ7 A;  3VT9 A;  3K6P A;  4R06 A;  3P8X A;  5DZ1 A;  5APJ A;  5KCE A;  3KWY A;  2I4J A;  2YFE A;  2ZXZ A;  4IWF A;  4JGV A;  1R20 D;  1UPW A;  2AX7 A;  4OIL A;  5ETH A;  1Z5X U;  5HJP A;  2Q70 A;  3OS8 C;  1G1U A;  4KZJ A;  1WM0 X;  1XDK B;  2B50 A;  2YAT A;  3G8I A;  4POH A;  3F5C A;  2AM9 A;  3B1M A;  4OZT U;  5G45 A;  3G9E A;  3GYT A;  5GID A;  5KRA A;  1PZL A;  1A28 A;  4ZO1 X;  2NPA A;  4P6X A;  2GPV A;  1XB7 A;  2NXX A;  1PQ9 A;  2POG A;  5DYD A;  2AX9 A;  4RZE A;  5DUH A;  3WGP A;  4MG8 A;  3CWD A;  5A86 A;  3DZU D;  1DKF B;  1NQ2 A;  2YLQ A;  2Q59 B;  3PO9 A;  4ZJR A;  5AVL A;  1M13 A;  4RAK A;  4XT9 A;  1PCG A;  2QR9 A;  2A3I A;  2O4J A;  4LNW A;  3L3Z A;  3R8I A;  2JJ3 A;  3G0W A;  1ZDU A;  1ZH7 A;  1T7R A;  2YLP A;  1XQC A;  3B65 A;  1YY4 A;  3B66 A;  2ZL9 A;  4OIU A;  4X1G A;  3CLD A;  4OEA A;  3OGT A;  4NQA B;  4MGC A;  4J24 A;  1X7E A;  1YYE A;  2R40 D;  4WHG A;  3HO0 A;  1FM6 A;  3VRV A;  5SYZ A;  4G21 A;  5E19 A;  2GPU A;  2JF9 A;  3D90 A;  4K7A A;  5DID A;  5KD9 A;  2ZK3 A;  3ERT A;  1EXX A;  4FHH A;  4MGD A;  4MG9 A;  4RUO X;  5DLR A;  3VJH A;  2NV7 A;  2QZO A;  2ZK2 A;  3W5Q A;  3L0L A;  3DT3 A;  2PKL A;  4OFR A;  1T5Z A;  3CS6 A;  3LMP A;  2P54 A;  5DV3 A;  4CSJ A;  4ZNT A;  3GZ9 A;  3MNO A;  2GPP A;  4IA7 A;  2Q7I A;  1ERR A;  3OMO A;  4M8H A;  1K74 A;  1XZX X;  4O8F A;  3ADX A;  1T76 A;  5EGV A;  4E4Q A;  5KRC A;  3RVF A;  2I4Z A;  5DZ0 A;  5DX3 A;  2I4P A;  5AAV B;  5APH A;  3HM1 A;  1G5Y A;  2Q5S A;  3B67 A;  1FD0 A;  1XPC A;  1PDU A;  1VJB A;  2QA8 A;  4XTA A;  3FAL B;  4LSJ A;  1N4H A;  3W0H A;  5B41 A;  5KYJ A;  2Z4B A;  2NW4 A;  4DOR A;  5L11 A;  1K7L A;  2ZLA A;  4RMC A;  3ADV A;  2ACL B;  1T63 A;  1DB1 A;  4DK8 A;  2HWQ A;  2AWH A;  4RUJ A;  5DKB A;  5DV8 A;  3V3Q A;  1OSH A;  3X31 A;  3ET0 A;  3E94 A;  1XP6 A;  2VV1 B;  3AZ2 A;  3IPS A;  3W0I A;  3WJ5 A;  1EXA A;  3P89 A;  3Q95 A;  3VSP A;  4N1Y A;  1XVP B;  1HJ1 A;  5KRH A;  1XLS E;  2PIQ A;  2H79 A;  4QJR A;  3OS9 A;  2F4B A;  3PBA A;  4G2I A;  5EC9 A;  3FUG A;  5DUE A;  3AX8 A; 
#chains in the Genus database with same CATH topology
 5KCT A;  4PP3 A;  1RKH A;  5DWI A;  1K74 D;  2HFP A;  1NQ0 A;  1ZEO A;  5KRJ A;  3CDP A;  1XIU A;  4PRG A;  2G0H A;  3A2I A;  2OCF A;  2P1U A;  4PLD A;  2ZK6 A;  4OKT A;  2Q3Y A;  3RLJ A;  5L7G A;  4JAZ A;  1E3G A;  4ZI1 A;  5HYK A;  4DM8 A;  1X78 A;  3FLI A;  3VTC A;  3CQV A;  3VTD A;  5E0W A;  5IZ0 A;  3VT8 A;  5JJM A;  5KYA A;  2P7G A;  3BC5 A;  4XI3 A;  4HLW A;  2ZNO A;  2AA5 A;  1Q4X A;  5DZ3 A;  3V9Y A;  2YJA B;  3P0U A;  1Y0X X;  2ZY0 A;  4ZN7 A;  4IVY A;  3H0A A;  5DRM A;  4OKW A;  4IWC A;  4WVD A;  4OH5 A;  5IAW A;  3GWS X;  2PJL A;  2AA2 A;  3AUR A;  1XDK A;  4QK4 A;  2ZMH A;  3OLF A;  4TUZ B;  5F9B A;  4YPQ A;  5ACC A;  5K13 A;  2QTU A;  2V7C A;  2ZNQ A;  4IS8 A;  4PVU A;  2XHS A;  1OSV A;  3AN4 A;  5DSH A;  4MG5 A;  2PRG A;  4APU A;  2R6W A;  4IUI A;  5DWG A;  2J4A A;  3U9Q A;  3UUA B;  1UOM A;  3FEI A;  3FXV A;  4G1Y A;  3W0J A;  5DI7 A;  4UDC A;  3IXP A;  2B1V A;  2Q5G A;  4X1F A;  4N8R A;  1UHL B;  2LBD A;  4OIV A;  1DKF A;  3AUN A;  4ZNW A;  5E14 A;  5AWK A;  3TY0 A;  2Q59 A;  1XNN A;  3IMY A;  4ITE A;  2EWP A;  2GIU A;  3IA6 A;  3ZR7 A;  3UP0 A;  3HC6 A;  5EIT A;  3QT0 A;  4J5W A;  1U9E A;  1ILH A;  1XAP A;  3SP6 A;  5DP0 A;  4RMD A;  2HB8 A;  2ZVT A;  3W0G A;  1XQ3 A;  1R6G A;  2P4Y A;  3KMZ A;  4NY9 A;  3GN8 A;  3VI8 A;  2YJD A;  4FNE A;  3NSP A;  3VT4 A;  5DVC A;  5KR9 A;  4REF A;  1UPV A;  1XLS A;  2Q6R A;  4G1Z A;  5DYB A;  3AN3 A;  1PRG A;  3H0A D;  5DMC A;  5DZI A;  3D57 A;  3O1D A;  2OVM A;  5DK9 A;  3RLL A;  3VRW A;  3VT7 A;  2ABI A;  2QXS A;  3VJS A;  1GS4 A;  1YMT A;  3A3Z X;  1PQC A;  4IA2 A;  1LV2 A;  1RK3 A;  2QGW A;  3NOA A;  3VT3 A;  3WFF A;  2GPO A;  4IA1 A;  1I7G A;  4MGB B;  4XAO A;  1YIN A;  4J5W C;  3IXP D;  3OZ0 A;  2AO6 A;  3WJ4 A;  4ZO1 B;  1FM9 A;  3F7D A;  4WPF A;  3ADW A;  2AX6 A;  3G8O A;  4OK1 A;  4PWL A;  4Q13 A;  5E15 A;  4QE6 A;  3D24 A;  3W0Y A;  4NB6 A;  4K6I A;  4S0S A;  3VT5 A;  4OJ9 A;  3KYT A;  1NDE A;  3BEJ A;  5AAV A;  2G44 A;  4G20 A;  3R8A A;  5KCU A;  1R1K A;  4LBD A;  1KNU A;  4ITF A;  5DWJ A;  1BSX A;  2VV0 A;  2XYW A;  1L2J A;  1MVC A;  5DXE A;  3W5T A;  1I38 A;  1KKQ A;  4ZOM A;  2ZKC A;  1XP9 A;  3L3X A;  3FAL A;  4LTW A;  1IE8 A;  2GL8 A;  1P93 A;  2J7X A;  4DOS A;  2B23 A;  3N00 A;  5KCC A;  1RDT A;  2ZXN A;  4OLM A;  1YJE A;  2ACL A;  2Q5P A;  2QSE A;  3AUQ A;  4XLD A;  2HAM A;  4OKX A;  3GBK A;  1QKM A;  5DXM A;  2PIP L;  4QL8 A;  5FQS A;  3GD2 A;  3OMP A;  2AMA A;  2Q6S A;  2VV1 A;  4ONI A;  1L2I A;  1PQ6 A;  4TV1 B;  1LBD A;  5DVV A;  1SJ0 A;  2OM9 A;  3EYB A;  1SQN A;  3ET2 A;  2YLY A;  2OZ7 A;  2Q60 A;  3M7R A;  4POJ A;  5KCD A;  1XVP A;  3ADU A;  4RFW A;  5EI1 A;  3ZRB A;  5DVS A;  5L7H A;  4CI5 A;  3VJI A;  2QW4 A;  3DCU A;  3CS4 A;  4XHD A;  4QE8 A;  2Q7L A;  3BQD A;  5C4O A;  4WQP A;  5FQV A;  4MG7 B;  1FM9 D;  1XP1 A;  3R8D A;  2HC4 A;  2ZNP A;  3OOF A;  4OKB A;  4R6S A;  4ZNU A;  3OSI A;  2IOK A;  1R1K D;  1FM6 D;  5DWE A;  4ZNS A;  2ZK5 A;  4MDD A;  2BJ4 B;  2IOG A;  1X76 A;  1X7J A;  1I7I A;  5B5B A;  3W0A A;  2ZLC A;  4OZR E;  2H77 A;  5H1E A;  2VV4 B;  1RDT D;  4IA3 A;  5DMF A;  3DY6 A;  2QA6 A;  4Q50 A;  5AAU A;  1XV9 B;  3KPZ A;  5DY8 A;  1ZKY A;  2Q6J A;  4KZM A;  1G50 A;  4TUZ A;  5L7E A;  4ZN9 A;  1MV9 A;  2AMB A;  2B1Z A;  2AB2 A;  4OJB A;  3VHV A;  4IQR A;  1FCX A;  2QH6 A;  4JYG A;  4L96 A;  5DZH A;  3LBD A;  4OAR A;  3CS8 A;  5DXR A;  3R2A A;  3B68 A;  