4WPFA

Crystal structure of rorc in complex with a phenyl sulfonamide agonist
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
246
structure length
246
Chain Sequence
YASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Minor Structural Change to Tertiary Sulfonamide RORc Ligands Led to Opposite Mechanisms of Action.
pubmed doi rcsb
molecule keywords Nuclear receptor ROR-gamma
molecule tags Transcription
source organism Homo sapiens
total genus 91
structure length 246
sequence length 246
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4wpfA00
3UUDA 2QA8A 5ETHA 4WPFA 2QE4A 4RAKA 3OS9A 3R5NA 3A2JA 1IE9A 1NQ0A 2Q6RA 1T7TA 1PDUA 1XDKA 3B1MA 5GIDA 1RJKA 2NV7A 4OZTE 4RZEA 1XNXA 4PLEA 1YUCA 5DWJA 4A4VA 3AZ1A 2B23A 3A2HA 3FEJA 3O1DA 2Q59A 4OZRU 5KCEA 3DT3A 3IXPD 3FC6B 2ZK0A 1L2IA 5G46A 3VRWA 3IPUA 1X78A 5DV8A 4MG9A 1YOKA 4P6WA 1FD0A 4MGDA 2AA6A 1NRLA 4JYIA 3B0WA 2Q6JA 3L3XA 5ACCA 5L11A 2IOGA 4OZTU 3TKCA 2O4RA 2HBHA 5DIEA 4POJA 2OUZA 3BQDA 3F7DA 4OJ9A 5DSHA 3DZYD 2XYJA 3VRUA 1GWXA 1ZGYA 5DIGA 2J7YA 2P7ZA 1P8DA 1ZDTA 1QKMA 4OIUA 5APJA 3LMPA 1ZAFA 4IA2A 4OJ4A 5G5WA 5KRCA 5IAWA 2G0GA 3VT4A 5GT4A 5HYKA 2Q5SA 1YMTA 3AZ2A 1IE8A 2W8YA 3FEIA 4OHAA 1NQ7A 2VV1A 4KZMA 4Q0AC 2LBDA 3B67A 1EXXA 4OFRA 4J5XC 3DZYA 2JJ3A 2BJ4B 1UOMA 2QZOA 5KRFA 4NUFA 1HG4A 2AXAA 3VJHA 1OVLB 2GTKA 5DUHA 5DVCA 3RLJA 1YYEA 5DXPA 2Q7KA 3VI8A 3A9EA 2NXXE 4IWCA 3WT7A 2J4AA 5DKBA 3GYTA 1Y0SA 2YJDA 4ZNSA 3U9QA 3HLVA 2BJ4A 2ZXMA 3GWSX 3OMQA 4LNXA 2AX6A 1TXIA 1NUOA 1OSVA 1XZXX 1R5KA 3CQVA 3H52A 3VJTA 3VRVA 3NOAA 3W0GA 3W5QA 5DWEA 4E4KA 5JJMA 2QW4A 4S0SA 2R40D 4ZNUA 1X7EA 3RLLA 3WFGA 5DY8A 4K6IA 3M7RA 2VSRA 5DXEA 5EHJA 5DXBA 4N1YA 5EJVA 5DKGA 1HJ1A 3OZJA 4OEAA 2QSEA 5G45A 1ZH7A 3GZ9A 3W0CA 3OMKA 2R6YA 4DM6A 5AZTA 4XUHA 4FHIA 1S9PA 1I7IA 3UU7A 3H0AA 1M7WA 1Y0XX 3CJWA 2P54A 1X7RA 2AB2A 2Q60A 5FQVA 5DZIA 2FAIA 1XVPB 2P4YA 4TUZB 1YIMA 2Q70A 3WFFA 2ZKCA 1RDTD 3AUQA 3VJIA 1P93A 4IVYA 2XHSA 3CDSA 3K22A 4NB6A 4OIVA 1NQ1A 2ZNQA 3ADWA 1T5ZA 1XVPA 4IW8A 4PP6A 4RWVA 5E1CA 1T7MA 2PINA 3MNEA 4KZJA 5EI1A 4IA7A 3LBDA 1G1UA 4HEEX 4PXMA 5DK9A 5EGVA 3L0JA 3OSIA 3OS8A 4UDBA 4MGCA 4QE6A 5DXRA 3OKHA 3D90A 5C4TA 2YLQA 1ZUCA 4J5WA 2AMAA 5AAVB 5GICA 3WGPA 1RDTA 1E3GA 3KWYA 3JZBA 2I4ZA 4PF3A 4S15A 1MVCA 3VT9A 2I0GA 4ZO1X 1NQ2A 3VT3A 1YP0A 2OZ7A 3R8DA 3K6PA 4PPSA 5G42A 4OARA 5DKEA 4G1DA 2PIXA 3CWDA 3TKMA 3O1EA 1KNUA 1YOWA 4PVUA 5LGAA 5KRHA 4OEZA 5AAVA 4WHFA 1PQCA 2ZK3A 4HLWA 3V49A 1XLSE 2HARA 2Q3YA 3VTCA 2B1VA 2Q8SA 3OKIA 3ADTA 3ADVA 2QTUA 3IPSA 2QNVA 3W5PA 1NYXA 3K23A 5C4OA 5DUEA 3OSWA 3KDTA 1T79A 4G21A 1I7GA 2ATHA 1UHLA 3V4AA 2G5OA 2QMVA 3HVLA 3PBAA 4LNWA 4XLDA 2P7GA 2JF9A 4IQRA 1PRGA 5DXQA 1M13A 4OH5A 2OVMA 2ZK1A 1XP9A 4XHDA 2ZNNA 5DI7A 5DVVA 3OLLA 5HJPB 5DMCA 4EMAA 1FBYA 1GS4A 2VV0A 2HAMA 3VHVA 1A52A 1N4HA 5DP0A 3OZ0A 4EM9A 3RUUA 2Q5PA 4OLMA 5DTVA 4OC7A 5E14A 4N5GA 2Q7JA 5HZCA 1R20D 5DU5A 3X1IA 2ZK6A 2BAWA 3SZ1A 2YLPA 5LWPA 3GBKA 4PP3A 3W0JA 5DL4A 4OKWA 4F9MA 2ZMJA 3AFRA 2POBA 1Y9RA 2J7XA 3TY0A 5DYDA 4DK7A 4MG7B 3HZFA 2YLOA 2P7AA 3E7CA 3L1BA 4QK4A 5APKA 2ZMIA 1T74A 3ADSA 3CLDA 3P88A 1XAPA 2VV2A 2YJAB 3FC6A 3UVVB 2OM9A 3V9TA 3G8IA 3PCUA 3PO9A 3KMZA 4ZOMA 3WT6A 1R6GA 5KYAA 3IXPA 3JZCA 2GP7A 1EXAA 4MG7A 3DY6A 5DKSA 1K7LA 1GWQA 5IXKA 4WVDA 5AVIA 4ZJWA 4OKXA 2I4PA 5DLRA 3WMHA 1MZNA 2PRGA 1T73A 4OFUA 1KV6A 4J5XA 4X1GA 4MG8B 2XYWA 5DXKA 2JFAB 3K8SA 1X7BA 1TFCA 2ZK4A 5F9BA 4RMDA 1S19A 2ZXNA 2AA2A 2OVHA 1I38A 1K4WA 2H79A 1PQ6A 5HJSA 5JY3A 2GWXA 1XQ3A 1QKTA 4ITFA 4R2UA 4WHGA 5KRJA 2I0JA 3AZ3A 4OK1A 2AYRA 3WJ4A 4MG8A 1Z95A 3HODA 3B5RA 1SKXA 1XOWA 5DX3B 3FALB 2ZNPA 1OVLA 2AWHA 3E00D 2Z4BA 3FS1A 2P1TA 4XUMA 2ABIA 4M8EA 2ZMHA 4IVWA 1FM9D 2G0HA 3HO0A 4XTAA 5DIDA 5EC9A 1I37A 2ZASA 3UP3A 1NDEA 2VV3A 3IPQA 2GPPA 3GD2A 2NXXA 4QL8A 1LBDA 3V9VA 2AX8A 2PIVA 3FALA 3FLIA 5I4VA 1SR7A 5KRAA 3RUTA 4ZO1B 1M2ZA 4JYHA 3PRGA 1A28A 4LSJA 1NHZA 3ET1A 3HQ5A 2AA7A 3L3ZA 5KCTA 5KCWA 4UDAA 4REEA 2R40A 3KMRA 