4EMAA

Human peroxisome proliferator-activated receptor gamma in complex with rosiglitazone
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
271
structure length
256
Chain Sequence
ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Medium chain fatty acids are selective peroxisome proliferator activated receptor (PPAR) Gamma activators and pan-PPAR partial agonists
pubmed doi rcsb
molecule keywords Peroxisome proliferator-activated receptor gamma
molecule tags Transcription
source organism Homo sapiens
total genus 93
structure length 256
sequence length 271
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4emaA00
1IE8A 1KV6A 4RUJA 3VJSA 2AX7A 2AA7A 3E7CA 4DOSA 1FCZA 2ZK0A 2HC4A 2GIUA 5FQSA 2Q7KA 3B65A 3MNOA 2P4YA 2H77A 2Q3YA 2Q61A 2Q59B 4TV1A 5DXBA 4OC7A 3SP9A 4DK7A 2ZMIA 2YHDA 2B1ZA 5JI0D 4REEA 5K13A 3W0AA 3CDSA 3L1BA 4WPFA 3HVLA 1A52A 4MGBA 1GS4A 1FM6D 3GYTA 3OS9A 4Q13A 1PZLA 1YIMA 2AMAA 1I37A 2PINA 3OSWA 1YYEA 1UOMA 3FURA 3L0LA 5HJPA 3E00A 5DRMA 3VHUA 3ADUA 1Z5XU 1NQ2A 1MZNA 2G5OA 2LBDA 3ERTA 2IOKA 3OMMA 3D24A 4O8FA 5DXQA 1E3KA 2ZLAA 3VHVA 4POHA 4OKBA 5C4SA 1UPVA 1TFCA 4HEEX 4JYGA 3R8IA 3WGPA 4ZNTA 5KRCA 3WMHA 3BC5A 3UP0A 2FAIA 1MV9A 2FVJA 1XV9A 4OZTU 5DL4A 5GIDA 4XUMA 3GWXA 1S0XA 3LMPA 3CTBA 1XLSA 5KCUA 2HASA 3A78A 2P15A 1SKXA 3X1HA 4UDBA 1M2ZA 4PPPA 1ZKYA 5APJA 2QA8A 4ZI1A 4FN9A 3TKMA 4QM0A 2ZK5A 2QXSA 2IHQA 2G44A 2XHSA 3B67A 1T73A 3JZBA 3CLDA 3OKHA 1K74A 5DV8A 4MGAB 4KZMA 1XQ3A 3CDPA 3OS8A 1XZXX 5DVSA 2JF9A 2GP7A 3OZ0A 5KROA 2QW4A 4YT1A 2GWXA 4MG7B 4XI3A 3TKCA 4CI5A 1GWXA 2W8YA 2GPPA 1K4WA 4RUOX 1X78A 3FXVA 5DYDA 5L7GA 2VV1B 3A9EA 3GBKA 4J5XC 3VT4A 4TUZB 5C4OA 1OT7A 5KCDA 2P54A 3V3EA 5KR9A 5KCTA 3OOFA 5AWJA 5JJMB 3ILZA 2YLYA 1PQ6A 3O1EA 4UDDA 2POGA 2ZMJA 4TV1B 5DXBB 3WJ5A 1XB7A 3V9VA 2Q70A 1ZEOA 5E15A 3DZYD 4IA2A 3VJIA 4ZN9A 5DTVA 1NQ0A 4S0SA 1LBDA 1XP6A 4MGBB 3F7DA 2P1TA 4MG6A 4OEYA 1PRGA 1Z95A 1T7RA 5DZ0A 5F9BA 2AA5A 4NY9A 1WM0X 3VT5A 5L7HA 4OEZA 3T03A 2GPUA 4APUA 5HJPB 4XT9A 4F9MA 4N1YA 4PP5A 4KZJA 3X36A 2QTUA 1ZDUA 3CWDA 3FLIA 4IV4A 4QK4A 4IWCA 3V9YA 1Y9RA 3KWYA 3OAPA 4MG8A 1NAVA 1ILHA 3W0CA 5KYJA 4A4WA 3VT6A 1KKQA 1FM9A 3B0TA 1XVPA 3G0WA 1X76A 3A2IA 3CJWA 1U3QA 4IVWA 2G0HA 1XQCA 1XV9B 4ITEA 2ZL9A 3KDUA 4DQMA 2HWRA 5AAVA 3P0UA 3WFFA 4OARA 5KCCA 3DZYA 2V0VA 2PIVA 3W0YA 5APHA 2OAXA 1T63A 3K22A 4WLBA 2VV3A 4DMAA 2QA6A 3ET2A 3HC5A 5E0XA 5HYKA 2NV7A 2QA8B 3W0GA 4DORA 4E2JA 5KRLA 3W5RA 5KCWA 2ZFXA 4OGHA 3ZRBA 2Q1VA 3CS4A 3RLLA 1YOKA 4FHIA 2QMVA 1ZH7A 1EREA 2Q7IA 4OJ9A 3FALA 4QE6A 1EXAA 3D57A 3G8OA 2R6WA 1FD0A 2ZMHA 4WHFA 2YATA 1SR7A 3P89A 4IW8A 3ET1A 5KCEA 4G1DA 3A9EB 3HZFA 2B50A 2PJLA 3KMGA 5AVLA 3HQ5A 3VRWA 4P6WA 3VTCA 1P93A 4ZN7A 2ZNPA 3X31A 5APKA 4OEDA 1EXXA 1T65A 3CQVA 3D6DA 1NAXA 4ZNVA 2ZVTA 4M8HA 5DZ1A 5E0WA 5LGAA 2ZXNA 1R20A 4OHAA 3KMZA 1G2NA 2NW4A 3AZ1A 4EM9A 1G50A 1UHLA 2VV2A 2OVHA 3RLJA 1MVCA 2ATHA 2EWPA 4OLMA 4DK8A 3KPZA 4OEAA 2Q5SA 5GICA 5DXRA 2VV4A 1M13A 2AA2A 4G21A 4MG7A 5IAWA 3E00D 2XKWA 5FQVA 5E19A 1PCGA 3X1IA 4OKWA 4OZRU 3VRTA 2QH6A 4MG8B 5AAUA 5JJMA 1XVPB 3IXPA 3R5NA 3HO0A 3VTDA 5G43A 3DY6A 2YFEA 5EITA 2Q7LA 5AAVB 2QXMA 3D5FA 3R5MA 3NOAA 2QGTA 3VT8A 1YJEA 5I4VA 3PBAA 5EI1A 4OH6A 3KFCA 3UU7B 5DZHA 5DIDA 1OSVA 2BJ4A 5JY3A 2AXAA 5G42A 3TY0A 1K74D 1T5ZA 4IU7A 4QJRA 2O4RA 4N8RA 1U3RA 4PP6A 1T7MA 3OLSA 2I4JA 3FALB 5KRAA 3ET3A 3HLVA 3NSQA 2OZ7A 5DWIA 1QKUA 5KRJA 4P6XA 3CS8A 3ET0A 4MGDA 1NRLA 1Y0SA 1XOWA 4IA1A 2B1VA 2IOGA 5DXEA 2Z4BA 4DM6A 2HB7A 3RUTA 4OIVA 5E1CA 3W5TA 3SZ1A 5DX3A 1DKFA 1YY4A 3L3ZA 1N4HA 2OVMA 2JFAA 4XLDA 1S9QA 1M7WA 2R40A 3B0WA 1NUOA 5DI7A 5ACCA 3DZUD 3OOKA 3U9QA 2ACLA 3FC6A 2AO6A 1UHLB 4ITFA 5DWJA 5G3JA 3KBAA 4RZEA 4S15A 2OUZA 3PRGA 3VSOA 1ZAFA 3AZ2A 3D90A 2FSZA 2VV4B 4LTWA 2PIQA 5KCFA 3AX8A 3W5QA 3ADWA 4OZTE 2Z4JA 1ERRA 5KYAA 2Q1HA 3UUDA 4YNKA 4XAOA 4ZNHA 5ETHA 4E4QA 2ZNOA 1FM9D 4JGVA 1RK3A 4YPQA 2ZXMA 4IWFA 1H9UA 3EYBA 5CJ6A 5HCVA 1T76A 3FEJA 2YLPA 5DKBA 5M96A 5G46A 2Q5GA 4G2HA 4PLEA 5L11A 1XNNA 1RDTD 3V49A 3IPQA 1T7FA 3L03A 5DVVA 4X1FA 2VSRA 4OJ4A 4BCRA 3DZUA 3R2AA 4EMAA 3GZ9A 2POBA 2OM9A 2BJ4B 4ZO1X 3KDTA 4A2JA 4JYIA 2AMBA 4MG9A 1U3SA 1XDKA 2ZK6A 5LWPA 1QKNA 2HCDA 3CS6A 3ERDA 4R2UA 2AB2A 4PXMA 4OH5A 5AYGA 4ONIA 4K6IA 1YP0A 3R29A 1E3GA 1XNXA 3GYUA 2GPVA 5DLRA 2PNUA 1XIUA 1NYXA 4MGCA 4ZNWA 5GT4A 2J14A 2GL8A 3HODA 4MGDB 1HG4A 2YLQA 3DT3A 1Q4XA 3WFGA 3PEQA 2ZNNA 3GN8A 2HB8A 2ZBSA 3ADXA 4LNXA 1G1UA 5FQPA 4POJA 2YJAB 3VT9A 3OMOA 5DX3B 1DKFB 1RDTA 2JFAB 5DVCA 3M7RA 3Q95A 5DV6A 3IPSA 4FGYA 3UU7A 4ZJWA 4IA7A 2R6YA 3G8IA 1P8DA 1R20D 2HBHA 1BSXA 4G1ZA 3B68A 4LNWA 2B23A 2Q6JA 4RZGA 5ICKA 3RVFA 2ACLB 3FC6B 4E4KA 5DWLA 3PO9A 4J5WC 2QZOA 4QE8A 1YUCA 5DMFA 2REWA 1YA3A 3H0AA 3P8XA 5E7VA 3OS8C 4HLWA 1YINA 3K23A 4RFWA 5DWEA 3GD2A 4XUHA 5DUEA 3UVVA 5EHJA 3UUDB 1FCXA 1XPCA 1PK5A 3L3XA 5IZ0A 3IXPD 5DRJA 4JAZA 2PIUA 2XYJA 3B5RA 4RE8A 1ILGA 2AM9A 3OKIA 3B3KA 5DZIA 5KRFA 4NQAB 4PF3A 5C4UA 4PVUA 1TXIA 3V3QA 5DXGA 5A86A 5DXPA 1IE9A 4REFA 1RKHA 3L0JA 4JYHA 2QNVA 3W0HA 3N00A 4DM8A 1XP9A 4FHHA 4IA3A 4N5GA 4MG9B 4MG5A 4L98A 1XDKB 1XLSE 2QE4A 3VT3A 2H79A 2QABA 3PCUA 1T7TA 3VN2A 3VRVA 2PITA 3AN3A 4NIEA 3G9EA 4IS8A 3MNPA 1T79A 2QPYA 3UUCA 1X7EA 5KRMA 5AZVA 4PLDA 1LV2A 3FEIA 4FNEA 2I0GA 5AK2A 3V4AA 5DU5A 2O4JA 5KD9A 1DB1A 3ADVA 2AAXA 2HVCA 1KNUA 3A2HA 4WHGA 5DIGA 1G5YA 5DZ3A 3Q95B 4OKTA 2PIRA 2R40D 4NB6A 3HC6A 2F4BA 2ZK4A 4OIUA 3F5CA 3OMKA 4J5XA 1R5KA 3OSAA 2I4ZA 3WWRA 2AA6A 3OLFA 1NQ7A 3WT5A 3A40X 2QZOB 1YMTA 5L7EA 4IUIA 3WT7A 3FUGA 5C4TA 2XYWA 4OKXA 2ZY0A 3W0IA 2Q6SA 4S14A 5DYBA 3H52A 4L96A 4PWLA 4LBDA 2V7CA 3OZJA 3UVVB 2HFPA 2Q60A 1L2JA 4ZO1B 3BEJA 3W0JA 4MDDA 1SQNA 1PQCA 3AUQA 4JL4A 1QKTA 2ZK3A 2NXXE 3AURA 1NDEA 2HARA 4ZNUA 4CI4A 3ZQTA 4YMQA 2I4PA 1PDUA 1PQ9A 3LBDA 4RAKA 4RZFA 2QGWA 4XTAA 1T74A 3KYTA 3OLLA 3P88A 3VHWA 4ZNSA 2ZXZA 3RY9A 1Z5XE 1U9EA 1R6GA 2AX6A 1SJ0A 1X7JA 3ADTA 1X7RA 2J7XA 2Q7JA 2YLOA 5DK9A 3TX7B 4OJBA 5H1EA 3A3ZX 4XHDA 3JZCA 4OFUA 1I38A 2G0GA 3B0RA 1OSHA 3UP3A 4NUFA 3WTQA 1A28A 3VT7A 4J5WA 1Y0XX 3VJHA 4X1GA 1FM6A 1GWQA 1R1KD 4G20A 1I7GA 5HZCA 5DKEA 1K7LA 1QKMA 1S19A 2Q5PA 3AUNA 1NQ1A 1FBYA 5AVIA 3F5CB 4OILA 2O9IA 1OVLA 5DP0A 4Y29A 3BQDA 5EGVA 3K8SA 2Q6RA 2BAWA 5FQTA 3R8AA 4LSJA 4N73A 3H0AD 2E2RA 2AWHA 2GTKA 1N83A 2AX9A 4PP3A 2NPAA 3AZ3A 3L0EA 5B5BA 2ABIA 3A2JA 5E14A 4IV2A 5DIEA 5DKGA 3VJTA 4IVYA 3UUAA 2J4AA 2PKLA 2ZNQA 3IPUA 4OFRA 5IXKA 5KRKA 3OMPA 3QT0A 4R6SA 1R1KA 5G44A 5FQRA 2ZLCA 4Q50A 5DUHA 1UPWA 5HYRA 1S0ZA 5B41A 2P7AA 1FCYA 2OCFA 3NSPA 4S0TA 3SP6A 4B7WA 3OMQA 4PRGA 1S9PA 2PIWA 5EC9A 2NXXA 4RWVA 1YOWA 1XAPA 2QR9A 4UDCA 2J7YA 3B0QA 2VSTA 4IW6A 3KMRA 2ZASA 1XJ7A 3MNEA 4G1YA 5DV3A 4OK1A 2Q59A 1XP1A 4K7AA 3ZRAA 5KRHA 3DCUA 4WVDA 4PPSA 3VI8A 3O1DA 2QSEA 3HM1A 2PIOA 2PRGA 1VJBA 4M8EA 3S9SA 4J26A 3V9TA 3OSIA 4QL8A 5DMCA 3RUUA 3VSPA 4RUPA 1N46A 3DCTA 2A3IA 5AWKA 3IMYA 5DWGA 5G5WA 1I7IA 1GWRA 2P1UA 1ZUCA 1X7BA 3FS1A 4G2IA 2AYRA 5DUGA 2ZKCA 1OVLB 4Q0AC 1ZDTA 2JJ3A 3IA6A 5DKSA 3VTBA 5EJVA 1RJKA 4K4JA 4KZIA 5G45A 5HJSA 5SYZA 1HJ1A 2YJDA 2PIXA 3AN4A 3OGTA 2AX8A 5DY8A 3WT6A 3VRUA 5KRIA 4IQRA 3B1MA 2PIPL 3DR1A 2ZK2A 2VV0A 1ZGYA 3GWSX 2ZK1A 5DXMA 4ZJRA 3UUAB 4UDAA 4RMDA 2Q8SA 4J24A 3K6PA 3R8DA 4MGAA 3E94A 2HAMA 4CSJA 2XYXA 3PLZA 1L2IA 3AFRA 3WJ4A 5DSHA 2GPOA 5GIEA 3B66A 4WQPA 4R06A 5AZTA 3W5PA 3ZR7A 1NHZA 2P1VA 4ZOMA 4A4VA 3ADSA 1RKGA 2I0JA 2P7ZA 2VV1A 4OZRE 5DXKA 4TUZA 4RMCA 4RMEA 2HWQA 2P7GA