4PXM A;  3W5R A;  1NHZ A;  2J14 A;  2ZBS A;  3UUA A;  3CTB A;  3A78 A;  3ADT A;  2PIN A;  4OC7 A;  4XUM A;  4F9M A;  1MZN A;  3B0Q A;  3HVL A;  3PEQ A;  1Y0S A;  2Q7J A;  3VTB A;  5KRL A;  3S9S A;  2ZMJ A;  5IXK A;  1UHL A;  1E3K A;  3ADS A;  4OGH A;  2Q1H A;  4OJ4 A;  5KRI A;  4XUH A;  5GIC A;  4OH6 A;  1Z5X E;  5AZV A;  4RZF A;  3B3K A;  2O4R A;  4RME A;  5AVI A;  3K22 A;  3PCU A;  3HC5 A;  2ZK4 A;  2YLO A;  3TX7 B;  4YT1 A;  2ZK1 A;  5DXG A;  1Y9R A;  2FVJ A;  4LNX A;  1A52 A;  5DWL A;  3T03 A;  2AYR A;  2HCD A;  4IVW A;  3H52 A;  3W0C A;  3V9V A;  2ATH A;  3HQ5 A;  4Q0A C;  5C4S A;  3OKI A;  3X1I A;  4A2J A;  1H9U A;  4RUP A;  3ET1 A;  3TKM A;  4DQM A;  1U3S A;  1OVL B;  3VJT A;  1YOK A;  3ILZ A;  5DXK A;  3UU7 B;  2FSZ A;  5DRJ A;  3VRU A;  3X36 A;  5KRM A;  5KRF A;  3CJW A;  1ZAF A;  1R5K A;  2PIW A;  5FQT A;  4E2J A;  2HB7 A;  3B5R A;  4JYI A;  4PPP A;  1X7B A;  5DIE A;  1ILG A;  4G1D A;  2GP7 A;  4OEZ A;  5LWP A;  2R6Y A;  5G46 A;  2QAB A;  1FCZ A;  3OS8 A;  4B7W A;  1K4W A;  4DM6 A;  5KCW A;  4MGB A;  1GWR A;  2GWX A;  5M96 A;  3TKC A;  2QGT A;  1T74 A;  2P1T A;  3AZ1 A;  3KDU A;  1ZUC A;  2HAS A;  1NAX A;  3L0E A;  4UDD A;  5DIG A;  4OED A;  3E00 A;  3V49 A;  2JFA B;  2QXM A;  3V9T A;  4MGA B;  3L1B A;  1N83 A;  4WLB A;  5AZT A;  3UUD B;  4S14 A;  4YNK A;  3E7C A;  3KDT A;  3P88 A;  5HJS A;  2AX8 A;  2BAW A;  3WTQ A;  4IV2 A;  1RKG A;  2V0V A;  4Y29 A;  3V4A A;  4NUF A;  1S0X A;  2PIX A;  4FGY A;  1U3R A;  5DXB B;  5E0X A;  1KV6 A;  3UVV B;  5FQP A;  2R40 A;  1Z95 A;  4OEY A;  4P6W A;  5DKS A;  4OFU A;  4S15 A;  5C4T A;  4DK7 A;  4TV1 A;  3HOD A;  4JL4 A;  2Z4J A;  2O9I A;  2QPY A;  2XYX A;  3OOK A;  3A2J A;  3FC6 B;  1I37 A;  3VHU A;  3JZC A;  1T73 A;  4PP6 A;  3RUU A;  2AXA A;  3K23 A;  3A9E B;  1M2Z A;  5EHJ A;  3OLS A;  2XYJ A;  2G5O A;  4HEE X;  1XJ7 A;  4FN9 A;  5JY3 A;  3PRG A;  4ZNH A;  3MNE A;  4MG7 A;  1S9Q A;  3OKH A;  2FAI A;  3E00 D;  1S0Z A;  4PLE A;  4UDB A;  3R29 A;  5LGA A;  1QKN A;  5JI0 D;  5ICK A;  3WFG A;  3X1H A;  2AAX A;  4IW8 A;  2QNV A;  3ET3 A;  1S9P A;  2OVH A;  1XOW A;  2BJ4 A;  1RJK A;  3IPU A;  3L0J A;  4J5X A;  4L98 A;  5AK2 A;  5HJP B;  1NUO A;  3OSW A;  3HLV A;  3F5C B;  1QKT A;  3K8S A;  3OMQ A;  1FCY A;  3OSA A;  3DR1 A;  4EM9 A;  5I4V A;  2VV4 A;  2P7A A;  3FS1 A;  3D6D A;  1XV9 A;  5EJV A;  2VST A;  4G2H A;  1NRL A;  2P7Z A;  5HCV A;  3VSO A;  1NAV A;  1YIM A;  2VV2 A;  1YOW A;  2Q1V A;  4MG8 B;  4A4W A;  1GWX A;  1N46 A;  5G44 A;  1T79 A;  2P1V A;  3KMG A;  3WT5 A;  1T7T A;  3A2H A;  4A4V A;  2G0G A;  5KRK A;  4WHF A;  3OMK A;  4N5G A;  4OHA A;  3UP3 A;  1YUC A;  3GWX A;  3CDS A;  3DCT A;  4EMA A;  5E1C A;  3VRT A;  1NYX A;  2XKW A;  3V3E A;  3R5N A;  3ZQT A;  3B0W A;  1SKX A;  2ZK0 