1T7FA 4N73A 4FN9A 3E94A 4Y29A 4P6XA 3T03A 3FUGA 5KYJA 3SP9A 4E4QA 5KRLA 4BCRA 5AK2A 1X76A 4JAZA 2ZK2A 4QE8A 1UPWA 4L96A 2ACLB 4RE8A 5DUGA 3OLFA 4OILA 2AAXA 1NAXA 4TUZA 2EWPA 4DOSA 2Q7IA 3SP6A 1G50A 3F5CB 2YATA 2AM9A 2B50A 1DKFB 4B7WA 5KCDA 1K74D 1X7JA 3OSAA 2PNUA 3VT7A 4DK8A 2QABA 5KRKA 3RVFA 4LBDA 4OKTA 5CJ6A 4M8HA 5EITA 4CSJA 3FXVA 1ZEOA 4R06A 5DWLA 2ZK5A 3BC5A 1Q4XA 3D24A 2VV4B 3WJ5A 2ZY0A 1DKFA 2HASA 3PEQA 1OT7A 3X31A 2V7CA 4MGAB 3IA6A 5E0XA 2QR9A 2G44A 5KROA 2J14A 2YFEA 3ZRBA 1K74A 4PWLA 4UDCA 3UUAB 5L7EA 4G2HA 3ADUA 4YPQA 2P1VA 4S0TA 3W5TA 2PIRA 4S14A 5JI0D 1ILHA 2AMBA 3L0LA 3AX8A 5DV6A 4O8FA 2O4JA 1E3KA 3A3ZX 2HWQA 4KZIA 3Q95B 1YY4A 1XLSA 5DVSA 5E15A 3W0YA 1N46A 2IOKA 2OCFA 3VT8A 2ZNOA 2QGTA 1FCYA 4YT1A 4POHA 4Q50A 3W0HA 5G43A 4WLBA 3KYTA 2FSZA 5B41A 3N00A 4XAOA 4JGVA 3ADXA 4A2JA 3BEJA 3CTBA 5B5BA 5DWGA 1PQ9A 2PITA 2HCDA 3VHWA 2AX9A 4REFA 5KCCA 1XDKB 3ET0A 5A86A 3R8IA 4PLDA 4G2IA 5HJPA 5G3JA 4XT9A 5AVLA 5E7VA 1S0XA 1EREA 1GWRA 1XPCA 1G5YA 1R1KD 2XKWA 3UUCA 1H9UA 1WM0X 2HVCA 2Q59B 5FQTA 3FURA 2OAXA 1N83A 3OOKA 3R5MA 4K7AA 4XI3A 1ZKYA 4WQPA 3L0EA 2QXMA 2ZLAA 4MG9B 5KD9A 3V9YA 4JYGA 2PIWA 1R20A 1S0ZA 2P15A 4MGDB 5KRMA 4IS8A 1DB1A 4QJRA 3GYUA 3MNOA 4RUJA 1XB7A 2A3IA 5HYRA 2AO6A 2E2RA 5AWJA 1R1KA 2ZVTA 3UVVA 2Z4JA 2IHQA 1RKHA 3HC6A 3W0IA 4RUOX 2VSTA 4YMQA 1YJEA 1NAVA 3OMMA 2QH6A 2AA5A 3PLZA 5G44A 1FCZA 2PKLA 1FM6D 3D5FA 4IV4A 1PZLA 4PRGA 3B66A 4RZGA 4CI5A 3AUNA 5M96A 3UP0A 1XQCA 4J24A 2I4JA 5E0WA 3KMGA 4RUPA 3VSPA 2VV1B 3DCTA 1U9EA 1L2JA 3DR1A 3B0QA 3CDPA 4IUIA 4NY9A 5C4SA 2XYXA 2QA6A 5FQSA 2YHDA 2QZOB 2HB8A 2JFAA 4Q13A 5DXGA 5SYZA 4ZNTA 2GIUA 2NPAA 3G9EA 3RY9A 5DV3A 1XP6A 5C4UA 1FM6A 2Q1VA 3A9EB 2GPVA 2O9IA 2HC4A 2R6WA 3A78A 4J26A 4TV1B 5HCVA 4E2JA 5AZVA 5FQPA 2Q1HA 4OGHA 4RMEA 4ITEA 3VSOA 4K4JA 5DZ1A 3A2IA 4APUA 2POGA 4MGBB 5AAUA 4MG5A 2REWA 5DX3A 5JJMB 4DM8A 3DZUD 4OH6A 4ZN9A 1MV9A 2ZFXA 3KPZA 1QKNA 3ILZA 3CS8A 4TV1A 3VTBA 2QPYA 4ZNVA 1OSHA 3E00A 3DCUA 3WT5A 4ZNWA 2PJLA 3AURA 4ZI1A 5DXBB 3X1HA 5DRMA 3KDUA 4ZN7A 1FM9A 5DMFA 3H0AD 4UDDA 1KKQA 2NW4A 2GL8A 1XV9B 1XJ7A 1U3RA 4X1FA 3UU7B 4QM0A 3OAPA 3W0AA 3NSQA 1LV2A 1S9QA 4PPPA 1YA3A 5DRJA 4ZJRA 1T76A 3DZUA 5KCFA 3R8AA 5DXMA 4NQAB 4MG6A 4IU7A 5H1EA 2GPUA 5KR9A 3B3KA 1UPVA 2Q7LA 3ERDA 3HM1A 3B68A 3D57A 4G20A 3VHUA 1XV9A 3S9SA 1ILGA 4YNKA 4MDDA 2F4BA 3D6DA 4IV2A 3CS6A 5AWKA 4DORA 3VT6A 5DZ3A 2P1UA 5APHA 1BSXA 5AYGA 1YINA 5IZ0A 5L7HA 4CI4A 3MNPA 3OMPA 4A4WA 2ACLA 4OJBA 1PCGA 1T65A 3VRTA 5E19A 1U3QA 2Q5GA 3OMOA 1SJ0A 2ZXZA 3EYBA 3F5CA 4ONIA 2PIQA 1U3SA 3IMYA 4FNEA 3NSPA 4N8RA 2V0VA 3G8OA 2ZBSA 1Z5XE 4RZFA 3VN2A 3X36A 2HWRA 3ERTA 3TX7B 4JL4A 4ZNHA 3W5RA 4OKBA 3QT0A 2Q6SA 4MGBA 3GWXA 2YLYA 4IWFA 5DZ0A 3OS8C 2VV4A 3AN3A 3G0WA 3L03A 3GN8A 3P8XA 3WWRA 4G1ZA 1XIUA 3AN4A 1PK5A 4J5WC 4MGAA 3P0UA 4RFWA 3WTQA 3R29A 1Z5XU 4IW6A 1XNNA 2GPOA 1RK3A 2Q61A 3B65A 3KBAA 2AX7A 4R6SA 4RMCA 1QKUA 1G2NA 2H77A 3A40X 3B0TA 3KFCA 3VTDA 3HC5A 3R2AA 2HFPA 1FCXA 3UUAA 2PIPL 3VT5A 4DQMA 3ZR7A 2HB7A 4FGYA 4IA3A 3V3QA 3ZRAA 2PIOA 2PIUA 3OLSA 4LTWA 3ET2A 3OGTA 4OEDA 5FQRA 1UHLB 5DZHA 1RKGA 3OOFA 5ICKA 5L7GA 2ZL9A 5KRIA 3CS4A 3ET3A 1ZDUA 2QGWA 5DWIA 2ZLCA 3P89A 3Q95A 2QA8B 3UUDB 4FHHA 1SQNA 1T7RA 5DYBA 2QXSA 5K13A 5KCUA 4IA1A 4L98A 4DMAA 4OEYA 2FVJA 4G1YA 4NIEA 4PP5A 3V3EA 1ERRA 5GIEA 3VJSA 3ZQTA 4OZRE 1T63A 1XP1A 3B0RA 1VJBA 2B1ZA
chains in the Genus database with same CATH superfamily