chains in the Genus database with same CATH superfamily
1IE8A 1KV6A 4RUJA 3VJSA 2AX7A 2AA7A 3E7CA 4DOSA 1FCZA 2ZK0A 2HC4A 2GIUA 5FQSA 2Q7KA 3B65A 3MNOA 2P4YA 2H77A 2Q3YA 2Q61A 2Q59B 4TV1A 5DXBA 4OC7A 3SP9A 4DK7A 2ZMIA 2YHDA 2B1ZA 5JI0D 4REEA 5K13A 3W0AA 3CDSA 3L1BA 4WPFA 3HVLA 1A52A 4MGBA 1GS4A 1FM6D 3GYTA 3OS9A 4Q13A 1PZLA 1YIMA 2AMAA 1I37A 2PINA 3OSWA 1YYEA 1UOMA 3FURA 3L0LA 5HJPA 3E00A 5DRMA 3VHUA 3ADUA 1Z5XU 1NQ2A 1MZNA 2G5OA 2LBDA 3ERTA 2IOKA 3OMMA 3D24A 4O8FA 5DXQA 1E3KA 2ZLAA 3VHVA 4POHA 4OKBA 5C4SA 1UPVA 1TFCA 4HEEX 4JYGA 3R8IA 3WGPA 4ZNTA 5KRCA 3WMHA 3BC5A 3UP0A 2FAIA 1MV9A 2FVJA 1XV9A 4OZTU 5DL4A 5GIDA 4XUMA 3GWXA 1S0XA 3LMPA 3CTBA 1XLSA 5KCUA 2HASA 3A78A 2P15A 1SKXA 3X1HA 4UDBA 1M2ZA 4PPPA 1ZKYA 5APJA 2QA8A 4ZI1A 4FN9A 3TKMA 4QM0A 2ZK5A 2QXSA 2IHQA 2G44A 2XHSA 3B67A 1T73A 3JZBA 3CLDA 3OKHA 1K74A 5DV8A 4MGAB 4KZMA 1XQ3A 3CDPA 3OS8A 1XZXX 5DVSA 2JF9A 2GP7A 3OZ0A 5KROA 2QW4A 4YT1A 2GWXA 4MG7B 4XI3A 3TKCA 4CI5A 1GWXA 2W8YA 2GPPA 1K4WA 4RUOX 1X78A 3FXVA 5DYDA 5L7GA 2VV1B 3A9EA 3GBKA 4J5XC 3VT4A 4TUZB 5C4OA 1OT7A 5KCDA 2P54A 3V3EA 5KR9A 5KCTA 3OOFA 5AWJA 5JJMB 3ILZA 2YLYA 1PQ6A 3O1EA 4UDDA 2POGA 2ZMJA 4TV1B 5DXBB 3WJ5A 1XB7A 3V9VA 2Q70A 1ZEOA 5E15A 3DZYD 4IA2A 3VJIA 4ZN9A 5DTVA 1NQ0A 4S0SA 1LBDA 1XP6A 4MGBB 3F7DA 2P1TA 4MG6A 4OEYA 1PRGA 1Z95A 1T7RA 5DZ0A 5F9BA 2AA5A 4NY9A 1WM0X 3VT5A 5L7HA 4OEZA 3T03A 2GPUA 4APUA 5HJPB 4XT9A 4F9MA 4N1YA 4PP5A 4KZJA 3X36A 2QTUA 1ZDUA 3CWDA 3FLIA 4IV4A 4QK4A 4IWCA 3V9YA 1Y9RA 3KWYA 3OAPA 4MG8A 1NAVA 1ILHA 3W0CA 5KYJA 4A4WA 3VT6A 1KKQA 1FM9A 3B0TA 1XVPA 3G0WA 1X76A 3A2IA 3CJWA 1U3QA 4IVWA 2G0HA 1XQCA 1XV9B 4ITEA 2ZL9A 3KDUA 4DQMA 2HWRA 5AAVA 3P0UA 3WFFA 4OARA 5KCCA 3DZYA 2V0VA 2PIVA 3W0YA 5APHA 2OAXA 1T63A 3K22A 4WLBA 2VV3A 4DMAA 2QA6A 3ET2A 3HC5A 5E0XA 5HYKA 2NV7A 2QA8B 3W0GA 4DORA 4E2JA 5KRLA 3W5RA 5KCWA 2ZFXA 4OGHA 3ZRBA 2Q1VA 3CS4A 3RLLA 1YOKA 4FHIA 2QMVA 1ZH7A 1EREA 2Q7IA 4OJ9A 3FALA 4QE6A 1EXAA 3D57A 3G8OA 2R6WA 1FD0A 2ZMHA 4WHFA 2YATA 1SR7A 3P89A 4IW8A 3ET1A 5KCEA 4G1DA 3A9EB 3HZFA 2B50A 2PJLA 3KMGA 5AVLA 3HQ5A 3VRWA 4P6WA 3VTCA 1P93A 4ZN7A 2ZNPA 3X31A 5APKA 4OEDA 1EXXA 1T65A 3CQVA 3D6DA 1NAXA 4ZNVA 2ZVTA 4M8HA 5DZ1A 5E0WA 5LGAA 2ZXNA 1R20A 4OHAA 3KMZA 1G2NA 2NW4A 3AZ1A 4EM9A 1G50A 1UHLA 2VV2A 2OVHA 3RLJA 1MVCA 2ATHA 2EWPA 4OLMA 4DK8A 3KPZA 4OEAA 2Q5SA 5GICA 5DXRA 2VV4A 1M13A 2AA2A 4G21A 4MG7A 5IAWA 3E00D 2XKWA 5FQVA 5E19A 1PCGA 3X1IA 4OKWA 4OZRU 3VRTA 2QH6A 4MG8B 5AAUA 5JJMA 1XVPB 3IXPA 3R5NA 3HO0A 3VTDA 5G43A 3DY6A 2YFEA 5EITA 2Q7LA 5AAVB 2QXMA 3D5FA 3R5MA 3NOAA 2QGTA 3VT8A 1YJEA 5I4VA 3PBAA 5EI1A 4OH6A 3KFCA 3UU7B 5DZHA 5DIDA 1OSVA 2BJ4A 5JY3A 2AXAA 5G42A 3TY0A 1K74D 1T5ZA 4IU7A 4QJRA 2O4RA 4N8RA 1U3RA 4PP6A 1T7MA 3OLSA 2I4JA 3FALB 5KRAA 3ET3A 3HLVA 3NSQA 2OZ7A 5DWIA 1QKUA 5KRJA 4P6XA 3CS8A 3ET0A 4MGDA 1NRLA 1Y0SA 1XOWA 4IA1A 2B1VA 2IOGA 5DXEA 2Z4BA 4DM6A 2HB7A 3RUTA 4OIVA 5E1CA 3W5TA 3SZ1A 5DX3A 1DKFA 1YY4A 3L3ZA 1N4HA 2OVMA 2JFAA 4XLDA 1S9QA 1M7WA 2R40A 3B0WA 1NUOA 5DI7A 5ACCA 3DZUD 3OOKA 3U9QA 2ACLA 3FC6A 2AO6A 1UHLB 4ITFA 5DWJA 5G3JA 3KBAA 4RZEA 4S15A 2OUZA 3PRGA 3VSOA 1ZAFA 3AZ2A 3D90A 2FSZA 2VV4B 4LTWA 2PIQA 5KCFA 3AX8A 3W5QA 3ADWA 4OZTE 2Z4JA 1ERRA 5KYAA 2Q1HA 3UUDA 4YNKA 4XAOA 4ZNHA 5ETHA 4E4QA 2ZNOA 1FM9D 4JGVA 1RK3A 4YPQA 2ZXMA 4IWFA 1H9UA 3EYBA 5CJ6A 5HCVA 1T76A 3FEJA 2YLPA 5DKBA 5M96A 5G46A 2Q5GA 4G2HA 4PLEA 5L11A 1XNNA 1RDTD 3V49A 3IPQA 1T7FA 3L03A 5DVVA 4X1FA 2VSRA 4OJ4A 4BCRA 3DZUA 3R2AA 4EMAA 3GZ9A 2POBA 2OM9A 2BJ4B 4ZO1X 3KDTA 4A2JA 4JYIA 2AMBA 4MG9A 1U3SA 1XDKA 2ZK6A 5LWPA 1QKNA 2HCDA 3CS6A 3ERDA 4R2UA 2AB2A 4PXMA 4OH5A 5AYGA 4ONIA 4K6IA 1YP0A 3R29A 1E3GA 1XNXA 3GYUA 2GPVA 5DLRA 2PNUA 1XIUA 1NYXA 4MGCA 4ZNWA 5GT4A 2J14A 2GL8A 3HODA 4MGDB 1HG4A 2YLQA 3DT3A 1Q4XA 3WFGA 3PEQA 2ZNNA 3GN8A 2HB8A 2ZBSA 3ADXA 4LNXA 1G1UA 5FQPA 4POJA 2YJAB 3VT9A 3OMOA 5DX3B 1DKFB 1RDTA 2JFAB 5DVCA 3M7RA 3Q95A 5DV6A 3IPSA 4FGYA 3UU7A 4ZJWA 4IA7A 2R6YA 3G8IA 1P8DA 1R20D 2HBHA 1BSXA 4G1ZA 3B68A 4LNWA 2B23A 2Q6JA 4RZGA 5ICKA 3RVFA 2ACLB 3FC6B 4E4KA 5DWLA 3PO9A 4J5WC 2QZOA 4QE8A 1YUCA 5DMFA 2REWA 1YA3A 3H0AA 3P8XA 5E7VA 3OS8C 4HLWA 1YINA 3K23A 4RFWA 5DWEA 3GD2A 4XUHA 5DUEA 3UVVA 5EHJA 3UUDB 1FCXA 1XPCA 1PK5A 3L3XA 5IZ0A 3IXPD 5DRJA 4JAZA 2PIUA 2XYJA 3B5RA 4RE8A 1ILGA 2AM9A 3OKIA 3B3KA 5DZIA 5KRFA 4NQAB 4PF3A 5C4UA 4PVUA 1TXIA 3V3QA 5DXGA 5A86A 5DXPA 1IE9A 4REFA 1RKHA 3L0JA 4JYHA 2QNVA 3W0HA 3N00A 4DM8A 1XP9A 4FHHA 4IA3A 4N5GA 4MG9B 4MG5A 4L98A 1XDKB 1XLSE 2QE4A 3VT3A 2H79A 2QABA 3PCUA 1T7TA 3VN2A 3VRVA 2PITA 3AN3A 4NIEA 3G9EA 4IS8A 3MNPA 1T79A 2QPYA 3UUCA 1X7EA 5KRMA 5AZVA 4PLDA 1LV2A 3FEIA 4FNEA 2I0GA 5AK2A 3V4AA 5DU5A 2O4JA 5KD9A 1DB1A 3ADVA 2AAXA 2HVCA 1KNUA 3A2HA 4WHGA 5DIGA 1G5YA 5DZ3A 3Q95B 4OKTA 2PIRA 2R40D 4NB6A 3HC6A 2F4BA 2ZK4A 4OIUA 3F5CA 3OMKA 4J5XA 1R5KA 3OSAA 2I4ZA 3WWRA 2AA6A 3OLFA 1NQ7A 3WT5A 3A40X 2QZOB 1YMTA 5L7EA 4IUIA 3WT7A 3FUGA 5C4TA 2XYWA 4OKXA 2ZY0A 3W0IA 2Q6SA 4S14A 5DYBA 3H52A 4L96A 4PWLA 4LBDA 2V7CA 3OZJA 3UVVB 2HFPA 2Q60A 1L2JA 4ZO1B 3BEJA 3W0JA 4MDDA 1SQNA 1PQCA 3AUQA 4JL4A 1QKTA 2ZK3A 2NXXE 3AURA 1NDEA 2HARA 4ZNUA 4CI4A 3ZQTA 4YMQA 2I4PA 1PDUA 1PQ9A 3LBDA 4RAKA 4RZFA 2QGWA 4XTAA 1T74A 3KYTA 3OLLA 3P88A 3VHWA 4ZNSA 2ZXZA 3RY9A 1Z5XE 1U9EA 1R6GA 2AX6A 1SJ0A 1X7JA 3ADTA 1X7RA 2J7XA 2Q7JA 2YLOA 5DK9A 3TX7B 4OJBA 5H1EA 3A3ZX 4XHDA 3JZCA 4OFUA 1I38A 2G0GA 3B0RA 1OSHA 3UP3A 4NUFA 3WTQA 1A28A 3VT7A 4J5WA 1Y0XX 3VJHA 4X1GA 1FM6A 1GWQA 1R1KD 4G20A 1I7GA 5HZCA 5DKEA 1K7LA 