A;  1QKU A;  5G3J A;  3IPQ A;  3DZY A;  4DMA A;  4N73 A;  1NQ1 A;  1ZGY A;  3FEJ A;  4J5X C;  4JYH A;  2I0J A;  2IHQ A;  2ZAS A;  5DKE A;  3WWR A;  2HBH A;  5DUG A;  2YHD A;  1T65 A;  2ZMI A;  5E7V A;  4MGD B;  4MG9 B;  4S0T A;  2QE4 A;  3VN2 A;  2P15 A;  2QZO B;  5FQR A;  1OT7 A;  4RE8 A;  4YMQ A;  2PIO A;  5G42 A;  3WMH A;  4BCR A;  5DXQ A;  2ZXM A;  5DTV A;  1OVL A;  3UU7 A;  3SP9 A;  2PIV A;  5GIE A;  3HZF A;  4PPS A;  2VV3 A;  2PIR A;  4QM0 A;  2Q7K A;  5DU5 A;  1T7M A;  1HG4 A;  3ERD A;  2VSR A;  3FUR A;  5DX3 B;  2ZNN A;  4RWV A;  5G5W A;  4OZT E;  1TXI A;  5HYR A;  2NXX E;  5CJ6 A;  1S19 A;  4ZNV A;  3SZ1 A;  3ZRA A;  2I0G A;  3UUC A;  4REE A;  5APK A;  4E4K A;  3KFC A;  3OLL A;  3B0T A;  4K4J A;  3OMM A;  4NIE A;  5C4U A;  2W8Y A;  1FBY A;  4UDA A;  3AFR A;  2JFA A;  4PP5 A;  4M8E A;  5G43 A;  2HWR A;  4MGA A;  2QA8 B;  3JZB A;  3NSQ A;  3UUD A;  3KMR A;  3R5M A;  4J26 A;  3VHW A;  4KZI A;  3DZY D;  1IE9 A;  2HAR A;  4IU7 A;  2J7Y A;  1R20 A;  3WT7 A;  1SR7 A;  1PK5 A;  3RUT A;  4IW6 A;  3OAP A;  3O1E A;  4FHI A;  3W5P A;  3PLZ A;  2REW A;  5KRO A;  1YA3 A;  2OAX A;  2OUZ A;  5DXB A;  2PIU A;  3UVV A;  1TFC A;  2PNU A;  3D5F A;  4ZJW A;  2QMV A;  3A40 X;  3AZ3 A;  3Q95 B;  1X7R A;  1U3Q A;  3GYU A;  3KBA A;  4MG6 A;  2E2R A;  5DKG A;  2AA7 A;  1T7F A;  2POB A;  3MNP A;  3DZU A;  3RY9 A;  4RZG A;  1ZDT A;  1G2N A;  4OZR U;  3VT6 A;  5AWJ A;  3FC6 A;  2ZFX A;  2HVC A;  2Q61 A;  3WT6 A;  4CI4 A;  3B0R A;  3L03 A;  4PF3 A;  2AA6 A;  3A9E A;  5DL4 A;  2PIT A;  2Q8S A;  3OZJ A;  4R2U A;  5HZC A;  1ERE A;  1GWQ A;  5KCF A;  1M7W A;  1YP0 A;  4IV4 A;  5DV6 A;  1P8D A;  5AYG A;  5DXP A;  5GT4 A;  5JJM B;  1XNX A;  2GTK A;  1NQ7 A;  3VT9 A;  3K6P A;  4R06 A;  3P8X A;  5DZ1 A;  5APJ A;  5KCE A;  3KWY A;  2I4J A;  2YFE A;  2ZXZ A;  4IWF A;  4JGV A;  1R20 D;  1UPW A;  2AX7 A;  4OIL A;  5ETH A;  1Z5X U;  5HJP A;  2Q70 A;  3OS8 C;  1G1U A;  4KZJ A;  1WM0 X;  1XDK B;  2B50 A;  2YAT A;  3G8I A;  4POH A;  3F5C A;  2AM9 A;  3B1M A;  4OZT U;  5G45 A;  3G9E A;  3GYT A;  5GID A;  5KRA A;  1PZL A;  1A28 A;  4ZO1 X;  2NPA A;  4P6X A;  2GPV A;  1XB7 A;  2NXX A;  1PQ9 A;  2POG A;  5DYD A;  2AX9 A;  4RZE A;  5DUH A;  3WGP A;  4MG8 A;  3CWD A;  5A86 A;  3DZU D;  1DKF B;  1NQ2 A;  2YLQ A;  2Q59 B;  3PO9 A;  4ZJR A;  5AVL A;  1M13 A;  4RAK A;  4XT9 A;  1PCG A;  2QR9 A;  2A3I A;  2O4J A;  4LNW A;  3L3Z A;  3R8I A;  2JJ3 A;  3G0W A;  1ZDU A;  1ZH7 A;  1T7R A;  2YLP A;  1XQC A;  3B65 A;  1YY4 A;  3B66 A;  2ZL9 A;  4OIU A;  4X1G A;  3CLD A;  4OEA A;  3OGT A;  4NQA B;  4MGC A;  4J24 A;  1X7E A;  1YYE A;  2R40 D;  4WHG A;  3HO0 A;  1FM6 A;  3VRV A;  5SYZ A;  4G21 A;  5E19 A;  2GPU A;  2JF9 A;  3D90 A;  4K7A A;  5DID A;  5KD9 A;  2ZK3 A;  3ERT A;  1EXX A;  