3UUDA 2QA8A 5ETHA 4WPFA 2QE4A 4RAKA 3OS9A 3R5NA 3A2JA 1IE9A 1NQ0A 2Q6RA 1T7TA 1PDUA 1XDKA 3B1MA 5GIDA 1RJKA 2NV7A 4OZTE 4RZEA 1XNXA 4PLEA 1YUCA 5DWJA 4A4VA 3AZ1A 2B23A 3A2HA 3FEJA 3O1DA 2Q59A 4OZRU 5KCEA 3DT3A 3IXPD 3FC6B 2ZK0A 1L2IA 5G46A 3VRWA 3IPUA 1X78A 5DV8A 4MG9A 1YOKA 4P6WA 1FD0A 4MGDA 2AA6A 1NRLA 4JYIA 3B0WA 2Q6JA 3L3XA 5ACCA 5L11A 2IOGA 4OZTU 3TKCA 2O4RA 2HBHA 5DIEA 4POJA 2OUZA 3BQDA 3F7DA 4OJ9A 5DSHA 3DZYD 2XYJA 3VRUA 1GWXA 1ZGYA 5DIGA 2J7YA 2P7ZA 1P8DA 1ZDTA 1QKMA 4OIUA 5APJA 3LMPA 1ZAFA 4IA2A 4OJ4A 5G5WA 5KRCA 5IAWA 2G0GA 3VT4A 5GT4A 5HYKA 2Q5SA 1YMTA 3AZ2A 1IE8A 2W8YA 3FEIA 4OHAA 1NQ7A 2VV1A 4KZMA 4Q0AC 2LBDA 3B67A 1EXXA 4OFRA 4J5XC 3DZYA 2JJ3A 2BJ4B 1UOMA 2QZOA 5KRFA 4NUFA 1HG4A 2AXAA 3VJHA 1OVLB 2GTKA 5DUHA 5DVCA 3RLJA 1YYEA 5DXPA 2Q7KA 3VI8A 3A9EA 2NXXE 4IWCA 3WT7A 2J4AA 5DKBA 3GYTA 1Y0SA 2YJDA 4ZNSA 3U9QA 3HLVA 2BJ4A 2ZXMA 3GWSX 3OMQA 4LNXA 2AX6A 1TXIA 1NUOA 1OSVA 1XZXX 1R5KA 3CQVA 3H52A 3VJTA 3VRVA 3NOAA 3W0GA 3W5QA 5DWEA 4E4KA 5JJMA 2QW4A 4S0SA 2R40D 4ZNUA 1X7EA 3RLLA 3WFGA 5DY8A 4K6IA 3M7RA 2VSRA 5DXEA 5EHJA 5DXBA 4N1YA 5EJVA 5DKGA 1HJ1A 3OZJA 4OEAA 2QSEA 5G45A 1ZH7A 3GZ9A 3W0CA 3OMKA 2R6YA 4DM6A 5AZTA 4XUHA 4FHIA 1S9PA 1I7IA 3UU7A 3H0AA 1M7WA 1Y0XX 3CJWA 2P54A 1X7RA 2AB2A 2Q60A 5FQVA 5DZIA 2FAIA 1XVPB 2P4YA 4TUZB 1YIMA 2Q70A 3WFFA 2ZKCA 1RDTD 3AUQA 3VJIA 1P93A 4IVYA 2XHSA 3CDSA 3K22A 4NB6A 4OIVA 1NQ1A 2ZNQA 3ADWA 1T5ZA 1XVPA 4IW8A 4PP6A 4RWVA 5E1CA 1T7MA 2PINA 3MNEA 4KZJA 5EI1A 4IA7A 3LBDA 1G1UA 4HEEX 4PXMA 5DK9A 5EGVA 3L0JA 3OSIA 3OS8A 4UDBA 4MGCA 4QE6A 5DXRA 3OKHA 3D90A 5C4TA 2YLQA 1ZUCA 4J5WA 2AMAA 5AAVB 5GICA 3WGPA 1RDTA 1E3GA 3KWYA 3JZBA 2I4ZA 4PF3A 4S15A 1MVCA 3VT9A 2I0GA 4ZO1X 1NQ2A 3VT3A 1YP0A 2OZ7A 3R8DA 3K6PA 4PPSA 5G42A 4OARA 5DKEA 4G1DA 2PIXA 3CWDA 3TKMA 3O1EA 1KNUA 1YOWA 4PVUA 5LGAA 5KRHA 4OEZA 5AAVA 4WHFA 1PQCA 2ZK3A 4HLWA 3V49A 1XLSE 2HARA 2Q3YA 3VTCA 2B1VA 2Q8SA 3OKIA 3ADTA 3ADVA 2QTUA 3IPSA 2QNVA 3W5PA 1NYXA 3K23A 5C4OA 5DUEA 3OSWA 3KDTA 1T79A 4G21A 1I7GA 2ATHA 1UHLA 3V4AA 2G5OA 2QMVA 3HVLA 3PBAA 4LNWA 4XLDA 2P7GA 2JF9A 4IQRA 1PRGA 5DXQA 1M13A 4OH5A 2OVMA 2ZK1A 1XP9A 4XHDA 2ZNNA 5DI7A 5DVVA 3OLLA 5HJPB 5DMCA 4EMAA 1FBYA 1GS4A 2VV0A 2HAMA 3VHVA 1A52A 1N4HA 5DP0A 3OZ0A 4EM9A 3RUUA 2Q5PA 4OLMA 5DTVA 4OC7A 5E14A 4N5GA 2Q7JA 5HZCA 1R20D 5DU5A 3X1IA 2ZK6A 2BAWA 3SZ1A 2YLPA 5LWPA 3GBKA 4PP3A 3W0JA 5DL4A 4OKWA 4F9MA 2ZMJA 3AFRA 2POBA 1Y9RA 2J7XA 3TY0A 5DYDA 4DK7A 4MG7B 3HZFA 2YLOA 2P7AA 3E7CA 3L1BA 4QK4A 5APKA 2ZMIA 1T74A 3ADSA 3CLDA 3P88A 1XAPA 2VV2A 2YJAB 3FC6A 3UVVB 2OM9A 3V9TA 3G8IA 3PCUA 3PO9A 3KMZA 4ZOMA 3WT6A 1R6GA 5KYAA 3IXPA 3JZCA 2GP7A 1EXAA 4MG7A 3DY6A 5DKSA 1K7LA 1GWQA 5IXKA 4WVDA 5AVIA 4ZJWA 4OKXA 2I4PA 5DLRA 3WMHA 1MZNA 2PRGA 1T73A 4OFUA 1KV6A 4J5XA 4X1GA 4MG8B 2XYWA 5DXKA 2JFAB 3K8SA 1X7BA 1TFCA 2ZK4A 5F9BA 4RMDA 1S19A 2ZXNA 2AA2A 2OVHA 1I38A 1K4WA 2H79A 1PQ6A 5HJSA 5JY3A 2GWXA 1XQ3A 1QKTA 4ITFA 4R2UA 4WHGA 5KRJA 2I0JA 3AZ3A 4OK1A 2AYRA 3WJ4A 4MG8A 1Z95A 3HODA 3B5RA 1SKXA 1XOWA 5DX3B 3FALB 2ZNPA 1OVLA 2AWHA 3E00D 2Z4BA 3FS1A 2P1TA 4XUMA 2ABIA 4M8EA 2ZMHA 4IVWA 1FM9D 2G0HA 3HO0A 4XTAA 5DIDA 5EC9A 1I37A 2ZASA 3UP3A 1NDEA 2VV3A 3IPQA 2GPPA 3GD2A 2NXXA 4QL8A 1LBDA 3V9VA 2AX8A 2PIVA 3FALA 3FLIA 5I4VA 1SR7A 5KRAA 3RUTA 4ZO1B 1M2ZA 4JYHA 3PRGA 1A28A 4LSJA 1NHZA 3ET1A 3HQ5A 2AA7A 3L3ZA 5KCTA 5KCWA 4UDAA 4REEA 2R40A 3KMRA 1T7FA 4N73A 4FN9A 3E94A 4Y29A 4P6XA 3T03A 3FUGA 5KYJA 3SP9A 4E4QA 5KRLA 4BCRA 5AK2A 1X76A 4JAZA 2ZK2A 4QE8A 1UPWA 4L96A 2ACLB 4RE8A 5DUGA 3OLFA 4OILA 2AAXA 1NAXA 4TUZA 2EWPA 4DOSA 2Q7IA 3SP6A 1G50A 3F5CB 2YATA 2AM9A 2B50A 1DKFB 4B7WA 5KCDA 1K74D 1X7JA 3OSAA 2PNUA 3VT7A 4DK8A 2QABA 5KRKA 3RVFA 4LBDA 4OKTA 5CJ6A 4M8HA 5EITA 4CSJA 3FXVA 1ZEOA 4R06A 5DWLA 2ZK5A 3BC5A 1Q4XA 3D24A 2VV4B 3WJ5A 2ZY0A 1DKFA 2HASA 3PEQA 1OT7A 3X31A 2V7CA 4MGAB 3IA6A 5E0XA 2QR9A 2G44A 5KROA 2J14A 2YFEA 3ZRBA 1K74A 4PWLA 4UDCA 3UUAB 5L7EA 4G2HA 3ADUA 4YPQA 2P1VA 4S0TA 3W5TA 2PIRA 4S14A 5JI0D 1ILHA 2AMBA 3L0LA 3AX8A 5DV6A 4O8FA 2O4JA 1E3KA 3A3ZX 2HWQA 4KZIA 3Q95B 1YY4A 1XLSA 5DVSA 5E15A 3W0YA 1N46A 2IOKA 2OCFA 3VT8A 2ZNOA 2QGTA 1FCYA 4YT1A 4POHA 4Q50A 3W0HA 5G43A 4WLBA 3KYTA 2FSZA 5B41A 3N00A 4XAOA 4JGVA 3ADXA 4A2JA 3BEJA 3CTBA 5B5BA 5DWGA 1PQ9A 2PITA 2HCDA 3VHWA 2AX9A 4REFA 5KCCA 1XDKB 3ET0A 5A86A 3R8IA 4PLDA 4G2IA 5HJPA 5G3JA 4XT9A 5AVLA 5E7VA 1S0XA 1EREA 1GWRA 1XPCA 1G5YA 1R1KD 2XKWA 3UUCA 1H9UA 1WM0X 2HVCA 2Q59B 5FQTA 3FURA 2OAXA 1N83A 3OOKA 3R5MA 4K7AA 4XI3A 1ZKYA 4WQPA 3L0EA 2QXMA 2ZLAA 