1QKMA 1S19A 2Q5PA 3AUNA 1NQ1A 1FBYA 5AVIA 3F5CB 4OILA 2O9IA 1OVLA 5DP0A 4Y29A 3BQDA 5EGVA 3K8SA 2Q6RA 2BAWA 5FQTA 3R8AA 4LSJA 4N73A 3H0AD 2E2RA 2AWHA 2GTKA 1N83A 2AX9A 4PP3A 2NPAA 3AZ3A 3L0EA 5B5BA 2ABIA 3A2JA 5E14A 4IV2A 5DIEA 5DKGA 3VJTA 4IVYA 3UUAA 2J4AA 2PKLA 2ZNQA 3IPUA 4OFRA 5IXKA 5KRKA 3OMPA 3QT0A 4R6SA 1R1KA 5G44A 5FQRA 2ZLCA 4Q50A 5DUHA 1UPWA 5HYRA 1S0ZA 5B41A 2P7AA 1FCYA 2OCFA 3NSPA 4S0TA 3SP6A 4B7WA 3OMQA 4PRGA 1S9PA 2PIWA 5EC9A 2NXXA 4RWVA 1YOWA 1XAPA 2QR9A 4UDCA 2J7YA 3B0QA 2VSTA 4IW6A 3KMRA 2ZASA 1XJ7A 3MNEA 4G1YA 5DV3A 4OK1A 2Q59A 1XP1A 4K7AA 3ZRAA 5KRHA 3DCUA 4WVDA 4PPSA 3VI8A 3O1DA 2QSEA 3HM1A 2PIOA 2PRGA 1VJBA 4M8EA 3S9SA 4J26A 3V9TA 3OSIA 4QL8A 5DMCA 3RUUA 3VSPA 4RUPA 1N46A 3DCTA 2A3IA 5AWKA 3IMYA 5DWGA 5G5WA 1I7IA 1GWRA 2P1UA 1ZUCA 1X7BA 3FS1A 4G2IA 2AYRA 5DUGA 2ZKCA 1OVLB 4Q0AC 1ZDTA 2JJ3A 3IA6A 5DKSA 3VTBA 5EJVA 1RJKA 4K4JA 4KZIA 5G45A 5HJSA 5SYZA 1HJ1A 2YJDA 2PIXA 3AN4A 3OGTA 2AX8A 5DY8A 3WT6A 3VRUA 5KRIA 4IQRA 3B1MA 2PIPL 3DR1A 2ZK2A 2VV0A 1ZGYA 3GWSX 2ZK1A 5DXMA 4ZJRA 3UUAB 4UDAA 4RMDA 2Q8SA 4J24A 3K6PA 3R8DA 4MGAA 3E94A 2HAMA 4CSJA 2XYXA 3PLZA 1L2IA 3AFRA 3WJ4A 5DSHA 2GPOA 5GIEA 3B66A 4WQPA 4R06A 5AZTA 3W5PA 3ZR7A 1NHZA 2P1VA 4ZOMA 4A4VA 3ADSA 1RKGA 2I0JA 2P7ZA 2VV1A 4OZRE 5DXKA 4TUZA 4RMCA 4RMEA 2HWQA 2P7GA
chains in the Genus database with same CATH topology
1IE8A 1KV6A 4RUJA 3VJSA 2AX7A 2AA7A 3E7CA 4DOSA 1FCZA 2ZK0A 2HC4A 2GIUA 5FQSA 2Q7KA 3B65A 3MNOA 2P4YA 2H77A 2Q3YA 2Q61A 2Q59B 4TV1A 5DXBA 4OC7A 3SP9A 4DK7A 2ZMIA 2YHDA 2B1ZA 5JI0D 4REEA 5K13A 3W0AA 3CDSA 3L1BA 4WPFA 3HVLA 1A52A 4MGBA 1GS4A 1FM6D 3GYTA 3OS9A 4Q13A 1PZLA 1YIMA 2AMAA 1I37A 2PINA 3OSWA 1YYEA 1UOMA 3FURA 3L0LA 5HJPA 3E00A 5DRMA 3VHUA 3ADUA 1Z5XU 1NQ2A 1MZNA 2G5OA 2LBDA 3ERTA 2IOKA 3OMMA 3D24A 4O8FA 5DXQA 1E3KA 2ZLAA 3VHVA 4POHA 4OKBA 5C4SA 1UPVA 1TFCA 4HEEX 4JYGA 3R8IA 3WGPA 4ZNTA 5KRCA 3WMHA 3BC5A 3UP0A 2FAIA 1MV9A 2FVJA 1XV9A 4OZTU 5DL4A 5GIDA 4XUMA 3GWXA 1S0XA 3LMPA 3CTBA 1XLSA 5KCUA 2HASA 3A78A 2P15A 1SKXA 3X1HA 4UDBA 1M2ZA 4PPPA 1ZKYA 5APJA 2QA8A 4ZI1A 4FN9A 3TKMA 4QM0A 2ZK5A 2QXSA 2IHQA 2G44A 2XHSA 3B67A 1T73A 3JZBA 3CLDA 3OKHA 1K74A 5DV8A 4MGAB 4KZMA 1XQ3A 3CDPA 3OS8A 1XZXX 5DVSA 2JF9A 2GP7A 3OZ0A 5KROA 2QW4A 4YT1A 2GWXA 4MG7B 4XI3A 3TKCA 4CI5A 1GWXA 2W8YA 2GPPA 1K4WA 4RUOX 1X78A 3FXVA 5DYDA 5L7GA 2VV1B 3A9EA 3GBKA 4J5XC 3VT4A 4TUZB 5C4OA 1OT7A 5KCDA 2P54A 3V3EA 5KR9A 5KCTA 3OOFA 5AWJA 5JJMB 3ILZA 2YLYA 1PQ6A 3O1EA 4UDDA 2POGA 2ZMJA 4TV1B 5DXBB 3WJ5A 1XB7A 3V9VA 2Q70A 1ZEOA 5E15A 3DZYD 4IA2A 3VJIA 4ZN9A 5DTVA 1NQ0A 4S0SA 1LBDA 1XP6A 4MGBB 3F7DA 2P1TA 4MG6A 4OEYA 1PRGA 1Z95A 1T7RA 5DZ0A 5F9BA 2AA5A 4NY9A 1WM0X 3VT5A 5L7HA 4OEZA 3T03A 2GPUA 4APUA 5HJPB 4XT9A 4F9MA 4N1YA 4PP5A 4KZJA 3X36A 2QTUA 1ZDUA 3CWDA 3FLIA 4IV4A 4QK4A 4IWCA 3V9YA 1Y9RA 3KWYA 3OAPA 4MG8A 1NAVA 1ILHA 3W0CA 5KYJA 4A4WA 3VT6A 1KKQA 1FM9A 3B0TA 1XVPA 3G0WA 1X76A 3A2IA 3CJWA 1U3QA 4IVWA 2G0HA 1XQCA 1XV9B 4ITEA 2ZL9A 3KDUA 4DQMA 2HWRA 5AAVA 3P0UA 3WFFA 4OARA 5KCCA 3DZYA 2V0VA 2PIVA 3W0YA 5APHA 2OAXA 1T63A 3K22A 4WLBA 2VV3A 4DMAA 2QA6A 3ET2A 3HC5A 5E0XA 5HYKA 2NV7A 2QA8B 3W0GA 4DORA 4E2JA 5KRLA 3W5RA 5KCWA 2ZFXA 4OGHA 3ZRBA 2Q1VA 3CS4A 3RLLA 1YOKA 4FHIA 2QMVA 1ZH7A 1EREA 2Q7IA 4OJ9A 3FALA 4QE6A 1EXAA 3D57A 3G8OA 2R6WA 1FD0A 2ZMHA 4WHFA 2YATA 1SR7A 3P89A 4IW8A 3ET1A 5KCEA 4G1DA 3A9EB 3HZFA 2B50A 2PJLA 3KMGA 5AVLA 3HQ5A 3VRWA 4P6WA 3VTCA 1P93A 4ZN7A 2ZNPA 3X31A 5APKA 4OEDA 1EXXA 1T65A 3CQVA 3D6DA 1NAXA 4ZNVA 2ZVTA 4M8HA 5DZ1A 5E0WA 5LGAA 2ZXNA 1R20A 4OHAA 3KMZA 1G2NA 2NW4A 3AZ1A 4EM9A 1G50A 1UHLA 2VV2A 2OVHA 3RLJA 1MVCA 2ATHA 2EWPA 4OLMA 4DK8A 3KPZA 4OEAA 2Q5SA 5GICA 5DXRA 2VV4A 1M13A 2AA2A 4G21A 4MG7A 5IAWA 3E00D 2XKWA 5FQVA 5E19A 1PCGA 3X1IA 4OKWA 4OZRU 3VRTA 2QH6A 4MG8B 5AAUA 5JJMA 1XVPB 3IXPA 3R5NA 3HO0A 3VTDA 5G43A 3DY6A 2YFEA 5EITA 2Q7LA 5AAVB 2QXMA 3D5FA 3R5MA 3NOAA 2QGTA 3VT8A 1YJEA 5I4VA 3PBAA 5EI1A 4OH6A 3KFCA 3UU7B 5DZHA 5DIDA 1OSVA 2BJ4A 5JY3A 2AXAA 5G42A 3TY0A 1K74D 1T5ZA 4IU7A 4QJRA 2O4RA 4N8RA 1U3RA 4PP6A 1T7MA 3OLSA 2I4JA 3FALB 5KRAA 3ET3A 3HLVA 3NSQA 2OZ7A 5DWIA 1QKUA 5KRJA 4P6XA 3CS8A 3ET0A 4MGDA 1NRLA 1Y0SA 1XOWA 4IA1A 2B1VA 2IOGA 5DXEA 2Z4BA 4DM6A 2HB7A 3RUTA 4OIVA 5E1CA 3W5TA 3SZ1A 5DX3A 1DKFA 1YY4A 3L3ZA 1N4HA 2OVMA 2JFAA 4XLDA 1S9QA 1M7WA 2R40A 3B0WA 1NUOA 5DI7A 5ACCA 3DZUD 3OOKA 3U9QA 2ACLA 3FC6A 2AO6A 1UHLB 4ITFA 5DWJA 5G3JA 3KBAA 4RZEA 4S15A 2OUZA 3PRGA 3VSOA 1ZAFA 3AZ2A 3D90A 2FSZA 2VV4B 4LTWA 2PIQA 5KCFA 3AX8A 3W5QA 3ADWA 4OZTE 2Z4JA 1ERRA 5KYAA 2Q1HA 3UUDA 4YNKA 4XAOA 4ZNHA 5ETHA 4E4QA 2ZNOA 1FM9D 4JGVA 1RK3A 4YPQA 2ZXMA 4IWFA 1H9UA 3EYBA 5CJ6A 5HCVA 1T76A 3FEJA 2YLPA 5DKBA 5M96A 5G46A 2Q5GA 4G2HA 4PLEA 5L11A 1XNNA 1RDTD 3V49A 3IPQA 1T7FA 3L03A 5DVVA 4X1FA 2VSRA 4OJ4A 4BCRA 3DZUA 3R2AA 4EMAA 3GZ9A 2POBA 2OM9A 2BJ4B 4ZO1X 3KDTA 4A2JA 4JYIA 2AMBA 4MG9A 1U3SA 1XDKA 2ZK6A 5LWPA 1QKNA 2HCDA 3CS6A 3ERDA 4R2UA 2AB2A 4PXMA 4OH5A 5AYGA 4ONIA 4K6IA 1YP0A 3R29A 1E3GA 1XNXA 3GYUA 2GPVA 5DLRA 2PNUA 1XIUA 1NYXA 4MGCA 4ZNWA 5GT4A 2J14A 2GL8A 3HODA 4MGDB 1HG4A 2YLQA 3DT3A 1Q4XA 3WFGA 3PEQA 2ZNNA 3GN8A 2HB8A 2ZBSA 3ADXA 4LNXA 1G1UA 5FQPA 4POJA 2YJAB 3VT9A 3OMOA 5DX3B 1DKFB 1RDTA 2JFAB 5DVCA 3M7RA 3Q95A 5DV6A 3IPSA 4FGYA 3UU7A 4ZJWA 4IA7A 2R6YA 3G8IA 1P8DA 1R20D 2HBHA 1BSXA 4G1ZA 3B68A 4LNWA 2B23A 2Q6JA 4RZGA 5ICKA 3RVFA 2ACLB 3FC6B 4E4KA 5DWLA 3PO9A 4J5WC 2QZOA 4QE8A 1YUCA 5DMFA 2REWA 1YA3A 3H0AA 3P8XA 5E7VA 3OS8C 4HLWA 1YINA 3K23A 4RFWA 5DWEA 3GD2A 4XUHA 5DUEA 3UVVA 5EHJA 3UUDB 1FCXA 1XPCA 1PK5A 3L3XA 5IZ0A 3IXPD 5DRJA 4JAZA 2PIUA 2XYJA 3B5RA 4RE8A 1ILGA 2AM9A 3OKIA 3B3KA 5DZIA 5KRFA 4NQAB 4PF3A 5C4UA 4PVUA 1TXIA 3V3QA 5DXGA 5A86A 5DXPA 1IE9A 4REFA 1RKHA 3L0JA 4JYHA 2QNVA 3W0HA 3N00A 4DM8A 1XP9A 4FHHA 4IA3A 4N5GA 4MG9B 4MG5A 4L98A 1XDKB 1XLSE 2QE4A 3VT3A 2H79A 2QABA 3PCUA 1T7TA 3VN2A 3VRVA 2PITA 3AN3A 4NIEA 3G9EA 4IS8A 3MNPA 1T79A 2QPYA 3UUCA 1X7EA 5KRMA 5AZVA 4PLDA 1LV2A 3FEIA 4FNEA 2I0GA 5AK2A 3V4AA 5DU5A 2O4JA 5KD9A 1DB1A 3ADVA 2AAXA 2HVCA 1KNUA 3A2HA 4WHGA 5DIGA 1G5YA 5DZ3A 3Q95B 4OKTA 2PIRA 2R40D 4NB6A 3HC6A 2F4BA 2ZK4A 4OIUA 3F5CA 3OMKA 4J5XA 1R5KA 3OSAA 2I4ZA 3WWRA 2AA6A 3OLFA 1NQ7A 3WT5A 3A40X 2QZOB 1YMTA 5L7EA 4IUIA 3WT7A 3FUGA 5C4TA 2XYWA 4OKXA 2ZY0A 3W0IA 2Q6SA 4S14A 5DYBA 3H52A 4L96A 4PWLA 4LBDA 2V7CA 3OZJA 3UVVB 2HFPA 2Q60A 1L2JA 4ZO1B 3BEJA 3W0JA 4MDDA 1SQNA 1PQCA 3AUQA 4JL4A 1QKTA 2ZK3A 2NXXE 3AURA 1NDEA 2HARA 4ZNUA 4CI4A 3ZQTA 4YMQA 