4FHH A;  4MGD A;  4MG9 A;  4RUO X;  5DLR A;  3VJH A;  2NV7 A;  2QZO A;  2ZK2 A;  3W5Q A;  3L0L A;  3DT3 A;  2PKL A;  4OFR A;  1T5Z A;  3CS6 A;  3LMP A;  2P54 A;  5DV3 A;  4CSJ A;  4ZNT A;  3GZ9 A;  3MNO A;  2GPP A;  4IA7 A;  2Q7I A;  1ERR A;  3OMO A;  4M8H A;  1K74 A;  1XZX X;  4O8F A;  3ADX A;  1T76 A;  5EGV A;  4E4Q A;  5KRC A;  3RVF A;  2I4Z A;  5DZ0 A;  5DX3 A;  2I4P A;  5AAV B;  5APH A;  3HM1 A;  1G5Y A;  2Q5S A;  3B67 A;  1FD0 A;  1XPC A;  1PDU A;  1VJB A;  2QA8 A;  4XTA A;  3FAL B;  4LSJ A;  1N4H A;  3W0H A;  5B41 A;  5KYJ A;  2Z4B A;  2NW4 A;  4DOR A;  5L11 A;  1K7L A;  2ZLA A;  4RMC A;  3ADV A;  2ACL B;  1T63 A;  1DB1 A;  4DK8 A;  2HWQ A;  2AWH A;  4RUJ A;  5DKB A;  5DV8 A;  3V3Q A;  1OSH A;  3X31 A;  3ET0 A;  3E94 A;  1XP6 A;  2VV1 B;  3AZ2 A;  3IPS A;  3W0I A;  3WJ5 A;  1EXA A;  3P89 A;  3Q95 A;  3VSP A;  4N1Y A;  1XVP B;  1HJ1 A;  5KRH A;  1XLS E;  2PIQ A;  2H79 A;  4QJR A;  3OS9 A;  2F4B A;  3PBA A;  4G2I A;  5EC9 A;  3FUG A;  5DUE A;  3AX8 A; 
#chains in the Genus database with same CATH homology
 5KCT A;  4PP3 A;  1RKH A;  5DWI A;  1K74 D;  2HFP A;  1NQ0 A;  1ZEO A;  5KRJ A;  3CDP A;  1XIU A;  4PRG A;  2G0H A;  3A2I A;  2OCF A;  2P1U A;  4PLD A;  2ZK6 A;  4OKT A;  2Q3Y A;  3RLJ A;  5L7G A;  4JAZ A;  1E3G A;  4ZI1 A;  5HYK A;  4DM8 A;  1X78 A;  3FLI A;  3VTC A;  3CQV A;  3VTD A;  5E0W A;  5IZ0 A;  3VT8 A;  5JJM A;  5KYA A;  2P7G A;  3BC5 A;  4XI3 A;  4HLW A;  2ZNO A;  2AA5 A;  1Q4X A;  5DZ3 A;  3V9Y A;  2YJA B;  3P0U A;  1Y0X X;  2ZY0 A;  4ZN7 A;  4IVY A;  3H0A A;  5DRM A;  4OKW A;  4IWC A;  4WVD A;  4OH5 A;  5IAW A;  3GWS X;  2PJL A;  2AA2 A;  3AUR A;  1XDK A;  4QK4 A;  2ZMH A;  3OLF A;  4TUZ B;  5F9B A;  4YPQ A;  5ACC A;  5K13 A;  2QTU A;  2V7C A;  2ZNQ A;  4IS8 A;  4PVU A;  2XHS A;  1OSV A;  3AN4 A;  5DSH A;  4MG5 A;  2PRG A;  4APU A;  2R6W A;  4IUI A;  5DWG A;  2J4A A;  3U9Q A;  3UUA B;  1UOM A;  3FEI A;  3FXV A;  4G1Y A;  3W0J A;  5DI7 A;  4UDC A;  3IXP A;  2B1V A;  2Q5G A;  4X1F A;  4N8R A;  1UHL B;  2LBD A;  4OIV A;  1DKF A;  3AUN A;  4ZNW A;  5E14 A;  5AWK A;  3TY0 A;  2Q59 A;  1XNN A;  3IMY A;  4ITE A;  2EWP A;  2GIU A;  3IA6 A;  3ZR7 A;  3UP0 A;  3HC6 A;  5EIT A;  3QT0 A;  4J5W A;  1U9E A;  1ILH A;  1XAP A;  3SP6 A;  5DP0 A;  4RMD A;  2HB8 A;  2ZVT A;  3W0G A;  1XQ3 A;  1R6G A;  2P4Y A;  3KMZ A;  4NY9 A;  3GN8 A;  3VI8 A;  2YJD A;  4FNE A;  3NSP A;  3VT4 A;  5DVC A;  5KR9 A;  4REF A;  1UPV A;  1XLS A;  2Q6R A;  4G1Z A;  5DYB A;  3AN3 A;  1PRG A;  3H0A D;  5DMC A;  5DZI A;  3D57 A;  3O1D A;  2OVM A;  5DK9 A;  3RLL A;  3VRW A;  3VT7 A;  2ABI A;  2QXS A;  3VJS A;  1GS4 A;  1YMT A;  3A3Z X;  1PQC A;  4IA2 A;  1LV2 A;  1RK3 A;  2QGW A;  3NOA A;  3VT3 A;  3WFF A;  2GPO A;  4IA1 A;  1I7G A;  4MGB B;  4XAO A;  