4MG9B 5KD9A 3V9YA 4JYGA 2PIWA 1R20A 1S0ZA 2P15A 4MGDB 5KRMA 4IS8A 1DB1A 4QJRA 3GYUA 3MNOA 4RUJA 1XB7A 2A3IA 5HYRA 2AO6A 2E2RA 5AWJA 1R1KA 2ZVTA 3UVVA 2Z4JA 2IHQA 1RKHA 3HC6A 3W0IA 4RUOX 2VSTA 4YMQA 1YJEA 1NAVA 3OMMA 2QH6A 2AA5A 3PLZA 5G44A 1FCZA 2PKLA 1FM6D 3D5FA 4IV4A 1PZLA 4PRGA 3B66A 4RZGA 4CI5A 3AUNA 5M96A 3UP0A 1XQCA 4J24A 2I4JA 5E0WA 3KMGA 4RUPA 3VSPA 2VV1B 3DCTA 1U9EA 1L2JA 3DR1A 3B0QA 3CDPA 4IUIA 4NY9A 5C4SA 2XYXA 2QA6A 5FQSA 2YHDA 2QZOB 2HB8A 2JFAA 4Q13A 5DXGA 5SYZA 4ZNTA 2GIUA 2NPAA 3G9EA 3RY9A 5DV3A 1XP6A 5C4UA 1FM6A 2Q1VA 3A9EB 2GPVA 2O9IA 2HC4A 2R6WA 3A78A 4J26A 4TV1B 5HCVA 4E2JA 5AZVA 5FQPA 2Q1HA 4OGHA 4RMEA 4ITEA 3VSOA 4K4JA 5DZ1A 3A2IA 4APUA 2POGA 4MGBB 5AAUA 4MG5A 2REWA 5DX3A 5JJMB 4DM8A 3DZUD 4OH6A 4ZN9A 1MV9A 2ZFXA 3KPZA 1QKNA 3ILZA 3CS8A 4TV1A 3VTBA 2QPYA 4ZNVA 1OSHA 3E00A 3DCUA 3WT5A 4ZNWA 2PJLA 3AURA 4ZI1A 5DXBB 3X1HA 5DRMA 3KDUA 4ZN7A 1FM9A 5DMFA 3H0AD 4UDDA 1KKQA 2NW4A 2GL8A 1XV9B 1XJ7A 1U3RA 4X1FA 3UU7B 4QM0A 3OAPA 3W0AA 3NSQA 1LV2A 1S9QA 4PPPA 1YA3A 5DRJA 4ZJRA 1T76A 3DZUA 5KCFA 3R8AA 5DXMA 4NQAB 4MG6A 4IU7A 5H1EA 2GPUA 5KR9A 3B3KA 1UPVA 2Q7LA 3ERDA 3HM1A 3B68A 3D57A 4G20A 3VHUA 1XV9A 3S9SA 1ILGA 4YNKA 4MDDA 2F4BA 3D6DA 4IV2A 3CS6A 5AWKA 4DORA 3VT6A 5DZ3A 2P1UA 5APHA 1BSXA 5AYGA 1YINA 5IZ0A 5L7HA 4CI4A 3MNPA 3OMPA 4A4WA 2ACLA 4OJBA 1PCGA 1T65A 3VRTA 5E19A 1U3QA 2Q5GA 3OMOA 1SJ0A 2ZXZA 3EYBA 3F5CA 4ONIA 2PIQA 1U3SA 3IMYA 4FNEA 3NSPA 4N8RA 2V0VA 3G8OA 2ZBSA 1Z5XE 4RZFA 3VN2A 3X36A 2HWRA 3ERTA 3TX7B 4JL4A 4ZNHA 3W5RA 4OKBA 3QT0A 2Q6SA 4MGBA 3GWXA 2YLYA 4IWFA 5DZ0A 3OS8C 2VV4A 3AN3A 3G0WA 3L03A 3GN8A 3P8XA 3WWRA 4G1ZA 1XIUA 3AN4A 1PK5A 4J5WC 4MGAA 3P0UA 4RFWA 3WTQA 3R29A 1Z5XU 4IW6A 1XNNA 2GPOA 1RK3A 2Q61A 3B65A 3KBAA 2AX7A 4R6SA 4RMCA 1QKUA 1G2NA 2H77A 3A40X 3B0TA 3KFCA 3VTDA 3HC5A 3R2AA 2HFPA 1FCXA 3UUAA 2PIPL 3VT5A 4DQMA 3ZR7A 2HB7A 4FGYA 4IA3A 3V3QA 3ZRAA 2PIOA 2PIUA 3OLSA 4LTWA 3ET2A 3OGTA 4OEDA 5FQRA 1UHLB 5DZHA 1RKGA 3OOFA 5ICKA 5L7GA 2ZL9A 5KRIA 3CS4A 3ET3A 1ZDUA 2QGWA 5DWIA 2ZLCA 3P89A 3Q95A 2QA8B 3UUDB 4FHHA 1SQNA 1T7RA 5DYBA 2QXSA 5K13A 5KCUA 4IA1A 4L98A 4DMAA 4OEYA 2FVJA 4G1YA 4NIEA 4PP5A 3V3EA 1ERRA 5GIEA 3VJSA 3ZQTA 4OZRE 1T63A 1XP1A 3B0RA 1VJBA 2B1ZA
chains in the Genus database with same CATH topology
3UUDA 2QA8A 5ETHA 4WPFA 2QE4A 4RAKA 3OS9A 3R5NA 3A2JA 1IE9A 1NQ0A 2Q6RA 1T7TA 1PDUA 1XDKA 3B1MA 5GIDA 1RJKA 2NV7A 4OZTE 4RZEA 1XNXA 4PLEA 1YUCA 5DWJA 4A4VA 3AZ1A 2B23A 3A2HA 3FEJA 3O1DA 2Q59A 4OZRU 5KCEA 3DT3A 3IXPD 3FC6B 2ZK0A 1L2IA 5G46A 3VRWA 3IPUA 1X78A 5DV8A 4MG9A 1YOKA 4P6WA 1FD0A 4MGDA 2AA6A 1NRLA 4JYIA 3B0WA 2Q6JA 3L3XA 5ACCA 5L11A 2IOGA 4OZTU 3TKCA 2O4RA 2HBHA 5DIEA 4POJA 2OUZA 3BQDA 3F7DA 4OJ9A 5DSHA 3DZYD 2XYJA 3VRUA 1GWXA 1ZGYA 5DIGA 2J7YA 2P7ZA 1P8DA 1ZDTA 1QKMA 4OIUA 5APJA 3LMPA 1ZAFA 4IA2A 4OJ4A 5G5WA 5KRCA 5IAWA 2G0GA 3VT4A 5GT4A 5HYKA 2Q5SA 1YMTA 3AZ2A 1IE8A 2W8YA 3FEIA 4OHAA 1NQ7A 2VV1A 4KZMA 4Q0AC 2LBDA 3B67A 1EXXA 4OFRA 4J5XC 3DZYA 2JJ3A 2BJ4B 1UOMA 2QZOA 5KRFA 4NUFA 1HG4A 2AXAA 3VJHA 1OVLB 2GTKA 5DUHA 5DVCA 3RLJA 1YYEA 5DXPA 2Q7KA 3VI8A 3A9EA 2NXXE 4IWCA 3WT7A 2J4AA 5DKBA 3GYTA 1Y0SA 2YJDA 4ZNSA 3U9QA 3HLVA 2BJ4A 2ZXMA 3GWSX 3OMQA 4LNXA 2AX6A 1TXIA 1NUOA 1OSVA 1XZXX 1R5KA 3CQVA 3H52A 3VJTA 3VRVA 3NOAA 3W0GA 3W5QA 5DWEA 4E4KA 5JJMA 2QW4A 4S0SA 2R40D 4ZNUA 1X7EA 3RLLA 3WFGA 5DY8A 4K6IA 3M7RA 2VSRA 5DXEA 5EHJA 5DXBA 4N1YA 5EJVA 5DKGA 1HJ1A 3OZJA 4OEAA 2QSEA 5G45A 1ZH7A 3GZ9A 3W0CA 3OMKA 2R6YA 4DM6A 5AZTA 4XUHA 4FHIA 1S9PA 1I7IA 3UU7A 3H0AA 1M7WA 1Y0XX 3CJWA 2P54A 1X7RA 2AB2A 2Q60A 5FQVA 5DZIA 2FAIA 1XVPB 2P4YA 4TUZB 1YIMA 2Q70A 3WFFA 2ZKCA 1RDTD 3AUQA 3VJIA 1P93A 4IVYA 2XHSA 3CDSA 3K22A 4NB6A 4OIVA 1NQ1A 2ZNQA 3ADWA 1T5ZA 1XVPA 4IW8A 4PP6A 4RWVA 5E1CA 1T7MA 2PINA 3MNEA 4KZJA 5EI1A 4IA7A 3LBDA 1G1UA 4HEEX 4PXMA 5DK9A 5EGVA 3L0JA 3OSIA 3OS8A 4UDBA 4MGCA 4QE6A 5DXRA 3OKHA 3D90A 5C4TA 2YLQA 1ZUCA 4J5WA 2AMAA 5AAVB 5GICA 3WGPA 1RDTA 1E3GA 3KWYA 3JZBA 2I4ZA 4PF3A 