2I4PA 1PDUA 1PQ9A 3LBDA 4RAKA 4RZFA 2QGWA 4XTAA 1T74A 3KYTA 3OLLA 3P88A 3VHWA 4ZNSA 2ZXZA 3RY9A 1Z5XE 1U9EA 1R6GA 2AX6A 1SJ0A 1X7JA 3ADTA 1X7RA 2J7XA 2Q7JA 2YLOA 5DK9A 3TX7B 4OJBA 5H1EA 3A3ZX 4XHDA 3JZCA 4OFUA 1I38A 2G0GA 3B0RA 1OSHA 3UP3A 4NUFA 3WTQA 1A28A 3VT7A 4J5WA 1Y0XX 3VJHA 4X1GA 1FM6A 1GWQA 1R1KD 4G20A 1I7GA 5HZCA 5DKEA 1K7LA 1QKMA 1S19A 2Q5PA 3AUNA 1NQ1A 1FBYA 5AVIA 3F5CB 4OILA 2O9IA 1OVLA 5DP0A 4Y29A 3BQDA 5EGVA 3K8SA 2Q6RA 2BAWA 5FQTA 3R8AA 4LSJA 4N73A 3H0AD 2E2RA 2AWHA 2GTKA 1N83A 2AX9A 4PP3A 2NPAA 3AZ3A 3L0EA 5B5BA 2ABIA 3A2JA 5E14A 4IV2A 5DIEA 5DKGA 3VJTA 4IVYA 3UUAA 2J4AA 2PKLA 2ZNQA 3IPUA 4OFRA 5IXKA 5KRKA 3OMPA 3QT0A 4R6SA 1R1KA 5G44A 5FQRA 2ZLCA 4Q50A 5DUHA 1UPWA 5HYRA 1S0ZA 5B41A 2P7AA 1FCYA 2OCFA 3NSPA 4S0TA 3SP6A 4B7WA 3OMQA 4PRGA 1S9PA 2PIWA 5EC9A 2NXXA 4RWVA 1YOWA 1XAPA 2QR9A 4UDCA 2J7YA 3B0QA 2VSTA 4IW6A 3KMRA 2ZASA 1XJ7A 3MNEA 4G1YA 5DV3A 4OK1A 2Q59A 1XP1A 4K7AA 3ZRAA 5KRHA 3DCUA 4WVDA 4PPSA 3VI8A 3O1DA 2QSEA 3HM1A 2PIOA 2PRGA 1VJBA 4M8EA 3S9SA 4J26A 3V9TA 3OSIA 4QL8A 5DMCA 3RUUA 3VSPA 4RUPA 1N46A 3DCTA 2A3IA 5AWKA 3IMYA 5DWGA 5G5WA 1I7IA 1GWRA 2P1UA 1ZUCA 1X7BA 3FS1A 4G2IA 2AYRA 5DUGA 2ZKCA 1OVLB 4Q0AC 1ZDTA 2JJ3A 3IA6A 5DKSA 3VTBA 5EJVA 1RJKA 4K4JA 4KZIA 5G45A 5HJSA 5SYZA 1HJ1A 2YJDA 2PIXA 3AN4A 3OGTA 2AX8A 5DY8A 3WT6A 3VRUA 5KRIA 4IQRA 3B1MA 2PIPL 3DR1A 2ZK2A 2VV0A 1ZGYA 3GWSX 2ZK1A 5DXMA 4ZJRA 3UUAB 4UDAA 4RMDA 2Q8SA 4J24A 3K6PA 3R8DA 4MGAA 3E94A 2HAMA 4CSJA 2XYXA 3PLZA 1L2IA 3AFRA 3WJ4A 5DSHA 2GPOA 5GIEA 3B66A 4WQPA 4R06A 5AZTA 3W5PA 3ZR7A 1NHZA 2P1VA 4ZOMA 4A4VA 3ADSA 1RKGA 2I0JA 2P7ZA 2VV1A 4OZRE 5DXKA 4TUZA 4RMCA 4RMEA 2HWQA 2P7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IE8 A;  1KV6 A;  4RUJ A;  3VJS A;  2AX7 A;  2AA7 A;  3E7C A;  4DOS A;  1FCZ A;  2ZK0 A;  2HC4 A;  2GIU A;  5FQS A;  2Q7K A;  3B65 A;  3MNO A;  2P4Y A;  2H77 A;  2Q3Y A;  2Q61 A;  2Q59 B;  4TV1 A;  5DXB A;  4OC7 A;  3SP9 A;  4DK7 A;  2ZMI A;  2YHD A;  2B1Z A;  5JI0 D;  4REE A;  5K13 A;  3W0A A;  3CDS A;  3L1B A;  4WPF A;  3HVL A;  1A52 A;  4MGB A;  1GS4 A;  1FM6 D;  3GYT A;  3OS9 A;  4Q13 A;  1PZL A;  1YIM A;  2AMA A;  1I37 A;  2PIN A;  3OSW A;  1YYE A;  1UOM A;  3FUR A;  3L0L A;  5HJP A;  3E00 A;  5DRM A;  3VHU A;  3ADU A;  1Z5X U;  1NQ2 A;  1MZN A;  2G5O A;  2LBD A;  3ERT A;  2IOK A;  3OMM A;  3D24 A;  4O8F A;  5DXQ A;  1E3K A;  2ZLA A;  3VHV A;  4POH A;  4OKB A;  5C4S A;  1UPV A;  1TFC A;  4HEE X;  4JYG A;  3R8I A;  3WGP A;  4ZNT A;  5KRC A;  3WMH A;  3BC5 A;  3UP0 A;  2FAI A;  1MV9 A;  2FVJ A;  1XV9 A;  4OZT U;  5DL4 A;  5GID A;  4XUM A;  3GWX A;  1S0X A;  3LMP A;  3CTB A;  1XLS A;  5KCU A;  2HAS A;  3A78 A;  2P15 A;  1SKX A;  3X1H A;  4UDB A;  1M2Z A;  4PPP A;  1ZKY A;  5APJ A;  2QA8 A;  4ZI1 A;  4FN9 A;  3TKM A;  4QM0 A;  2ZK5 A;  2QXS A;  2IHQ A;  2G44 A;  2XHS A;  3B67 A;  1T73 A;  3JZB A;  3CLD A;  3OKH A;  1K74 A;  5DV8 A;  4MGA B;  4KZM A;  1XQ3 A;  3CDP A;  3OS8 A;  1XZX X;  5DVS A;  2JF9 A;  2GP7 A;  3OZ0 A;  5KRO A;  2QW4 A;  4YT1 A;  2GWX A;  4MG7 B;  4XI3 A;  3TKC A;  4CI5 A;  1GWX A;  2W8Y A;  2GPP A;  1K4W A;  4RUO X;  1X78 A;  3FXV A;  5DYD A;  5L7G A;  2VV1 B;  3A9E A;  3GBK A;  4J5X C;  3VT4 A;  4TUZ B;  5C4O A;  1OT7 A;  5KCD A;  2P54 A;  3V3E A;  5KR9 A;  5KCT A;  3OOF A;  5AWJ A;  5JJM B;  3ILZ A;  2YLY A;  1PQ6 A;  3O1E A;  4UDD A;  2POG A;  2ZMJ A;  4TV1 B;  5DXB B;  3WJ5 A;  1XB7 A;  3V9V A;  2Q70 A;  1ZEO A;  5E15 A;  3DZY D;  4IA2 A;  3VJI A;  4ZN9 A;  5DTV A;  1NQ0 A;  4S0S A;  1LBD A;  1XP6 A;  4MGB B;  3F7D A;  2P1T A;  4MG6 A;  4OEY A;  1PRG A;  1Z95 A;  1T7R A;  5DZ0 A;  5F9B A;  2AA5 A;  4NY9 A;  1WM0 X;  3VT5 A;  5L7H A;  4OEZ A;  3T03 A;  2GPU A;  4APU A;  5HJP B;  4XT9 A;  4F9M A;  4N1Y A;  4PP5 A;  4KZJ A;  3X36 A;  2QTU A;  1ZDU A;  3CWD A;  3FLI A;  4IV4 A;  4QK4 A;  4IWC A;  3V9Y A;  1Y9R A;  3KWY A;  3OAP A;  4MG8 A;  1NAV A;  1ILH A;  3W0C A;  5KYJ A;  4A4W A;  3VT6 A;  1KKQ A;  1FM9 A;  3B0T A;  1XVP A;  3G0W A;  1X76 A;  3A2I A;  3CJW A;  1U3Q A;  4IVW A;  2G0H A;  1XQC A;  1XV9 B;  4ITE A;  2ZL9 A;  3KDU A;  4DQM A;  2HWR A;  5AAV A;  3P0U A;  3WFF A;  4OAR A;  5KCC A;  3DZY A;  2V0V A;  2PIV A;  3W0Y A;  5APH A;  2OAX A;  1T63 A;  3K22 A;  4WLB A;  2VV3 A;  4DMA A;  2QA6 A;  3ET2 A;  3HC5 A;  5E0X A;  5HYK A;  2NV7 A;  2QA8 B;  3W0G A;  4DOR A;  4E2J A;  5KRL A;  3W5R A;  5KCW A;  2ZFX A;  4OGH A;  3ZRB A;  2Q1V A;  3CS4 A;  3RLL A;  1YOK A;  4FHI A;  2QMV A;  1ZH7 A;  1ERE A;  2Q7I A;  4OJ9 A;  3FAL A;  4QE6 A;  1EXA A;  3D57 A;  3G8O A;  2R6W A;  1FD0 A;  2ZMH A;  4WHF A;  2YAT A;  1SR7 A;  3P89 A;  4IW8 A;  3ET1 A;  5KCE A;  4G1D A;  3A9E B;  3HZF A;  2B50 A;  2PJL A;  3KMG A;  5AVL A;  3HQ5 A;  3VRW A;  4P6W A;  3VTC A;  1P93 A;  4ZN7 A;  2ZNP A;  3X31 A;  5APK A;  4OED A;  1EXX A;  1T65 A;  3CQV A;  3D6D A;  1NAX A;  4ZNV A;  2ZVT A;  4M8H A;  5DZ1 A;  5E0W A;  5LGA A;  2ZXN A;  1R20 A;  4OHA A;  3KMZ A;  1G2N A;  2NW4 A;  3AZ1 A;  4EM9 A;  1G50 A;  1UHL A;  2VV2 A;  2OVH A;  3RLJ A;  1MVC A;  2ATH A;  2EWP A;  4OLM A;  4DK8 A;  3KPZ A;  4OEA A;  2Q5S A;  5GIC A;  5DXR A;  2VV4 A;  1M13 A;  2AA2 A;  4G21 A;  4MG7 A;  5IAW A;  3E00 D;  2XKW A;  5FQV A;  5E19 A;  1PCG A;  3X1I A;  4OKW A;  4OZR U;  3VRT A;  2QH6 A;  4MG8 B;  5AAU A;  5JJM A;  1XVP B;  3IXP A;  3R5N A;  3HO0 A;  3VTD A;  5G43 A;  3DY6 A;  2YFE A;  5EIT A;  2Q7L A;  5AAV B;  2QXM A;  3D5F A;  3R5M A;  3NOA A;  2QGT A;  3VT8 A;  1YJE A;  5I4V A;  3PBA A;  5EI1 A;  4OH6 A;  3KFC A;  3UU7 B;  5DZH A;  5DID A;  1OSV A;  2BJ4 A;  5JY3 A;  2AXA A;  5G42 A;  3TY0 A;  1K74 D;  1T5Z A;  4IU7 A;  4QJR A;  2O4R A;  4N8R A;  1U3R A;  4PP6 A;  1T7M A;  3OLS A;  2I4J A;  3FAL B;  5KRA A;  3ET3 A;  3HLV A;  3NSQ A;  2OZ7 A;  5DWI A;  1QKU A;  5KRJ A;  4P6X A;  3CS8 A;  3ET0 A;  4MGD A;  1NRL A;  1Y0S A;  1XOW A;  4IA1 A;  2B1V A;  2IOG A;  5DXE A;  2Z4B A;  4DM6 A;  2HB7 A;  3RUT A;  4OIV A;  5E1C A;  3W5T A;  3SZ1 A;  5DX3 A;  1DKF A;  1YY4 A;  3L3Z A;  1N4H A;  2OVM A;  2JFA A;  4XLD A;  1S9Q A;  1M7W A;  2R40 A;  3B0W A;  1NUO A;  5DI7 A;  5ACC A;  3DZU D;  3OOK A;  3U9Q A;  2ACL A;  3FC6 A;  2AO6 A;  1UHL B;  4ITF A;  5DWJ A;  5G3J A;  3KBA A;  4RZE A;  4S15 A;  2OUZ A;  3PRG A;  3VSO A;  1ZAF A;  3AZ2 A;  3D90 A;  2FSZ A;  2VV4 B;  4LTW A;  2PIQ A;  5KCF A;  3AX8 A;  3W5Q A;  3ADW A;  4OZT E;  2Z4J A;  1ERR A;  