1YIN A;  4J5W C;  3IXP D;  3OZ0 A;  2AO6 A;  3WJ4 A;  4ZO1 B;  1FM9 A;  3F7D A;  4WPF A;  3ADW A;  2AX6 A;  3G8O A;  4OK1 A;  4PWL A;  4Q13 A;  5E15 A;  4QE6 A;  3D24 A;  3W0Y A;  4NB6 A;  4K6I A;  4S0S A;  3VT5 A;  4OJ9 A;  3KYT A;  1NDE A;  3BEJ A;  5AAV A;  2G44 A;  4G20 A;  3R8A A;  5KCU A;  1R1K A;  4LBD A;  1KNU A;  4ITF A;  5DWJ A;  1BSX A;  2VV0 A;  2XYW A;  1L2J A;  1MVC A;  5DXE A;  3W5T A;  1I38 A;  1KKQ A;  4ZOM A;  2ZKC A;  1XP9 A;  3L3X A;  3FAL A;  4LTW A;  1IE8 A;  2GL8 A;  1P93 A;  2J7X A;  4DOS A;  2B23 A;  3N00 A;  5KCC A;  1RDT A;  2ZXN A;  4OLM A;  1YJE A;  2ACL A;  2Q5P A;  2QSE A;  3AUQ A;  4XLD A;  2HAM A;  4OKX A;  3GBK A;  1QKM A;  5DXM A;  2PIP L;  4QL8 A;  5FQS A;  3GD2 A;  3OMP A;  2AMA A;  2Q6S A;  2VV1 A;  4ONI A;  1L2I A;  1PQ6 A;  4TV1 B;  1LBD A;  5DVV A;  1SJ0 A;  2OM9 A;  3EYB A;  1SQN A;  3ET2 A;  2YLY A;  2OZ7 A;  2Q60 A;  3M7R A;  4POJ A;  5KCD A;  1XVP A;  3ADU A;  4RFW A;  5EI1 A;  3ZRB A;  5DVS A;  5L7H A;  4CI5 A;  3VJI A;  2QW4 A;  3DCU A;  3CS4 A;  4XHD A;  4QE8 A;  2Q7L A;  3BQD A;  5C4O A;  4WQP A;  5FQV A;  4MG7 B;  1FM9 D;  1XP1 A;  3R8D A;  2HC4 A;  2ZNP A;  3OOF A;  4OKB A;  4R6S A;  4ZNU A;  3OSI A;  2IOK A;  1R1K D;  1FM6 D;  5DWE A;  4ZNS A;  2ZK5 A;  4MDD A;  2BJ4 B;  2IOG A;  1X76 A;  1X7J A;  1I7I A;  5B5B A;  3W0A A;  2ZLC A;  4OZR E;  2H77 A;  5H1E A;  2VV4 B;  1RDT D;  4IA3 A;  5DMF A;  3DY6 A;  2QA6 A;  4Q50 A;  5AAU A;  1XV9 B;  3KPZ A;  5DY8 A;  1ZKY A;  2Q6J A;  4KZM A;  1G50 A;  4TUZ A;  5L7E A;  4ZN9 A;  1MV9 A;  2AMB A;  2B1Z A;  2AB2 A;  4OJB A;  3VHV A;  4IQR A;  1FCX A;  2QH6 A;  4JYG A;  4L96 A;  5DZH A;  3LBD A;  4OAR A;  3CS8 A;  5DXR A;  3R2A A;  3B68 A;  4PXM A;  3W5R A;  1NHZ A;  2J14 A;  2ZBS A;  3UUA A;  3CTB A;  3A78 A;  3ADT A;  2PIN A;  4OC7 A;  4XUM A;  4F9M A;  1MZN A;  3B0Q A;  3HVL A;  3PEQ A;  1Y0S A;  2Q7J A;  3VTB A;  5KRL A;  3S9S A;  2ZMJ A;  5IXK A;  1UHL A;  1E3K A;  3ADS A;  4OGH A;  2Q1H A;  4OJ4 A;  5KRI A;  4XUH A;  5GIC A;  4OH6 A;  1Z5X E;  5AZV A;  4RZF A;  3B3K A;  2O4R A;  4RME A;  5AVI A;  3K22 A;  3PCU A;  3HC5 A;  2ZK4 A;  2YLO A;  3TX7 B;  4YT1 A;  2ZK1 A;  5DXG A;  1Y9R A;  2FVJ A;  4LNX A;  1A52 A;  5DWL A;  3T03 A;  2AYR A;  2HCD A;  4IVW A;  3H52 A;  3W0C A;  3V9V A;  2ATH A;  3HQ5 A;  4Q0A C;  5C4S A;  3OKI A;  3X1I A;  4A2J A;  1H9U A;  4RUP A;  3ET1 A;  3TKM A;  4DQM A;  1U3S A;  1OVL B;  3VJT A;  1YOK A;  3ILZ A;  5DXK A;  3UU7 B;  2FSZ A;  5DRJ A;  3VRU A;  3X36 A;  5KRM A;  5KRF A;  3CJW A;  1ZAF A;  1R5K A;  2PIW A;  5FQT A;  4E2J A;  2HB7 A;  3B5R A;  4JYI A;  4PPP A;  1X7B A;  5DIE A;  1ILG A;  4G1D A;  2GP7 A;  4OEZ A;  5LWP A;  2R6Y A;  5G46 A;  2QAB A;  1FCZ A;  3OS8 A;  4B7W A;  1K4W A;  4DM6 A;  5KCW A;  4MGB