4S15A 1MVCA 3VT9A 2I0GA 4ZO1X 1NQ2A 3VT3A 1YP0A 2OZ7A 3R8DA 3K6PA 4PPSA 5G42A 4OARA 5DKEA 4G1DA 2PIXA 3CWDA 3TKMA 3O1EA 1KNUA 1YOWA 4PVUA 5LGAA 5KRHA 4OEZA 5AAVA 4WHFA 1PQCA 2ZK3A 4HLWA 3V49A 1XLSE 2HARA 2Q3YA 3VTCA 2B1VA 2Q8SA 3OKIA 3ADTA 3ADVA 2QTUA 3IPSA 2QNVA 3W5PA 1NYXA 3K23A 5C4OA 5DUEA 3OSWA 3KDTA 1T79A 4G21A 1I7GA 2ATHA 1UHLA 3V4AA 2G5OA 2QMVA 3HVLA 3PBAA 4LNWA 4XLDA 2P7GA 2JF9A 4IQRA 1PRGA 5DXQA 1M13A 4OH5A 2OVMA 2ZK1A 1XP9A 4XHDA 2ZNNA 5DI7A 5DVVA 3OLLA 5HJPB 5DMCA 4EMAA 1FBYA 1GS4A 2VV0A 2HAMA 3VHVA 1A52A 1N4HA 5DP0A 3OZ0A 4EM9A 3RUUA 2Q5PA 4OLMA 5DTVA 4OC7A 5E14A 4N5GA 2Q7JA 5HZCA 1R20D 5DU5A 3X1IA 2ZK6A 2BAWA 3SZ1A 2YLPA 5LWPA 3GBKA 4PP3A 3W0JA 5DL4A 4OKWA 4F9MA 2ZMJA 3AFRA 2POBA 1Y9RA 2J7XA 3TY0A 5DYDA 4DK7A 4MG7B 3HZFA 2YLOA 2P7AA 3E7CA 3L1BA 4QK4A 5APKA 2ZMIA 1T74A 3ADSA 3CLDA 3P88A 1XAPA 2VV2A 2YJAB 3FC6A 3UVVB 2OM9A 3V9TA 3G8IA 3PCUA 3PO9A 3KMZA 4ZOMA 3WT6A 1R6GA 5KYAA 3IXPA 3JZCA 2GP7A 1EXAA 4MG7A 3DY6A 5DKSA 1K7LA 1GWQA 5IXKA 4WVDA 5AVIA 4ZJWA 4OKXA 2I4PA 5DLRA 3WMHA 1MZNA 2PRGA 1T73A 4OFUA 1KV6A 4J5XA 4X1GA 4MG8B 2XYWA 5DXKA 2JFAB 3K8SA 1X7BA 1TFCA 2ZK4A 5F9BA 4RMDA 1S19A 2ZXNA 2AA2A 2OVHA 1I38A 1K4WA 2H79A 1PQ6A 5HJSA 5JY3A 2GWXA 1XQ3A 1QKTA 4ITFA 4R2UA 4WHGA 5KRJA 2I0JA 3AZ3A 4OK1A 2AYRA 3WJ4A 4MG8A 1Z95A 3HODA 3B5RA 1SKXA 1XOWA 5DX3B 3FALB 2ZNPA 1OVLA 2AWHA 3E00D 2Z4BA 3FS1A 2P1TA 4XUMA 2ABIA 4M8EA 2ZMHA 4IVWA 1FM9D 2G0HA 3HO0A 4XTAA 5DIDA 5EC9A 1I37A 2ZASA 3UP3A 1NDEA 2VV3A 3IPQA 2GPPA 3GD2A 2NXXA 4QL8A 1LBDA 3V9VA 2AX8A 2PIVA 3FALA 3FLIA 5I4VA 1SR7A 5KRAA 3RUTA 4ZO1B 1M2ZA 4JYHA 3PRGA 1A28A 4LSJA 1NHZA 3ET1A 3HQ5A 2AA7A 3L3ZA 5KCTA 5KCWA 4UDAA 4REEA 2R40A 3KMRA 1T7FA 4N73A 4FN9A 3E94A 4Y29A 4P6XA 3T03A 3FUGA 5KYJA 3SP9A 4E4QA 5KRLA 4BCRA 5AK2A 1X76A 4JAZA 2ZK2A 4QE8A 1UPWA 4L96A 2ACLB 4RE8A 5DUGA 3OLFA 4OILA 2AAXA 1NAXA 4TUZA 2EWPA 4DOSA 2Q7IA 3SP6A 1G50A 3F5CB 2YATA 2AM9A 2B50A 1DKFB 4B7WA 5KCDA 1K74D 1X7JA 3OSAA 2PNUA 3VT7A 4DK8A 2QABA 5KRKA 3RVFA 4LBDA 4OKTA 5CJ6A 4M8HA 5EITA 4CSJA 3FXVA 1ZEOA 4R06A 5DWLA 2ZK5A 3BC5A 1Q4XA 3D24A 2VV4B 3WJ5A 2ZY0A 1DKFA 2HASA 3PEQA 1OT7A 3X31A 2V7CA 4MGAB 3IA6A 5E0XA 2QR9A 2G44A 5KROA 2J14A 2YFEA 3ZRBA 1K74A 4PWLA 4UDCA 3UUAB 5L7EA 4G2HA 3ADUA 4YPQA 2P1VA 4S0TA 3W5TA 2PIRA 4S14A 5JI0D 1ILHA 2AMBA 3L0LA 3AX8A 5DV6A 4O8FA 2O4JA 1E3KA 3A3ZX 2HWQA 4KZIA 3Q95B 1YY4A 1XLSA 5DVSA 5E15A 3W0YA 1N46A 2IOKA 2OCFA 3VT8A 2ZNOA 2QGTA 1FCYA 4YT1A 4POHA 4Q50A 3W0HA 5G43A 4WLBA 3KYTA 2FSZA 5B41A 3N00A 4XAOA 4JGVA 3ADXA 4A2JA 3BEJA 3CTBA 5B5BA 5DWGA 1PQ9A 2PITA 2HCDA 3VHWA 2AX9A 4REFA 5KCCA 1XDKB 3ET0A 5A86A 3R8IA 4PLDA 4G2IA 5HJPA 5G3JA 4XT9A 5AVLA 5E7VA 1S0XA 1EREA 1GWRA 1XPCA 1G5YA 1R1KD 2XKWA 3UUCA 1H9UA 1WM0X 2HVCA 2Q59B 5FQTA 3FURA 2OAXA 1N83A 3OOKA 3R5MA 4K7AA 4XI3A 1ZKYA 4WQPA 3L0EA 2QXMA 2ZLAA 4MG9B 5KD9A 3V9YA 4JYGA 2PIWA 1R20A 1S0ZA 2P15A 4MGDB 5KRMA 4IS8A 1DB1A 4QJRA 3GYUA 3MNOA 4RUJA 1XB7A 2A3IA 5HYRA 2AO6A 2E2RA 5AWJA 1R1KA 2ZVTA 3UVVA 2Z4JA 2IHQA 1RKHA 3HC6A 3W0IA 4RUOX 2VSTA 4YMQA 1YJEA 1NAVA 3OMMA 2QH6A 2AA5A 3PLZA 5G44A 1FCZA 2PKLA 1FM6D 3D5FA 4IV4A 1PZLA 4PRGA 3B66A 4RZGA 4CI5A 3AUNA 5M96A 3UP0A 1XQCA 4J24A 2I4JA 5E0WA 3KMGA 4RUPA 3VSPA 2VV1B 3DCTA 1U9EA 1L2JA 3DR1A 3B0QA 3CDPA 4IUIA 4NY9A 5C4SA 2XYXA 2QA6A 5FQSA 2YHDA 2QZOB 2HB8A 2JFAA 4Q13A 5DXGA 5SYZA 4ZNTA 2GIUA 2NPAA 3G9EA 3RY9A 5DV3A 1XP6A 5C4UA 1FM6A 2Q1VA 3A9EB 2GPVA 2O9IA 2HC4A 2R6WA 3A78A 4J26A 4TV1B 5HCVA 4E2JA 5AZVA 5FQPA 2Q1HA 4OGHA 4RMEA 4ITEA 3VSOA 4K4JA 5DZ1A 3A2IA 4APUA 2POGA 4MGBB 5AAUA 4MG5A 2REWA 5DX3A 5JJMB 4DM8A 3DZUD 4OH6A 4ZN9A 1MV9A 2ZFXA 3KPZA 1QKNA 3ILZA 3CS8A 4TV1A 3VTBA 2QPYA 4ZNVA 1OSHA 3E00A 3DCUA 3WT5A 4ZNWA 2PJLA 3AURA 4ZI1A 5DXBB 3X1HA 5DRMA 3KDUA 4ZN7A 1FM9A 5DMFA 3H0AD 4UDDA 1KKQA 2NW4A 2GL8A 1XV9B 1XJ7A 1U3RA 4X1FA 3UU7B 4QM0A 3OAPA 3W0AA 3NSQA 1LV2A 1S9QA 4PPPA 1YA3A 5DRJA 4ZJRA 1T76A 3DZUA 5KCFA 3R8AA 5DXMA 4NQAB 4MG6A 4IU7A 5H1EA 2GPUA 5KR9A 3B3KA 1UPVA 