5KYA A;  2Q1H A;  3UUD A;  4YNK A;  4XAO A;  4ZNH A;  5ETH A;  4E4Q A;  2ZNO A;  1FM9 D;  4JGV A;  1RK3 A;  4YPQ A;  2ZXM A;  4IWF A;  1H9U A;  3EYB A;  5CJ6 A;  5HCV A;  1T76 A;  3FEJ A;  2YLP A;  5DKB A;  5M96 A;  5G46 A;  2Q5G A;  4G2H A;  4PLE A;  5L11 A;  1XNN A;  1RDT D;  3V49 A;  3IPQ A;  1T7F A;  3L03 A;  5DVV A;  4X1F A;  2VSR A;  4OJ4 A;  4BCR A;  3DZU A;  3R2A A;  4EMA A;  3GZ9 A;  2POB A;  2OM9 A;  2BJ4 B;  4ZO1 X;  3KDT A;  4A2J A;  4JYI A;  2AMB A;  4MG9 A;  1U3S A;  1XDK A;  2ZK6 A;  5LWP A;  1QKN A;  2HCD A;  3CS6 A;  3ERD A;  4R2U A;  2AB2 A;  4PXM A;  4OH5 A;  5AYG A;  4ONI A;  4K6I A;  1YP0 A;  3R29 A;  1E3G A;  1XNX A;  3GYU A;  2GPV A;  5DLR A;  2PNU A;  1XIU A;  1NYX A;  4MGC A;  4ZNW A;  5GT4 A;  2J14 A;  2GL8 A;  3HOD A;  4MGD B;  1HG4 A;  2YLQ A;  3DT3 A;  1Q4X A;  3WFG A;  3PEQ A;  2ZNN A;  3GN8 A;  2HB8 A;  2ZBS A;  3ADX A;  4LNX A;  1G1U A;  5FQP A;  4POJ A;  2YJA B;  3VT9 A;  3OMO A;  5DX3 B;  1DKF B;  1RDT A;  2JFA B;  5DVC A;  3M7R A;  3Q95 A;  5DV6 A;  3IPS A;  4FGY A;  3UU7 A;  4ZJW A;  4IA7 A;  2R6Y A;  3G8I A;  1P8D A;  1R20 D;  2HBH A;  1BSX A;  4G1Z A;  3B68 A;  4LNW A;  2B23 A;  2Q6J A;  4RZG A;  5ICK A;  3RVF A;  2ACL B;  3FC6 B;  4E4K A;  5DWL A;  3PO9 A;  4J5W C;  2QZO A;  4QE8 A;  1YUC A;  5DMF A;  2REW A;  1YA3 A;  3H0A A;  3P8X A;  5E7V A;  3OS8 C;  4HLW A;  1YIN A;  3K23 A;  4RFW A;  5DWE A;  3GD2 A;  4XUH A;  5DUE A;  3UVV A;  5EHJ A;  3UUD B;  1FCX A;  1XPC A;  1PK5 A;  3L3X A;  5IZ0 A;  3IXP D;  5DRJ A;  4JAZ A;  2PIU A;  2XYJ A;  3B5R A;  4RE8 A;  1ILG A;  2AM9 A;  3OKI A;  3B3K A;  5DZI A;  5KRF A;  4NQA B;  4PF3 A;  5C4U A;  4PVU A;  1TXI A;  3V3Q A;  5DXG A;  5A86 A;  5DXP A;  1IE9 A;  4REF A;  1RKH A;  3L0J A;  4JYH A;  2QNV A;  3W0H A;  3N00 A;  4DM8 A;  1XP9 A;  4FHH A;  4IA3 A;  4N5G A;  4MG9 B;  4MG5 A;  4L98 A;  1XDK B;  1XLS E;  2QE4 A;  3VT3 A;  2H79 A;  2QAB A;  3PCU A;  1T7T A;  3VN2 A;  3VRV A;  2PIT A;  3AN3 A;  4NIE A;  3G9E A;  4IS8 A;  3MNP A;  1T79 A;  2QPY A;  3UUC A;  1X7E A;  5KRM A;  5AZV A;  4PLD A;  1LV2 A;  3FEI A;  4FNE A;  2I0G A;  5AK2 A;  3V4A A;  5DU5 A;  2O4J A;  5KD9 A;  1DB1 A;  3ADV A;  2AAX A;  2HVC A;  1KNU A;  3A2H A;  4WHG A;  5DIG A;  1G5Y A;  5DZ3 A;  3Q95 B;  4OKT A;  2PIR A;  2R40 D;  4NB6 A;  3HC6 A;  2F4B A;  2ZK4 A;  4OIU A;  3F5C A;  3OMK A;  4J5X A;  1R5K A;  3OSA A;  2I4Z A;  3WWR A;  2AA6 A;  3OLF A;  1NQ7 A;  3WT5 A;  3A40 X;  2QZO B;  1YMT A;  5L7E A;  4IUI A;  3WT7 A;  3FUG A;  5C4T A;  2XYW A;  4OKX A;  2ZY0 A;  3W0I A;  2Q6S A;  4S14 A;  5DYB A;  3H52 A;  4L96 A;  4PWL A;  4LBD A;  2V7C A;  3OZJ A;  3UVV B;  2HFP A;  2Q60 A;  1L2J A;  4ZO1 B;  3BEJ A;  3W0J A;  4MDD A;  1SQN A;  1PQC A;  3AUQ A;  4JL4 A;  1QKT A;  2ZK3 A;  2NXX E;  3AUR A;  1NDE A;  2HAR A;  4ZNU A;  4CI4 A;  3ZQT A;  4YMQ A;  2I4P A;  1PDU A;  1PQ9 A;  3LBD A;  4RAK A;  4RZF A;  2QGW A;  4XTA A;  1T74 A;  3KYT A;  3OLL A;  3P88 A;  3VHW A;  4ZNS A;  2ZXZ A;  3RY9 A;  1Z5X E;  1U9E A;  1R6G A;  2AX6 A;  1SJ0 A;  1X7J A;  3ADT A;  1X7R A;  2J7X A;  2Q7J A;  2YLO A;  5DK9 A;  3TX7 B;  4OJB A;  5H1E A;  3A3Z X;  4XHD A;  3JZC A;  4OFU A;  1I38 A;  2G0G A;  3B0R A;  1OSH A;  3UP3 A;  4NUF A;  3WTQ A;  1A28 A;  3VT7 A;  4J5W A;  1Y0X X;  3VJH A;  4X1G A;  1FM6 A;  1GWQ A;  1R1K D;  4G20 A;  1I7G A;  5HZC A;  5DKE A;  1K7L A;  1QKM A;  1S19 A;  2Q5P A;  3AUN A;  1NQ1 A;  1FBY A;  5AVI A;  3F5C B;  4OIL A;  2O9I A;  1OVL A;  5DP0 A;  4Y29 A;  3BQD A;  5EGV A;  3K8S A;  2Q6R A;  2BAW A;  5FQT A;  3R8A A;  4LSJ A;  4N73 A;  3H0A D;  2E2R A;  2AWH A;  2GTK A;  1N83 A;  2AX9 A;  4PP3 A;  2NPA A;  3AZ3 A;  3L0E A;  5B5B A;  2ABI A;  3A2J A;  5E14 A;  4IV2 A;  5DIE A;  5DKG A;  3VJT A;  4IVY A;  3UUA A;  2J4A A;  2PKL A;  2ZNQ A;  3IPU A;  4OFR A;  5IXK A;  5KRK A;  3OMP A;  3QT0 A;  4R6S A;  1R1K A;  5G44 A;  5FQR A;  2ZLC A;  4Q50 A;  5DUH A;  1UPW A;  5HYR A;  1S0Z A;  5B41 A;  2P7A A;  1FCY A;  2OCF A;  3NSP A;  4S0T A;  3SP6 A;  4B7W A;  3OMQ A;  4PRG A;  1S9P A;  2PIW A;  5EC9 A;  2NXX A;  4RWV A;  1YOW A;  1XAP A;  2QR9 A;  4UDC A;  2J7Y A;  3B0Q A;  2VST A;  4IW6 A;  3KMR A;  2ZAS A;  1XJ7 A;  3MNE A;  4G1Y A;  5DV3 A;  4OK1 A;  2Q59 A;  1XP1 A;  4K7A A;  3ZRA A;  5KRH A;  3DCU A;  4WVD A;  4PPS A;  3VI8 A;  3O1D A;  2QSE A;  3HM1 A;  2PIO A;  2PRG A;  1VJB A;  4M8E A;  3S9S A;  4J26 A;  3V9T A;  3OSI A;  4QL8 A;  5DMC A;  3RUU A;  3VSP A;  4RUP A;  1N46 A;  3DCT A;  2A3I A;  5AWK A;  3IMY A;  5DWG A;  5G5W A;  1I7I A;  1GWR A;  2P1U A;  1ZUC A;  1X7B A;  3FS1 A;  4G2I A;  2AYR A;  5DUG A;  2ZKC A;  1OVL B;  4Q0A C;  1ZDT A;  2JJ3 A;  3IA6 A;  5DKS A;  3VTB A;  5EJV A;  1RJK A;  4K4J A;  4KZI A;  5G45 A;  5HJS A;  5SYZ A;  1HJ1 A;  2YJD A;  2PIX A;  3AN4 A;  3OGT A;  2AX8 A;  5DY8 A;  3WT6 A;  3VRU A;  5KRI A;  4IQR A;  3B1M A;  2PIP L;  3DR1 A;  2ZK2 A;  2VV0 A;  1ZGY A;  3GWS X;  2ZK1 A;  5DXM A;  4ZJR A;  3UUA B;  4UDA A;  4RMD A;  2Q8S A;  4J24 A;  3K6P A;  3R8D A;  4MGA A;  3E94 A;  2HAM A;  4CSJ A;  2XYX A;  3PLZ A;  1L2I A;  3AFR A;  3WJ4 A;  5DSH A;  2GPO A;  5GIE A;  3B66 A;  4WQP A;  4R06 A;  5AZT A;  3W5P A;  3ZR7 A;  1NHZ A;  2P1V A;  4ZOM A;  4A4V A;  3ADS A;  1RKG A;  2I0J A;  2P7Z A;  2VV1 A;  4OZR E;  5DXK A;  4TUZ A;  4RMC A;  4RME A;  2HWQ A;  2P7G A; 
#chains in the Genus database with same CATH topology
 1IE8 A;  1KV6 A;  4RUJ A;  3VJS A;  2AX7 A;  2AA7 A;  3E7C A;  4DOS A;  1FCZ A;  2ZK0 A;  2HC4 A;  2GIU A;  5FQS A;  2Q7K A;  3B65 A;  3MNO A;  2P4Y A;  2H77 A;  2Q3Y A;  2Q61 A;  2Q59 B;  4TV1 A;  5DXB A;  4OC7 A;  3SP9 A;  4DK7 A;  2ZMI A;  2YHD A;  2B1Z A;  5JI0 D;  4REE A;  5K13 A;  3W0A A;  3CDS A;  3L1B A;  4WPF A;  3HVL A;  1A52 A;  4MGB A;  1GS4 A;  1FM6 D;  3GYT A;  3OS9 A;  4Q13 A;  1PZL A;  1YIM A;  2AMA A;  1I37 A;  2PIN A;  3OSW A;  1YYE A;  1UOM A;  3FUR A;  3L0L A;  5HJP A;  3E00 A;  5DRM A;  3VHU A;  3ADU A;  1Z5X U;  1NQ2 A;  1MZN A;  2G5O A;  2LBD A;  3ERT A;  2IOK A;  3OMM A;  3D24 A;  4O8F A;  5DXQ A;  1E3K A;  2ZLA A;  3VHV A;  4POH A;  4OKB A;  5C4S A;  1UPV A;  1TFC A;  4HEE X;  4JYG A;  3R8I A;  3WGP A;  4ZNT A;  5KRC A;  3WMH A;  3BC5 A;  3UP0 A;  2FAI A;  1MV9 A;  2FVJ A;  1XV9 A;  4OZT U;  5DL4 A;  5GID A;  4XUM A;  3GWX A;  1S0X A;  3LMP A;  3CTB A;  1XLS A;  5KCU A;  2HAS A;  3A78 A;  2P15 A;  1SKX A;  3X1H A;  