A;  1GWR A;  2GWX A;  5M96 A;  3TKC A;  2QGT A;  1T74 A;  2P1T A;  3AZ1 A;  3KDU A;  1ZUC A;  2HAS A;  1NAX A;  3L0E A;  4UDD A;  5DIG A;  4OED A;  3E00 A;  3V49 A;  2JFA B;  2QXM A;  3V9T A;  4MGA B;  3L1B A;  1N83 A;  4WLB A;  5AZT A;  3UUD B;  4S14 A;  4YNK A;  3E7C A;  3KDT A;  3P88 A;  5HJS A;  2AX8 A;  2BAW A;  3WTQ A;  4IV2 A;  1RKG A;  2V0V A;  4Y29 A;  3V4A A;  4NUF A;  1S0X A;  2PIX A;  4FGY A;  1U3R A;  5DXB B;  5E0X A;  1KV6 A;  3UVV B;  5FQP A;  2R40 A;  1Z95 A;  4OEY A;  4P6W A;  5DKS A;  4OFU A;  4S15 A;  5C4T A;  4DK7 A;  4TV1 A;  3HOD A;  4JL4 A;  2Z4J A;  2O9I A;  2QPY A;  2XYX A;  3OOK A;  3A2J A;  3FC6 B;  1I37 A;  3VHU A;  3JZC A;  1T73 A;  4PP6 A;  3RUU A;  2AXA A;  3K23 A;  3A9E B;  1M2Z A;  5EHJ A;  3OLS A;  2XYJ A;  2G5O A;  4HEE X;  1XJ7 A;  4FN9 A;  5JY3 A;  3PRG A;  4ZNH A;  3MNE A;  4MG7 A;  1S9Q A;  3OKH A;  2FAI A;  3E00 D;  1S0Z A;  4PLE A;  4UDB A;  3R29 A;  5LGA A;  1QKN A;  5JI0 D;  5ICK A;  3WFG A;  3X1H A;  2AAX A;  4IW8 A;  2QNV A;  3ET3 A;  1S9P A;  2OVH A;  1XOW A;  2BJ4 A;  1RJK A;  3IPU A;  3L0J A;  4J5X A;  4L98 A;  5AK2 A;  5HJP B;  1NUO A;  3OSW A;  3HLV A;  3F5C B;  1QKT A;  3K8S A;  3OMQ A;  1FCY A;  3OSA A;  3DR1 A;  4EM9 A;  5I4V A;  2VV4 A;  2P7A A;  3FS1 A;  3D6D A;  1XV9 A;  5EJV A;  2VST A;  4G2H A;  1NRL A;  2P7Z A;  5HCV A;  3VSO A;  1NAV A;  1YIM A;  2VV2 A;  1YOW A;  2Q1V A;  4MG8 B;  4A4W A;  1GWX A;  1N46 A;  5G44 A;  1T79 A;  2P1V A;  3KMG A;  3WT5 A;  1T7T A;  3A2H A;  4A4V A;  2G0G A;  5KRK A;  4WHF A;  3OMK A;  4N5G A;  4OHA A;  3UP3 A;  1YUC A;  3GWX A;  3CDS A;  3DCT A;  4EMA A;  5E1C A;  3VRT A;  1NYX A;  2XKW A;  3V3E A;  3R5N A;  3ZQT A;  3B0W A;  1SKX A;  2ZK0 A;  1QKU A;  5G3J A;  3IPQ A;  3DZY A;  4DMA A;  4N73 A;  1NQ1 A;  1ZGY A;  3FEJ A;  4J5X C;  4JYH A;  2I0J A;  2IHQ A;  2ZAS A;  5DKE A;  3WWR A;  2HBH A;  5DUG A;  2YHD A;  1T65 A;  2ZMI A;  5E7V A;  4MGD B;  4MG9 B;  4S0T A;  2QE4 A;  3VN2 A;  2P15 A;  2QZO B;  5FQR A;  1OT7 A;  4RE8 A;  4YMQ A;  2PIO A;  5G42 A;  3WMH A;  4BCR A;  5DXQ A;  2ZXM A;  5DTV A;  1OVL A;  3UU7 A;  3SP9 A;  2PIV A;  5GIE A;  3HZF A;  4PPS A;  2VV3 A;  2PIR A;  4QM0 A;  2Q7K A;  5DU5 A;  1T7M A;  1HG4 A;  3ERD A;  2VSR A;  3FUR A;  5DX3 B;  2ZNN A;  4RWV A;  5G5W A;  4OZT E;  1TXI A;  5HYR A;  2NXX E;  5CJ6 A;  1S19 A;  4ZNV A;  3SZ1 A;  3ZRA A;  2I0G A;  3UUC A;  4REE A;  5APK A;  4E4K A;  3KFC A;  3OLL A;  3B0T A;  4K4J A;  3OMM A;  4NIE A;  5C4U A;  2W8Y A;  1FBY A;  4UDA A;  3AFR A;  2JFA A;  4PP5 A;  4M8E A;  5G43 A;  2HWR A;  4MGA A;  2QA8 B;  3JZB A;  3NSQ A;  3UUD A;  3KMR A;  3R5M A;  4J26 A;  3VHW A;  4KZI A;  3DZY D;  1IE9 A;  2HAR A;  4IU7 A;  2J7Y A;  1R20 A;  3WT7 A;  1SR7 A;  1PK5 A;  3RUT A;  4IW6 A;  3OAP A;  