2Q7LA 3ERDA 3HM1A 3B68A 3D57A 4G20A 3VHUA 1XV9A 3S9SA 1ILGA 4YNKA 4MDDA 2F4BA 3D6DA 4IV2A 3CS6A 5AWKA 4DORA 3VT6A 5DZ3A 2P1UA 5APHA 1BSXA 5AYGA 1YINA 5IZ0A 5L7HA 4CI4A 3MNPA 3OMPA 4A4WA 2ACLA 4OJBA 1PCGA 1T65A 3VRTA 5E19A 1U3QA 2Q5GA 3OMOA 1SJ0A 2ZXZA 3EYBA 3F5CA 4ONIA 2PIQA 1U3SA 3IMYA 4FNEA 3NSPA 4N8RA 2V0VA 3G8OA 2ZBSA 1Z5XE 4RZFA 3VN2A 3X36A 2HWRA 3ERTA 3TX7B 4JL4A 4ZNHA 3W5RA 4OKBA 3QT0A 2Q6SA 4MGBA 3GWXA 2YLYA 4IWFA 5DZ0A 3OS8C 2VV4A 3AN3A 3G0WA 3L03A 3GN8A 3P8XA 3WWRA 4G1ZA 1XIUA 3AN4A 1PK5A 4J5WC 4MGAA 3P0UA 4RFWA 3WTQA 3R29A 1Z5XU 4IW6A 1XNNA 2GPOA 1RK3A 2Q61A 3B65A 3KBAA 2AX7A 4R6SA 4RMCA 1QKUA 1G2NA 2H77A 3A40X 3B0TA 3KFCA 3VTDA 3HC5A 3R2AA 2HFPA 1FCXA 3UUAA 2PIPL 3VT5A 4DQMA 3ZR7A 2HB7A 4FGYA 4IA3A 3V3QA 3ZRAA 2PIOA 2PIUA 3OLSA 4LTWA 3ET2A 3OGTA 4OEDA 5FQRA 1UHLB 5DZHA 1RKGA 3OOFA 5ICKA 5L7GA 2ZL9A 5KRIA 3CS4A 3ET3A 1ZDUA 2QGWA 5DWIA 2ZLCA 3P89A 3Q95A 2QA8B 3UUDB 4FHHA 1SQNA 1T7RA 5DYBA 2QXSA 5K13A 5KCUA 4IA1A 4L98A 4DMAA 4OEYA 2FVJA 4G1YA 4NIEA 4PP5A 3V3EA 1ERRA 5GIEA 3VJSA 3ZQTA 4OZRE 1T63A 1XP1A 3B0RA 1VJBA 2B1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UUD A;  2QA8 A;  5ETH A;  4WPF A;  2QE4 A;  4RAK A;  3OS9 A;  3R5N A;  3A2J A;  1IE9 A;  1NQ0 A;  2Q6R A;  1T7T A;  1PDU A;  1XDK A;  3B1M A;  5GID A;  1RJK A;  2NV7 A;  4OZT E;  4RZE A;  1XNX A;  4PLE A;  1YUC A;  5DWJ A;  4A4V A;  3AZ1 A;  2B23 A;  3A2H A;  3FEJ A;  3O1D A;  2Q59 A;  4OZR U;  5KCE A;  3DT3 A;  3IXP D;  3FC6 B;  2ZK0 A;  1L2I A;  5G46 A;  3VRW A;  3IPU A;  1X78 A;  5DV8 A;  4MG9 A;  1YOK A;  4P6W A;  1FD0 A;  4MGD A;  2AA6 A;  1NRL A;  4JYI A;  3B0W A;  2Q6J A;  3L3X A;  5ACC A;  5L11 A;  2IOG A;  4OZT U;  3TKC A;  2O4R A;  2HBH A;  5DIE A;  4POJ A;  2OUZ A;  3BQD A;  3F7D A;  4OJ9 A;  5DSH A;  3DZY D;  2XYJ A;  3VRU A;  1GWX A;  1ZGY A;  5DIG A;  2J7Y A;  2P7Z A;  1P8D A;  1ZDT A;  1QKM A;  4OIU A;  5APJ A;  3LMP A;  1ZAF A;  4IA2 A;  4OJ4 A;  5G5W A;  5KRC A;  5IAW A;  2G0G A;  3VT4 A;  5GT4 A;  5HYK A;  2Q5S A;  1YMT A;  3AZ2 A;  1IE8 A;  2W8Y A;  3FEI A;  4OHA A;  1NQ7 A;  2VV1 A;  4KZM A;  4Q0A C;  2LBD A;  3B67 A;  1EXX A;  4OFR A;  4J5X C;  3DZY A;  2JJ3 A;  2BJ4 B;  1UOM A;  2QZO A;  5KRF A;  4NUF A;  1HG4 A;  2AXA A;  3VJH A;  1OVL B;  2GTK A;  5DUH A;  5DVC A;  3RLJ A;  1YYE A;  5DXP A;  2Q7K A;  3VI8 A;  3A9E A;  2NXX E;  4IWC A;  3WT7 A;  2J4A A;  5DKB A;  3GYT A;  1Y0S A;  2YJD A;  4ZNS A;  3U9Q A;  3HLV A;  2BJ4 A;  2ZXM A;  3GWS X;  3OMQ A;  4LNX A;  2AX6 A;  1TXI A;  1NUO A;  1OSV A;  1XZX X;  1R5K A;  3CQV A;  3H52 A;  3VJT A;  3VRV A;  3NOA A;  3W0G A;  3W5Q A;  5DWE A;  4E4K A;  5JJM A;  2QW4 A;  4S0S A;  2R40 D;  4ZNU A;  1X7E A;  3RLL A;  3WFG A;  5DY8 A;  4K6I A;  3M7R A;  2VSR A;  5DXE A;  5EHJ A;  5DXB A;  4N1Y A;  5EJV A;  5DKG A;  1HJ1 A;  3OZJ A;  4OEA A;  2QSE A;  5G45 A;  1ZH7 A;  3GZ9 A;  3W0C A;  3OMK A;  2R6Y A;  4DM6 A;  5AZT A;  4XUH A;  4FHI A;  1S9P A;  1I7I A;  3UU7 A;  3H0A A;  1M7W A;  1Y0X X;  3CJW A;  2P54 A;  1X7R A;  2AB2 A;  2Q60 A;  5FQV A;  5DZI A;  2FAI A;  1XVP B;  2P4Y A;  4TUZ B;  1YIM A;  2Q70 A;  3WFF A;  2ZKC A;  1RDT D;  3AUQ A;  3VJI A;  1P93 A;  4IVY A;  2XHS A;  3CDS A;  3K22 A;  4NB6 A;  4OIV A;  1NQ1 A;  2ZNQ A;  3ADW A;  1T5Z A;  1XVP A;  4IW8 A;  4PP6 A;  4RWV A;  5E1C A;  1T7M A;  2PIN A;  3MNE A;  4KZJ A;  5EI1 A;  4IA7 A;  3LBD A;  1G1U A;  4HEE X;  4PXM A;  5DK9 A;  5EGV A;  3L0J A;  3OSI A;  3OS8 A;  4UDB A;  4MGC A;  4QE6 A;  5DXR A;  3OKH A;  3D90 A;  5C4T A;  2YLQ A;  1ZUC A;  4J5W A;  2AMA A;  5AAV B;  5GIC A;  3WGP A;  1RDT A;  1E3G A;  3KWY A;  3JZB A;  2I4Z A;  4PF3 A;  4S15 A;  1MVC A;  3VT9 A;  2I0G A;  4ZO1 X;  1NQ2 A;  3VT3 A;  1YP0 A;  2OZ7 A;  3R8D A;  3K6P A;  4PPS A;  5G42 A;  4OAR A;  5DKE A;  4G1D A;  2PIX A;  3CWD A;  3TKM A;  3O1E A;  1KNU A;  1YOW A;  4PVU A;  5LGA A;  5KRH A;  4OEZ A;  5AAV A;  4WHF A;  1PQC A;  2ZK3 A;  4HLW A;  3V49 