4UDB A;  1M2Z A;  4PPP A;  1ZKY A;  5APJ A;  2QA8 A;  4ZI1 A;  4FN9 A;  3TKM A;  4QM0 A;  2ZK5 A;  2QXS A;  2IHQ A;  2G44 A;  2XHS A;  3B67 A;  1T73 A;  3JZB A;  3CLD A;  3OKH A;  1K74 A;  5DV8 A;  4MGA B;  4KZM A;  1XQ3 A;  3CDP A;  3OS8 A;  1XZX X;  5DVS A;  2JF9 A;  2GP7 A;  3OZ0 A;  5KRO A;  2QW4 A;  4YT1 A;  2GWX A;  4MG7 B;  4XI3 A;  3TKC A;  4CI5 A;  1GWX A;  2W8Y A;  2GPP A;  1K4W A;  4RUO X;  1X78 A;  3FXV A;  5DYD A;  5L7G A;  2VV1 B;  3A9E A;  3GBK A;  4J5X C;  3VT4 A;  4TUZ B;  5C4O A;  1OT7 A;  5KCD A;  2P54 A;  3V3E A;  5KR9 A;  5KCT A;  3OOF A;  5AWJ A;  5JJM B;  3ILZ A;  2YLY A;  1PQ6 A;  3O1E A;  4UDD A;  2POG A;  2ZMJ A;  4TV1 B;  5DXB B;  3WJ5 A;  1XB7 A;  3V9V A;  2Q70 A;  1ZEO A;  5E15 A;  3DZY D;  4IA2 A;  3VJI A;  4ZN9 A;  5DTV A;  1NQ0 A;  4S0S A;  1LBD A;  1XP6 A;  4MGB B;  3F7D A;  2P1T A;  4MG6 A;  4OEY A;  1PRG A;  1Z95 A;  1T7R A;  5DZ0 A;  5F9B A;  2AA5 A;  4NY9 A;  1WM0 X;  3VT5 A;  5L7H A;  4OEZ A;  3T03 A;  2GPU A;  4APU A;  5HJP B;  4XT9 A;  4F9M A;  4N1Y A;  4PP5 A;  4KZJ A;  3X36 A;  2QTU A;  1ZDU A;  3CWD A;  3FLI A;  4IV4 A;  4QK4 A;  4IWC A;  3V9Y A;  1Y9R A;  3KWY A;  3OAP A;  4MG8 A;  1NAV A;  1ILH A;  3W0C A;  5KYJ A;  4A4W A;  3VT6 A;  1KKQ A;  1FM9 A;  3B0T A;  1XVP A;  3G0W A;  1X76 A;  3A2I A;  3CJW A;  1U3Q A;  4IVW A;  2G0H A;  1XQC A;  1XV9 B;  4ITE A;  2ZL9 A;  3KDU A;  4DQM A;  2HWR A;  5AAV A;  3P0U A;  3WFF A;  4OAR A;  5KCC A;  3DZY A;  2V0V A;  2PIV A;  3W0Y A;  5APH A;  2OAX A;  1T63 A;  3K22 A;  4WLB A;  2VV3 A;  4DMA A;  2QA6 A;  3ET2 A;  3HC5 A;  5E0X A;  5HYK A;  2NV7 A;  2QA8 B;  3W0G A;  4DOR A;  4E2J A;  5KRL A;  3W5R A;  5KCW A;  2ZFX A;  4OGH A;  3ZRB A;  2Q1V A;  3CS4 A;  3RLL A;  1YOK A;  4FHI A;  2QMV A;  1ZH7 A;  1ERE A;  2Q7I A;  4OJ9 A;  3FAL A;  4QE6 A;  1EXA A;  3D57 A;  3G8O A;  2R6W A;  1FD0 A;  2ZMH A;  4WHF A;  2YAT A;  1SR7 A;  3P89 A;  4IW8 A;  3ET1 A;  5KCE A;  4G1D A;  3A9E B;  3HZF A;  2B50 A;  2PJL A;  3KMG A;  5AVL A;  3HQ5 A;  3VRW A;  4P6W A;  3VTC A;  1P93 A;  4ZN7 A;  2ZNP A;  3X31 A;  5APK A;  4OED A;  1EXX A;  1T65 A;  3CQV A;  3D6D A;  1NAX A;  4ZNV A;  2ZVT A;  4M8H A;  5DZ1 A;  5E0W A;  5LGA A;  2ZXN A;  1R20 A;  4OHA A;  3KMZ A;  1G2N A;  2NW4 A;  3AZ1 A;  4EM9 A;  1G50 A;  1UHL A;  2VV2 A;  2OVH A;  3RLJ A;  1MVC A;  2ATH A;  2EWP A;  4OLM A;  4DK8 A;  3KPZ A;  4OEA A;  2Q5S A;  5GIC A;  5DXR A;  2VV4 A;  1M13 A;  2AA2 A;  4G21 A;  4MG7 A;  5IAW A;  3E00 D;  2XKW A;  5FQV A;  5E19 A;  1PCG A;  3X1I A;  4OKW A;  4OZR U;  3VRT A;  2QH6 A;  4MG8 B;  5AAU A;  5JJM A;  1XVP B;  3IXP A;  3R5N A;  3HO0 A;  3VTD A;  5G43 A;  3DY6 A;  2YFE A;  5EIT A;  2Q7L A;  5AAV B;  2QXM A;  3D5F A;  3R5M A;  3NOA A;  2QGT A;  3VT8 A;  1YJE A;  5I4V A;  3PBA A;  5EI1 A;  4OH6 A;  3KFC A;  3UU7 B;  5DZH A;  5DID A;  1OSV A;  2BJ4 A;  5JY3 A;  2AXA A;  5G42 A;  3TY0 A;  1K74 D;  1T5Z A;  4IU7 A;  4QJR A;  2O4R A;  4N8R A;  1U3R A;  4PP6 A;  1T7M A;  3OLS A;  2I4J A;  3FAL B;  5KRA A;  3ET3 A;  3HLV A;  3NSQ A;  2OZ7 A;  5DWI A;  1QKU A;  5KRJ A;  4P6X A;  3CS8 A;  3ET0 A;  4MGD A;  1NRL A;  1Y0S A;  1XOW A;  4IA1 A;  2B1V A;  2IOG A;  5DXE A;  2Z4B A;  4DM6 A;  2HB7 A;  3RUT A;  4OIV A;  5E1C A;  3W5T A;  3SZ1 A;  5DX3 A;  1DKF A;  1YY4 A;  3L3Z A;  1N4H A;  2OVM A;  2JFA A;  4XLD A;  1S9Q A;  1M7W A;  2R40 A;  3B0W A;  1NUO A;  5DI7 A;  5ACC A;  3DZU D;  3OOK A;  3U9Q A;  2ACL A;  3FC6 A;  2AO6 A;  1UHL B;  4ITF A;  5DWJ A;  5G3J A;  3KBA A;  4RZE A;  4S15 A;  2OUZ A;  3PRG A;  3VSO A;  1ZAF A;  3AZ2 A;  3D90 A;  2FSZ A;  2VV4 B;  4LTW A;  2PIQ A;  5KCF A;  3AX8 A;  3W5Q A;  3ADW A;  4OZT E;  2Z4J A;  1ERR A;  5KYA A;  2Q1H A;  3UUD A;  4YNK A;  4XAO A;  4ZNH A;  5ETH A;  4E4Q A;  2ZNO A;  1FM9 D;  4JGV A;  1RK3 A;  4YPQ A;  2ZXM A;  4IWF A;  1H9U A;  3EYB A;  5CJ6 A;  5HCV A;  1T76 A;  3FEJ A;  2YLP A;  5DKB A;  5M96 A;  5G46 A;  2Q5G A;  4G2H A;  4PLE A;  5L11 A;  1XNN A;  1RDT D;  3V49 A;  3IPQ A;  1T7F A;  3L03 A;  5DVV A;  4X1F A;  2VSR A;  4OJ4 A;  4BCR A;  3DZU A;  3R2A A;  4EMA A;  3GZ9 A;  2POB A;  2OM9 A;  2BJ4 B;  4ZO1 X;  3KDT A;  4A2J A;  4JYI A;  2AMB A;  4MG9 A;  1U3S A;  1XDK A;  2ZK6 A;  5LWP A;  1QKN A;  2HCD A;  3CS6 A;  3ERD A;  4R2U A;  2AB2 A;  4PXM A;  4OH5 A;  5AYG A;  4ONI A;  4K6I A;  1YP0 A;  3R29 A;  1E3G A;  1XNX A;  3GYU A;  2GPV A;  5DLR A;  2PNU A;  1XIU A;  1NYX A;  4MGC A;  4ZNW A;  5GT4 A;  2J14 A;  2GL8 A;  3HOD A;  4MGD B;  1HG4 A;  2YLQ A;  3DT3 A;  1Q4X A;  3WFG A;  3PEQ A;  2ZNN A;  3GN8 A;  2HB8 A;  2ZBS A;  3ADX A;  4LNX A;  1G1U A;  5FQP A;  4POJ A;  2YJA B;  3VT9 A;  3OMO A;  5DX3 B;  1DKF B;  1RDT A;  2JFA B;  5DVC A;  3M7R A;  3Q95 A;  5DV6 A;  3IPS A;  4FGY A;  3UU7 A;  4ZJW A;  4IA7 A;  2R6Y A;  3G8I A;  1P8D A;  1R20 D;  2HBH A;  1BSX A;  4G1Z A;  3B68 A;  4LNW A;  2B23 A;  2Q6J A;  4RZG A;  5ICK A;  3RVF A;  2ACL B;  3FC6 B;  4E4K A;  5DWL A;  3PO9 A;  4J5W C;  2QZO A;  4QE8 A;  1YUC A;  5DMF A;  2REW A;  1YA3 A;  3H0A A;  3P8X A;  5E7V A;  3OS8 C;  4HLW A;  1YIN A;  3K23 A;  4RFW A;  5DWE A;  3GD2 A;  4XUH A;  5DUE A;  3UVV A;  5EHJ A;  3UUD B;  1FCX A;  1XPC A;  1PK5 A;  3L3X A;  5IZ0 A;  3IXP D;  5DRJ A;  4JAZ A;  2PIU A;  2XYJ A;  3B5R A;  4RE8 A;  1ILG A;  2AM9 A;  3OKI A;  3B3K A;  5DZI A;  5KRF A;  4NQA B;  4PF3 A;  5C4U A;  4PVU A;  1TXI A;  3V3Q A;  5DXG A;  5A86 A;  5DXP A;  1IE9 A;  4REF A;  1RKH A;  3L0J A;  4JYH A;  2QNV A;  3W0H A;  3N00 A;  4DM8 A;  1XP9 A;  4FHH A;  4IA3 A;  4N5G A;  4MG9 B;  4MG5 A;  4L98 A;  1XDK B;  1XLS E;  2QE4 A;  3VT3 A;  2H79 A;  2QAB A;  3PCU A;  1T7T A;  3VN2 A;  3VRV A;  2PIT A;  3AN3 A;  4NIE A;  3G9E A;  4IS8 A;  3MNP A;  1T79 A;  2QPY A;  3UUC A;  1X7E A;  5KRM A;  5AZV A;  4PLD A;  1LV2 A;  3FEI A;  4FNE A;  2I0G A;  5AK2 A;  3V4A A;  5DU5 A;  2O4J A;  5KD9 A;  1DB1 A;  3ADV A;  2AAX A;  2HVC A;  1KNU A;  3A2H A;  4WHG A;  5DIG A;  1G5Y A;  5DZ3 A;  3Q95 B;  4OKT A;  2PIR A;  2R40 D;  4NB6 A;  3HC6 A;  2F4B A;  2ZK4 A;  4OIU A;  3F5C A;  3OMK A;  4J5X A;  1R5K A;  3OSA A;  2I4Z A;  3WWR A;  2AA6 A;  3OLF A;  1NQ7 A;  3WT5 A;  3A40 X;  2QZO B;  1YMT A;  5L7E A;  4IUI A;  3WT7 A;  3FUG A;  5C4T A;  2XYW A;  4OKX A;  2ZY0 A;  3W0I A;  2Q6S A;  4S14 A;  5DYB A;  3H52 A;  4L96 A;  4PWL A;  4LBD A;  2V7C A;  3OZJ A;  3UVV B;  2HFP A;  2Q60 A;  1L2J A;  4ZO1 