3O1E A;  4FHI A;  3W5P A;  3PLZ A;  2REW A;  5KRO A;  1YA3 A;  2OAX A;  2OUZ A;  5DXB A;  2PIU A;  3UVV A;  1TFC A;  2PNU A;  3D5F A;  4ZJW A;  2QMV A;  3A40 X;  3AZ3 A;  3Q95 B;  1X7R A;  1U3Q A;  3GYU A;  3KBA A;  4MG6 A;  2E2R A;  5DKG A;  2AA7 A;  1T7F A;  2POB A;  3MNP A;  3DZU A;  3RY9 A;  4RZG A;  1ZDT A;  1G2N A;  4OZR U;  3VT6 A;  5AWJ A;  3FC6 A;  2ZFX A;  2HVC A;  2Q61 A;  3WT6 A;  4CI4 A;  3B0R A;  3L03 A;  4PF3 A;  2AA6 A;  3A9E A;  5DL4 A;  2PIT A;  2Q8S A;  3OZJ A;  4R2U A;  5HZC A;  1ERE A;  1GWQ A;  5KCF A;  1M7W A;  1YP0 A;  4IV4 A;  5DV6 A;  1P8D A;  5AYG A;  5DXP A;  5GT4 A;  5JJM B;  1XNX A;  2GTK A;  1NQ7 A;  3VT9 A;  3K6P A;  4R06 A;  3P8X A;  5DZ1 A;  5APJ A;  5KCE A;  3KWY A;  2I4J A;  2YFE A;  2ZXZ A;  4IWF A;  4JGV A;  1R20 D;  1UPW A;  2AX7 A;  4OIL A;  5ETH A;  1Z5X U;  5HJP A;  2Q70 A;  3OS8 C;  1G1U A;  4KZJ A;  1WM0 X;  1XDK B;  2B50 A;  2YAT A;  3G8I A;  4POH A;  3F5C A;  2AM9 A;  3B1M A;  4OZT U;  5G45 A;  3G9E A;  3GYT A;  5GID A;  5KRA A;  1PZL A;  1A28 A;  4ZO1 X;  2NPA A;  4P6X A;  2GPV A;  1XB7 A;  2NXX A;  1PQ9 A;  2POG A;  5DYD A;  2AX9 A;  4RZE A;  5DUH A;  3WGP A;  4MG8 A;  3CWD A;  5A86 A;  3DZU D;  1DKF B;  1NQ2 A;  2YLQ A;  2Q59 B;  3PO9 A;  4ZJR A;  5AVL A;  1M13 A;  4RAK A;  4XT9 A;  1PCG A;  2QR9 A;  2A3I A;  2O4J A;  4LNW A;  3L3Z A;  3R8I A;  2JJ3 A;  3G0W A;  1ZDU A;  1ZH7 A;  1T7R A;  2YLP A;  1XQC A;  3B65 A;  1YY4 A;  3B66 A;  2ZL9 A;  4OIU A;  4X1G A;  3CLD A;  4OEA A;  3OGT A;  4NQA B;  4MGC A;  4J24 A;  1X7E A;  1YYE A;  2R40 D;  4WHG A;  3HO0 A;  1FM6 A;  3VRV A;  5SYZ A;  4G21 A;  5E19 A;  2GPU A;  2JF9 A;  3D90 A;  4K7A A;  5DID A;  5KD9 A;  2ZK3 A;  3ERT A;  1EXX A;  4FHH A;  4MGD A;  4MG9 A;  4RUO X;  5DLR A;  3VJH A;  2NV7 A;  2QZO A;  2ZK2 A;  3W5Q A;  3L0L A;  3DT3 A;  2PKL A;  4OFR A;  1T5Z A;  3CS6 A;  3LMP A;  2P54 A;  5DV3 A;  4CSJ A;  4ZNT A;  3GZ9 A;  3MNO A;  2GPP A;  4IA7 A;  2Q7I A;  1ERR A;  3OMO A;  4M8H A;  1K74 A;  1XZX X;  4O8F A;  3ADX A;  1T76 A;  5EGV A;  4E4Q A;  5KRC A;  3RVF A;  2I4Z A;  5DZ0 A;  5DX3 A;  2I4P A;  5AAV B;  5APH A;  3HM1 A;  1G5Y A;  2Q5S A;  3B67 A;  1FD0 A;  1XPC A;  1PDU A;  1VJB A;  2QA8 A;  4XTA A;  3FAL B;  4LSJ A;  1N4H A;  3W0H A;  5B41 A;  5KYJ A;  2Z4B A;  2NW4 A;  4DOR A;  5L11 A;  1K7L A;  2ZLA A;  4RMC A;  3ADV A;  2ACL B;  1T63 A;  1DB1 A;  4DK8 A;  2HWQ A;  2AWH A;  4RUJ A;  5DKB A;  5DV8 A;  3V3Q A;  1OSH A;  3X31 A;  3ET0 A;  3E94 A;  1XP6 A;  2VV1 B;  3AZ2 A;  3IPS A;  3W0I A;  3WJ5 A;  1EXA A;  3P89 A;  3Q95 A;  3VSP A;  4N1Y A;  1XVP B;  1HJ1 A;  5KRH A;  1XLS E;  2PIQ A;  2H79 A;  4QJR A;  3OS9 A;  2F4B A;  3PBA A;  4G2I A;  5EC9 A;  3FUG A;  5DUE A;  3AX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...