A;  1XLS E;  2HAR A;  2Q3Y A;  3VTC A;  2B1V A;  2Q8S A;  3OKI A;  3ADT A;  3ADV A;  2QTU A;  3IPS A;  2QNV A;  3W5P A;  1NYX A;  3K23 A;  5C4O A;  5DUE A;  3OSW A;  3KDT A;  1T79 A;  4G21 A;  1I7G A;  2ATH A;  1UHL A;  3V4A A;  2G5O A;  2QMV A;  3HVL A;  3PBA A;  4LNW A;  4XLD A;  2P7G A;  2JF9 A;  4IQR A;  1PRG A;  5DXQ A;  1M13 A;  4OH5 A;  2OVM A;  2ZK1 A;  1XP9 A;  4XHD A;  2ZNN A;  5DI7 A;  5DVV A;  3OLL A;  5HJP B;  5DMC A;  4EMA A;  1FBY A;  1GS4 A;  2VV0 A;  2HAM A;  3VHV A;  1A52 A;  1N4H A;  5DP0 A;  3OZ0 A;  4EM9 A;  3RUU A;  2Q5P A;  4OLM A;  5DTV A;  4OC7 A;  5E14 A;  4N5G A;  2Q7J A;  5HZC A;  1R20 D;  5DU5 A;  3X1I A;  2ZK6 A;  2BAW A;  3SZ1 A;  2YLP A;  5LWP A;  3GBK A;  4PP3 A;  3W0J A;  5DL4 A;  4OKW A;  4F9M A;  2ZMJ A;  3AFR A;  2POB A;  1Y9R A;  2J7X A;  3TY0 A;  5DYD A;  4DK7 A;  4MG7 B;  3HZF A;  2YLO A;  2P7A A;  3E7C A;  3L1B A;  4QK4 A;  5APK A;  2ZMI A;  1T74 A;  3ADS A;  3CLD A;  3P88 A;  1XAP A;  2VV2 A;  2YJA B;  3FC6 A;  3UVV B;  2OM9 A;  3V9T A;  3G8I A;  3PCU A;  3PO9 A;  3KMZ A;  4ZOM A;  3WT6 A;  1R6G A;  5KYA A;  3IXP A;  3JZC A;  2GP7 A;  1EXA A;  4MG7 A;  3DY6 A;  5DKS A;  1K7L A;  1GWQ A;  5IXK A;  4WVD A;  5AVI A;  4ZJW A;  4OKX A;  2I4P A;  5DLR A;  3WMH A;  1MZN A;  2PRG A;  1T73 A;  4OFU A;  1KV6 A;  4J5X A;  4X1G A;  4MG8 B;  2XYW A;  5DXK A;  2JFA B;  3K8S A;  1X7B A;  1TFC A;  2ZK4 A;  5F9B A;  4RMD A;  1S19 A;  2ZXN A;  2AA2 A;  2OVH A;  1I38 A;  1K4W A;  2H79 A;  1PQ6 A;  5HJS A;  5JY3 A;  2GWX A;  1XQ3 A;  1QKT A;  4ITF A;  4R2U A;  4WHG A;  5KRJ A;  2I0J A;  3AZ3 A;  4OK1 A;  2AYR A;  3WJ4 A;  4MG8 A;  1Z95 A;  3HOD A;  3B5R A;  1SKX A;  1XOW A;  5DX3 B;  3FAL B;  2ZNP A;  1OVL A;  2AWH A;  3E00 D;  2Z4B A;  3FS1 A;  2P1T A;  4XUM A;  2ABI A;  4M8E A;  2ZMH A;  4IVW A;  1FM9 D;  2G0H A;  3HO0 A;  4XTA A;  5DID A;  5EC9 A;  1I37 A;  2ZAS A;  3UP3 A;  1NDE A;  2VV3 A;  3IPQ A;  2GPP A;  3GD2 A;  2NXX A;  4QL8 A;  1LBD A;  3V9V A;  2AX8 A;  2PIV A;  3FAL A;  3FLI A;  5I4V A;  1SR7 A;  5KRA A;  3RUT A;  4ZO1 B;  1M2Z A;  4JYH A;  3PRG A;  1A28 A;  4LSJ A;  1NHZ A;  3ET1 A;  3HQ5 A;  2AA7 A;  3L3Z A;  5KCT A;  5KCW A;  4UDA A;  4REE A;  2R40 A;  3KMR A;  1T7F A;  4N73 A;  4FN9 A;  3E94 A;  4Y29 A;  4P6X A;  3T03 A;  3FUG A;  5KYJ A;  3SP9 A;  4E4Q A;  5KRL A;  4BCR A;  5AK2 A;  1X76 A;  4JAZ A;  2ZK2 A;  4QE8 A;  1UPW A;  4L96 A;  2ACL B;  4RE8 A;  5DUG A;  3OLF A;  4OIL A;  2AAX A;  1NAX A;  4TUZ A;  2EWP A;  4DOS A;  2Q7I A;  3SP6 A;  1G50 A;  3F5C B;  2YAT A;  2AM9 A;  2B50 A;  1DKF B;  4B7W A;  5KCD A;  1K74 D;  1X7J A;  3OSA A;  2PNU A;  3VT7 A;  4DK8 A;  2QAB A;  5KRK A;  3RVF A;  4LBD A;  4OKT A;  5CJ6 A;  4M8H A;  5EIT A;  4CSJ A;  3FXV A;  1ZEO A;  4R06 A;  5DWL A;  2ZK5 A;  3BC5 A;  1Q4X A;  3D24 A;  2VV4 B;  3WJ5 A;  2ZY0 A;  1DKF A;  2HAS A;  3PEQ A;  1OT7 A;  3X31 A;  2V7C A;  4MGA B;  3IA6 A;  5E0X A;  2QR9 A;  2G44 A;  5KRO A;  2J14 A;  2YFE A;  3ZRB A;  1K74 A;  4PWL A;  4UDC A;  3UUA B;  5L7E A;  4G2H A;  3ADU A;  4YPQ A;  2P1V A;  4S0T A;  3W5T A;  2PIR A;  4S14 A;  5JI0 D;  1ILH A;  2AMB A;  3L0L A;  3AX8 A;  5DV6 A;  4O8F A;  2O4J A;  1E3K A;  3A3Z X;  2HWQ A;  4KZI A;  3Q95 B;  1YY4 A;  1XLS A;  5DVS A;  5E15 A;  3W0Y A;  1N46 A;  2IOK A;  2OCF A;  3VT8 A;  2ZNO A;  2QGT A;  1FCY A;  4YT1 A;  4POH A;  4Q50 A;  3W0H A;  5G43 A;  4WLB A;  3KYT A;  2FSZ A;  5B41 A;  3N00 A;  4XAO A;  4JGV A;  3ADX A;  4A2J A;  3BEJ A;  3CTB A;  5B5B A;  5DWG A;  1PQ9 A;  2PIT A;  2HCD A;  3VHW A;  2AX9 A;  4REF A;  5KCC A;  1XDK B;  3ET0 A;  5A86 A;  3R8I A;  4PLD A;  4G2I A;  5HJP A;  5G3J A;  4XT9 A;  5AVL A;  5E7V A;  1S0X A;  1ERE A;  1GWR A;  1XPC A;  1G5Y A;  1R1K D;  2XKW A;  3UUC A;  1H9U A;  1WM0 X;  2HVC A;  2Q59 B;  5FQT A;  3FUR A;  2OAX A;  1N83 A;  3OOK A;  3R5M A;  4K7A A;  4XI3 A;  1ZKY A;  4WQP A;  3L0E A;  2QXM A;  2ZLA A;  4MG9 B;  5KD9 A;  