B;  3BEJ A;  3W0J A;  4MDD A;  1SQN A;  1PQC A;  3AUQ A;  4JL4 A;  1QKT A;  2ZK3 A;  2NXX E;  3AUR A;  1NDE A;  2HAR A;  4ZNU A;  4CI4 A;  3ZQT A;  4YMQ A;  2I4P A;  1PDU A;  1PQ9 A;  3LBD A;  4RAK A;  4RZF A;  2QGW A;  4XTA A;  1T74 A;  3KYT A;  3OLL A;  3P88 A;  3VHW A;  4ZNS A;  2ZXZ A;  3RY9 A;  1Z5X E;  1U9E A;  1R6G A;  2AX6 A;  1SJ0 A;  1X7J A;  3ADT A;  1X7R A;  2J7X A;  2Q7J A;  2YLO A;  5DK9 A;  3TX7 B;  4OJB A;  5H1E A;  3A3Z X;  4XHD A;  3JZC A;  4OFU A;  1I38 A;  2G0G A;  3B0R A;  1OSH A;  3UP3 A;  4NUF A;  3WTQ A;  1A28 A;  3VT7 A;  4J5W A;  1Y0X X;  3VJH A;  4X1G A;  1FM6 A;  1GWQ A;  1R1K D;  4G20 A;  1I7G A;  5HZC A;  5DKE A;  1K7L A;  1QKM A;  1S19 A;  2Q5P A;  3AUN A;  1NQ1 A;  1FBY A;  5AVI A;  3F5C B;  4OIL A;  2O9I A;  1OVL A;  5DP0 A;  4Y29 A;  3BQD A;  5EGV A;  3K8S A;  2Q6R A;  2BAW A;  5FQT A;  3R8A A;  4LSJ A;  4N73 A;  3H0A D;  2E2R A;  2AWH A;  2GTK A;  1N83 A;  2AX9 A;  4PP3 A;  2NPA A;  3AZ3 A;  3L0E A;  5B5B A;  2ABI A;  3A2J A;  5E14 A;  4IV2 A;  5DIE A;  5DKG A;  3VJT A;  4IVY A;  3UUA A;  2J4A A;  2PKL A;  2ZNQ A;  3IPU A;  4OFR A;  5IXK A;  5KRK A;  3OMP A;  3QT0 A;  4R6S A;  1R1K A;  5G44 A;  5FQR A;  2ZLC A;  4Q50 A;  5DUH A;  1UPW A;  5HYR A;  1S0Z A;  5B41 A;  2P7A A;  1FCY A;  2OCF A;  3NSP A;  4S0T A;  3SP6 A;  4B7W A;  3OMQ A;  4PRG A;  1S9P A;  2PIW A;  5EC9 A;  2NXX A;  4RWV A;  1YOW A;  1XAP A;  2QR9 A;  4UDC A;  2J7Y A;  3B0Q A;  2VST A;  4IW6 A;  3KMR A;  2ZAS A;  1XJ7 A;  3MNE A;  4G1Y A;  5DV3 A;  4OK1 A;  2Q59 A;  1XP1 A;  4K7A A;  3ZRA A;  5KRH A;  3DCU A;  4WVD A;  4PPS A;  3VI8 A;  3O1D A;  2QSE A;  3HM1 A;  2PIO A;  2PRG A;  1VJB A;  4M8E A;  3S9S A;  4J26 A;  3V9T A;  3OSI A;  4QL8 A;  5DMC A;  3RUU A;  3VSP A;  4RUP A;  1N46 A;  3DCT A;  2A3I A;  5AWK A;  3IMY A;  5DWG A;  5G5W A;  1I7I A;  1GWR A;  2P1U A;  1ZUC A;  1X7B A;  3FS1 A;  4G2I A;  2AYR A;  5DUG A;  2ZKC A;  1OVL B;  4Q0A C;  1ZDT A;  2JJ3 A;  3IA6 A;  5DKS A;  3VTB A;  5EJV A;  1RJK A;  4K4J A;  4KZI A;  5G45 A;  5HJS A;  5SYZ A;  1HJ1 A;  2YJD A;  2PIX A;  3AN4 A;  3OGT A;  2AX8 A;  5DY8 A;  3WT6 A;  3VRU A;  5KRI A;  4IQR A;  3B1M A;  2PIP L;  3DR1 A;  2ZK2 A;  2VV0 A;  1ZGY A;  3GWS X;  2ZK1 A;  5DXM A;  4ZJR A;  3UUA B;  4UDA A;  4RMD A;  2Q8S A;  4J24 A;  3K6P A;  3R8D A;  4MGA A;  3E94 A;  2HAM A;  4CSJ A;  2XYX A;  3PLZ A;  1L2I A;  3AFR A;  3WJ4 A;  5DSH A;  2GPO A;  5GIE A;  3B66 A;  4WQP A;  4R06 A;  5AZT A;  3W5P A;  3ZR7 A;  1NHZ A;  2P1V A;  4ZOM A;  4A4V A;  3ADS A;  1RKG A;  2I0J A;  2P7Z A;  2VV1 A;  4OZR E;  5DXK A;  4TUZ A;  4RMC A;  4RME A;  2HWQ A;  2P7G A; 
#chains in the Genus database with same CATH homology
 1IE8 A;  1KV6 A;  4RUJ A;  3VJS A;  2AX7 A;  2AA7 A;  3E7C A;  4DOS A;  1FCZ A;  2ZK0 A;  2HC4 A;  2GIU A;  5FQS A;  2Q7K A;  3B65 A;  3MNO A;  2P4Y A;  2H77 A;  2Q3Y A;  2Q61 A;  2Q59 B;  4TV1 A;  5DXB A;  4OC7 A;  3SP9 A;  4DK7 A;  2ZMI A;  2YHD A;  2B1Z A;  5JI0 D;  4REE A;  5K13 A;  3W0A A;  3CDS A;  3L1B A;  4WPF A;  3HVL A;  1A52 A;  4MGB A;  1GS4 A;  1FM6 D;  3GYT A;  3OS9 A;  4Q13 A;  1PZL A;  1YIM A;  2AMA A;  1I37 A;  2PIN A;  3OSW A;  1YYE A;  1UOM A;  3FUR A;  3L0L A;  5HJP A;  3E00 A;  5DRM A;  3VHU A;  3ADU A;  1Z5X U;  1NQ2 A;  1MZN A;  2G5O A;  2LBD A;  3ERT A;  2IOK A;  3OMM A;  3D24 A;  4O8F A;  5DXQ A;  1E3K A;  2ZLA A;  3VHV A;  4POH A;  4OKB A;  5C4S A;  1UPV A;  1TFC A;  4HEE X;  4JYG A;  3R8I A;  3WGP A;  4ZNT A;  5KRC A;  3WMH A;  3BC5 A;  3UP0 A;  2FAI A;  1MV9 A;  2FVJ A;  1XV9 A;  4OZT U;  5DL4 A;  5GID A;  4XUM A;  3GWX A;  1S0X A;  3LMP A;  3CTB A;  1XLS A;  5KCU A;  2HAS A;  3A78 A;  2P15 A;  1SKX A;  3X1H A;  4UDB A;  1M2Z A;  4PPP A;  1ZKY A;  5APJ A;  2QA8 A;  4ZI1 A;  4FN9 A;  3TKM A;  4QM0 A;  2ZK5 A;  2QXS A;  2IHQ A;  2G44 A;  2XHS A;  3B67 A;  1T73 A;  3JZB A;  3CLD A;  3OKH A;  1K74 A;  5DV8 A;  4MGA B;  4KZM A;  1XQ3 A;  3CDP A;  3OS8 A;  1XZX X;  5DVS A;  2JF9 A;  2GP7 A;  3OZ0 A;  5KRO A;  2QW4 A;  4YT1 A;  2GWX A;  4MG7 B;  4XI3 A;  3TKC A;  4CI5 A;  1GWX A;  2W8Y A;  2GPP A;  1K4W A;  4RUO X;  1X78 A;  3FXV A;  5DYD A;  5L7G A;  2VV1 B;  3A9E A;  3GBK A;  4J5X C;  3VT4 A;  4TUZ B;  5C4O A;  1OT7 A;  5KCD A;  2P54 A;  3V3E A;  5KR9 A;  5KCT A;  3OOF A;  5AWJ A;  5JJM B;  3ILZ A;  2YLY A;  1PQ6 A;  3O1E A;  4UDD A;  2POG A;  2ZMJ A;  4TV1 B;  5DXB B;  3WJ5 A;  1XB7 A;  3V9V A;  2Q70 A;  1ZEO A;  5E15 A;  3DZY D;  4IA2 A;  3VJI A;  4ZN9 A;  5DTV A;  1NQ0 A;  4S0S A;  1LBD A;  1XP6 A;  4MGB B;  3F7D A;  2P1T A;  4MG6 A;  4OEY A;  1PRG A;  1Z95 A;  1T7R A;  5DZ0 A;  5F9B A;  2AA5 A;  4NY9 A;  1WM0 X;  3VT5 A;  5L7H A;  4OEZ A;  3T03 A;  2GPU A;  4APU A;  5HJP B;  4XT9 A;  4F9M A;  4N1Y A;  4PP5 A;  4KZJ A;  3X36 A;  2QTU A;  1ZDU A;  3CWD A;  3FLI A;  4IV4 A;  4QK4 A;  4IWC A;  3V9Y A;  1Y9R A;  3KWY A;  3OAP A;  4MG8 A;  1NAV A;  1ILH A;  3W0C A;  5KYJ A;  4A4W A;  3VT6 A;  1KKQ A;  1FM9 A;  3B0T A;  1XVP A;  3G0W A;  1X76 A;  3A2I A;  3CJW A;  1U3Q A;  4IVW A;  2G0H A;  1XQC A;  1XV9 B;  4ITE A;  2ZL9 A;  3KDU A;  4DQM A;  2HWR A;  5AAV A;  3P0U A;  3WFF A;  4OAR A;  5KCC A;  3DZY A;  2V0V A;  2PIV A;  3W0Y A;  5APH A;  2OAX A;  1T63 A;  3K22 A;  4WLB A;  2VV3 A;  4DMA A;  2QA6 A;  3ET2 A;  3HC5 A;  5E0X A;  5HYK A;  2NV7 A;  2QA8 B;  3W0G A;  4DOR A;  4E2J A;  5KRL A;  3W5R A;  5KCW A;  2ZFX A;  4OGH A;  3ZRB A;  2Q1V A;  3CS4 A;  3RLL A;  1YOK A;  4FHI A;  2QMV A;  1ZH7 A;  1ERE A;  2Q7I A;  4OJ9 A;  3FAL A;  4QE6 A;  1EXA A;  3D57 A;  3G8O A;  2R6W A;  1FD0 A;  2ZMH A;  4WHF A;  2YAT A;  1SR7 A;  3P89 A;  4IW8 A;  3ET1 A;  5KCE A;  4G1D A;  3A9E B;  3HZF A;  2B50 A;  2PJL A;  3KMG A;  5AVL A;  3HQ5 A;  3VRW A;  4P6W A;  3VTC A;  1P93 A;  4ZN7 A;  2ZNP A;  3X31 A;  5APK A;  4OED A;  1EXX A;  1T65 A;  3CQV A;  3D6D A;  1NAX A;  4ZNV A;  2ZVT A;  4M8H A;  5DZ1 A;  5E0W A;  5LGA A;  2ZXN A;  1R20 A;  4OHA A;  3KMZ A;  1G2N A;  2NW4 A;  3AZ1 A;  4EM9 A;  1G50 A;  1UHL A;  2VV2 A;  2OVH A;  3RLJ A;  1MVC A;  2ATH A;  2EWP A;  4OLM A;  4DK8 A;  3KPZ A;  4OEA A;  2Q5S A;  5GIC A;  5DXR A;  2VV4 A;  1M13 A;  2AA2 A;  4G21 A;  4MG7 A;  5IAW A;  3E00 D;  2XKW A;  5FQV A;  5E19 A;  1PCG A;  3X1I A;  4OKW A;  4OZR U;  3VRT A;  2QH6 A;  4MG8 B;  5AAU A;  5JJM A;  1XVP B;  3IXP A;  3R5N A;  3HO0 A;  3VTD A;  5G43 A;  3DY6 A;  2YFE A;  5EIT A;  2Q7L A;  5AAV B;  2QXM A;  3D5F A;  3R5M A;  3NOA A;  2QGT A;  3VT8 A;  1YJE A;  5I4V A;  3PBA A;  5EI1 A;  4OH6 A;  3KFC A;  3UU7 B;  5DZH A;  5DID A;  1OSV A;  2BJ4 A;  5JY3 A;  2AXA A;  5G42 A;  3TY0 A;  1K74 D;  1T5Z A;  4IU7 A;  4QJR A;  2O4R A;  4N8R A;  1U3R A;  4PP6 A;  1T7M A;  3OLS A;  2I4J A;  3FAL B;  5KRA A;  3ET3 A;  3HLV A;  3NSQ A;  2OZ7 A;  5DWI A;  1QKU A;  5KRJ A;  4P6X A;  3CS8 A;  3ET0 A;  4MGD A;  1NRL A;  1Y0S A;  1XOW A;  4IA1 A;  2B1V A;  2IOG A;  5DXE A;  2Z4B A;  4DM6 A;  2HB7 A;  3RUT A;  4OIV A;  5E1C A;  3W5T A;  3SZ1 A;  5DX3 A;  1DKF A;  1YY4 A;  3L3Z A;  1N4H A;  2OVM A;  2JFA A;  4XLD A;  1S9Q A;  1M7W A;  2R40 A;  3B0W A;  1NUO A;  5DI7 A;  5ACC A;  3DZU D;  3OOK A;  3U9Q A;  2ACL A;  3FC6 A;  2AO6 A;  1UHL B;  4ITF A;  5DWJ A;  5G3J A;  3KBA A;  4RZE A;  4S15 A;  2OUZ A;  3PRG A;  3VSO A;  1ZAF A;  3AZ2 A;  3D90 A;  2FSZ A;  2VV4 B;  4LTW A;  2PIQ A;  5KCF A;  3AX8 A;  3W5Q A;  3ADW A;  4OZT E;  2Z4J A;  1ERR A;  5KYA A;  2Q1H A;  3UUD A;  4YNK A;  4XAO A;  4ZNH A;  5ETH A;  4E4Q A;  2ZNO A;  1FM9 D;  4JGV A;  1RK3 A;  4YPQ A;  2ZXM A;  4IWF A;  1H9U A;  3EYB A;  5CJ6 A;  5HCV A;  1T76 A;  3FEJ A;  2YLP A;  5DKB A;  5M96 A;  5G46 A;  2Q5G A;  4G2H A;  4PLE A;  5L11 A;  1XNN A;  1RDT D;  3V49 A;  3IPQ A;  1T7F A;  3L03 A;  5DVV A;  4X1F A;  2VSR A;  4OJ4 A;  4BCR A;  3DZU A;  3R2A A;  4EMA A;  3GZ9 A;  2POB A;  2OM9 A;  2BJ4 B;  4ZO1 X;  3KDT A;  4A2J A;  4JYI A;  2AMB A;  4MG9 A;  1U3S A;  1XDK A;  2ZK6 A;  5LWP A;  1QKN A;  2HCD A;  3CS6 A;  3ERD A;  4R2U A;  2AB2 A;  4PXM A;  4OH5 A;  5AYG A;  4ONI A;  4K6I A;  1YP0 A;  3R29 A;  1E3G A;  1XNX A;  3GYU A;  2GPV A;  5DLR A;  2PNU A;  1XIU A;  1NYX A;  4MGC A;  4ZNW A;  5GT4 A;  2J14 A;  2GL8 A;  3HOD A;  4MGD B;  1HG4 A;  2YLQ A;  3DT3 A;  1Q4X A;  3WFG A;  3PEQ A;  2ZNN A;  3GN8 A;  2HB8 A;  2ZBS A;  3ADX A;  4LNX A;  1G1U A;  5FQP A;  4POJ A;  2YJA B;  3VT9 A;  3OMO A;  5DX3 B;  1DKF B;  1RDT A;  2JFA B;  5DVC A;  3M7R A;  3Q95 A;  5DV6 A;  3IPS A;  4FGY A;  3UU7 A;  4ZJW A;  4IA7 A;  2R6Y A;  3G8I A;  1P8D A;  1R20 D;  2HBH A;  1BSX A;  4G1Z A;  3B68 A;  4LNW A;  2B23 A;  2Q6J A;  4RZG A;  5ICK A;  3RVF A;  2ACL B;  3FC6 B;  4E4K A;  5DWL A;  3PO9 A;  4J5W C;  2QZO A;  4QE8 A;  1YUC A;  5DMF A;  2REW A;  1YA3 A;  3H0A A;  3P8X A;  5E7V A;  3OS8 C;  4HLW A;  1YIN A;  3K23 A;  4RFW A;  5DWE A;  3GD2 A;  4XUH A;  5DUE A;  3UVV A;  5EHJ A;  3UUD B;  1FCX A;  1XPC A;  1PK5 A;  3L3X A;  5IZ0 A;  3IXP D;  5DRJ A;  4JAZ A;  2PIU A;  2XYJ A;  3B5R A;  4RE8 A;  1ILG A;  2AM9 A;  3OKI A;  3B3K A;  5DZI A;  5KRF A;  4NQA B;  4PF3 A;  5C4U A;  4PVU A;  1TXI A;  3V3Q A;  5DXG A;  5A86 A;  5DXP A;  1IE9 A;  4REF A;  1RKH A;  3L0J A;  4JYH A;  2QNV A;  3W0H A;  3N00 A;  4DM8 A;  1XP9 A;  4FHH A;  4IA3 A;  4N5G A;  4MG9 B;  4MG5 A;  4L98 A;  1XDK B;  1XLS E;  2QE4 A;  3VT3 A;  2H79 A;  2QAB A;  3PCU A;  1T7T A;  3VN2 A;  3VRV A;  2PIT A;  3AN3 A;  4NIE A;  3G9E A;  4IS8 A;  3MNP A;  1T79 A;  2QPY A;  3UUC A;  1X7E A;  5KRM A;  5AZV A;  4PLD A;  1LV2 A;  3FEI A;  4FNE A;  2I0G A;  5AK2 A;  3V4A A;  5DU5 A;  2O4J A;  5KD9 A;  1DB1 A;  3ADV A;  2AAX A;  2HVC A;  1KNU A;  3A2H A;  4WHG A;  5DIG A;  1G5Y A;  5DZ3 A;  3Q95 B;  4OKT A;  2PIR A;  2R40 D;  4NB6 A;  3HC6 A;  2F4B A;  2ZK4 A;  4OIU A;  3F5C A;  3OMK A;  4J5X A;  1R5K A;  3OSA A;  2I4Z A;  3WWR A;  2AA6 A;  3OLF A;  1NQ7 A;  3WT5 A;  3A40 X;  2QZO B;  1YMT A;  5L7E A;  4IUI A;  3WT7 A;  3FUG A;  5C4T A;  2XYW A;  4OKX A;  2ZY0 A;  3W0I A;  2Q6S A;  4S14 A;  5DYB A;  3H52 A;  4L96 A;  4PWL A;  4LBD A;  2V7C A;  3OZJ A;  3UVV B;  2HFP A;  2Q60 A;  1L2J A;  4ZO1 B;  3BEJ A;  3W0J A;  4MDD A;  1SQN A;  1PQC A;  3AUQ A;  4JL4 A;  1QKT A;  2ZK3 A;  2NXX E;  3AUR A;  1NDE A;  2HAR A;  4ZNU A;  4CI4 A;  3ZQT A;  4YMQ A;  2I4P A;  1PDU A;  1PQ9 A;  3LBD A;  4RAK A;  4RZF A;  2QGW A;  4XTA A;  1T74 A;  3KYT A;  3OLL A;  3P88 A;  3VHW A;  4ZNS A;  2ZXZ A;  3RY9 A;  1Z5X E;  1U9E A;  1R6G A;  2AX6 A;  1SJ0 A;  1X7J A;  3ADT A;  1X7R A;  2J7X A;  2Q7J A;  2YLO A;  5DK9 A;  3TX7 B;  4OJB A;  5H1E A;  3A3Z X;  4XHD A;  3JZC A;  4OFU A;  1I38 A;  2G0G A;  3B0R A;  1OSH A;  3UP3 A;  4NUF A;  3WTQ A;  1A28 A;  3VT7 A;  4J5W A;  1Y0X X;  3VJH A;  4X1G A;  1FM6 A;  1GWQ A;  1R1K D;  4G20 A;  1I7G A;  5HZC A;  5DKE A;  1K7L A;  1QKM A;  1S19 A;  2Q5P A;  3AUN A;  1NQ1 A;  1FBY A;  5AVI A;  3F5C B;  4OIL A;  2O9I A;  1OVL A;  5DP0 A;  4Y29 A;  3BQD A;  5EGV A;  3K8S A;  2Q6R A;  2BAW A;  5FQT A;  3R8A A;  4LSJ A;  4N73 A;  3H0A D;  2E2R A;  2AWH A;  2GTK A;  1N83 A;  2AX9 A;  4PP3 A;  2NPA A;  3AZ3 A;  3L0E A;  5B5B A;  2ABI A;  3A2J A;  5E14 A;  4IV2 A;  5DIE A;  5DKG A;  3VJT A;  4IVY A;  3UUA A;  2J4A A;  2PKL A;  2ZNQ A;  3IPU A;  4OFR A;  5IXK A;  5KRK A;  3OMP A;  3QT0 A;  4R6S A;  1R1K A;  5G44 A;  5FQR A;  2ZLC A;  4Q50 A;  5DUH A;  1UPW A;  5HYR A;  1S0Z A;  5B41 A;  2P7A A;  1FCY A;  2OCF A;  3NSP A;  4S0T A;  3SP6 A;  4B7W A;  3OMQ A;  4PRG A;  1S9P A;  2PIW A;  5EC9 A;  2NXX A;  4RWV A;  1YOW A;  1XAP A;  2QR9 A;  4UDC A;  2J7Y A;  3B0Q A;  2VST A;  4IW6 A;  3KMR A;  2ZAS A;  1XJ7 A;  3MNE A;  4G1Y A;  5DV3 A;  4OK1 A;  2Q59 A;  1XP1 A;  4K7A A;  3ZRA A;  5KRH A;  3DCU A;  4WVD A;  4PPS A;  3VI8 A;  3O1D A;  2QSE A;  3HM1 A;  2PIO A;  2PRG A;  1VJB A;  4M8E A;  3S9S A;  4J26 A;  3V9T A;  3OSI A;  4QL8 A;  5DMC A;  3RUU A;  3VSP A;  4RUP A;  1N46 A;  3DCT A;  2A3I A;  5AWK A;  3IMY A;  5DWG A;  5G5W A;  1I7I A;  1GWR A;  2P1U A;  1ZUC A;  1X7B A;  3FS1 A;  4G2I A;  2AYR A;  5DUG A;  2ZKC A;  1OVL B;  4Q0A C;  1ZDT A;  2JJ3 A;  3IA6 A;  5DKS A;  3VTB A;  5EJV A;  1RJK A;  4K4J A;  4KZI A;  5G45 A;  5HJS A;  5SYZ A;  1HJ1 A;  2YJD A;  2PIX A;  3AN4 A;  3OGT A;  2AX8 A;  5DY8 A;  3WT6 A;  3VRU A;  5KRI A;  4IQR A;  3B1M A;  2PIP L;  3DR1 A;  2ZK2 A;  2VV0 A;  1ZGY A;  3GWS X;  2ZK1 A;  5DXM A;  4ZJR A;  3UUA B;  4UDA A;  4RMD A;  2Q8S A;  4J24 A;  3K6P A;  3R8D A;  4MGA A;  3E94 A;  2HAM A;  4CSJ A;  2XYX A;  3PLZ A;  1L2I A;  3AFR A;  3WJ4 A;  5DSH A;  2GPO A;  5GIE A;  3B66 A;  4WQP A;  4R06 A;  5AZT A;  3W5P A;  3ZR7 A;  1NHZ A;  2P1V A;  4ZOM A;  4A4V A;  3ADS A;  1RKG A;  2I0J A;  2P7Z A;  2VV1 A;  4OZR E;  5DXK A;  4TUZ A;  4RMC A;  4RME A;  2HWQ A;  2P7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...