3V9Y A;  4JYG A;  2PIW A;  1R20 A;  1S0Z A;  2P15 A;  4MGD B;  5KRM A;  4IS8 A;  1DB1 A;  4QJR A;  3GYU A;  3MNO A;  4RUJ A;  1XB7 A;  2A3I A;  5HYR A;  2AO6 A;  2E2R A;  5AWJ A;  1R1K A;  2ZVT A;  3UVV A;  2Z4J A;  2IHQ A;  1RKH A;  3HC6 A;  3W0I A;  4RUO X;  2VST A;  4YMQ A;  1YJE A;  1NAV A;  3OMM A;  2QH6 A;  2AA5 A;  3PLZ A;  5G44 A;  1FCZ A;  2PKL A;  1FM6 D;  3D5F A;  4IV4 A;  1PZL A;  4PRG A;  3B66 A;  4RZG A;  4CI5 A;  3AUN A;  5M96 A;  3UP0 A;  1XQC A;  4J24 A;  2I4J A;  5E0W A;  3KMG A;  4RUP A;  3VSP A;  2VV1 B;  3DCT A;  1U9E A;  1L2J A;  3DR1 A;  3B0Q A;  3CDP A;  4IUI A;  4NY9 A;  5C4S A;  2XYX A;  2QA6 A;  5FQS A;  2YHD A;  2QZO B;  2HB8 A;  2JFA A;  4Q13 A;  5DXG A;  5SYZ A;  4ZNT A;  2GIU A;  2NPA A;  3G9E A;  3RY9 A;  5DV3 A;  1XP6 A;  5C4U A;  1FM6 A;  2Q1V A;  3A9E B;  2GPV A;  2O9I A;  2HC4 A;  2R6W A;  3A78 A;  4J26 A;  4TV1 B;  5HCV A;  4E2J A;  5AZV A;  5FQP A;  2Q1H A;  4OGH A;  4RME A;  4ITE A;  3VSO A;  4K4J A;  5DZ1 A;  3A2I A;  4APU A;  2POG A;  4MGB B;  5AAU A;  4MG5 A;  2REW A;  5DX3 A;  5JJM B;  4DM8 A;  3DZU D;  4OH6 A;  4ZN9 A;  1MV9 A;  2ZFX A;  3KPZ A;  1QKN A;  3ILZ A;  3CS8 A;  4TV1 A;  3VTB A;  2QPY A;  4ZNV A;  1OSH A;  3E00 A;  3DCU A;  3WT5 A;  4ZNW A;  2PJL A;  3AUR A;  4ZI1 A;  5DXB B;  3X1H A;  5DRM A;  3KDU A;  4ZN7 A;  1FM9 A;  5DMF A;  3H0A D;  4UDD A;  1KKQ A;  2NW4 A;  2GL8 A;  1XV9 B;  1XJ7 A;  1U3R A;  4X1F A;  3UU7 B;  4QM0 A;  3OAP A;  3W0A A;  3NSQ A;  1LV2 A;  1S9Q A;  4PPP A;  1YA3 A;  5DRJ A;  4ZJR A;  1T76 A;  3DZU A;  5KCF A;  3R8A A;  5DXM A;  4NQA B;  4MG6 A;  4IU7 A;  5H1E A;  2GPU A;  5KR9 A;  3B3K A;  1UPV A;  2Q7L A;  3ERD A;  3HM1 A;  3B68 A;  3D57 A;  4G20 A;  3VHU A;  1XV9 A;  3S9S A;  1ILG A;  4YNK A;  4MDD A;  2F4B A;  3D6D A;  4IV2 A;  3CS6 A;  5AWK A;  4DOR A;  3VT6 A;  5DZ3 A;  2P1U A;  5APH A;  1BSX A;  5AYG A;  1YIN A;  5IZ0 A;  5L7H A;  4CI4 A;  3MNP A;  3OMP A;  4A4W A;  2ACL A;  4OJB A;  1PCG A;  1T65 A;  3VRT A;  5E19 A;  1U3Q A;  2Q5G A;  3OMO A;  1SJ0 A;  2ZXZ A;  3EYB A;  3F5C A;  4ONI A;  2PIQ A;  1U3S A;  3IMY A;  4FNE A;  3NSP A;  4N8R A;  2V0V A;  3G8O A;  2ZBS A;  1Z5X E;  4RZF A;  3VN2 A;  3X36 A;  2HWR A;  3ERT A;  3TX7 B;  4JL4 A;  4ZNH A;  3W5R A;  4OKB A;  3QT0 A;  2Q6S A;  4MGB A;  3GWX A;  2YLY A;  4IWF A;  5DZ0 A;  3OS8 C;  2VV4 A;  3AN3 A;  3G0W A;  3L03 A;  3GN8 A;  3P8X A;  3WWR A;  4G1Z A;  1XIU A;  3AN4 A;  1PK5 A;  4J5W C;  4MGA A;  3P0U A;  4RFW A;  3WTQ A;  3R29 A;  1Z5X U;  4IW6 A;  1XNN A;  2GPO A;  1RK3 A;  2Q61 A;  3B65 A;  3KBA A;  2AX7 A;  4R6S A;  4RMC A;  1QKU A;  1G2N A;  2H77 A;  3A40 X;  3B0T A;  3KFC A;  3VTD A;  3HC5 A;  3R2A A;  2HFP A;  1FCX A;  3UUA A;  2PIP L;  3VT5 A;  4DQM A;  3ZR7 A;  2HB7 A;  4FGY A;  4IA3 A;  3V3Q A;  3ZRA A;  2PIO A;  2PIU A;  3OLS A;  4LTW A;  3ET2 A;  3OGT A;  4OED A;  5FQR A;  1UHL B;  5DZH A;  1RKG A;  3OOF A;  5ICK A;  5L7G A;  2ZL9 A;  5KRI A;  3CS4 A;  3ET3 A;  1ZDU A;  2QGW A;  5DWI A;  2ZLC A;  3P89 A;  3Q95 A;  2QA8 B;  3UUD B;  4FHH A;  1SQN A;  1T7R A;  5DYB A;  2QXS A;  5K13 A;  5KCU A;  4IA1 A;  4L98 A;  4DMA A;  4OEY A;  2FVJ A;  4G1Y A;  4NIE A;  4PP5 A;  3V3E A;  1ERR A;  5GIE A;  3VJS A;  3ZQT A;  4OZR E;  1T63 A;  1XP1 A;  3B0R A;  1VJB A;  2B1Z A; 
#chains in the Genus database with same CATH topology
 3UUD A;  2QA8 A;  5ETH A;  4WPF A;  2QE4 A;  4RAK A;  3OS9 A;  3R5N A;  3A2J A;  1IE9 A;  1NQ0 A;  2Q6R A;  1T7T A;  1PDU A;  1XDK A;  3B1M A;  5GID A;  1RJK A;  2NV7 A;  4OZT E;  4RZE A;  1XNX A;  4PLE A;  1YUC A;  5DWJ A;  4A4V A;  3AZ1 A;  2B23 A;  3A2H A;  3FEJ A;  3O1D A;  2Q59 A;  4OZR U;  5KCE A;  3DT3 A;  3IXP D;  3FC6 B;  2ZK0 A;  1L2I A;  5G46 A;  3VRW A;  3IPU A;  1X78 A;  5DV8 A;  4MG9 A;  1YOK A;  4P6W A;  1FD0 A;  4MGD A;  2AA6 A;  1NRL A;  4JYI A;  3B0W A;  2Q6J A;  3L3X A;  5ACC A;  5L11 A;  2IOG A;  4OZT U;  3TKC A;  2O4R A;  2HBH A;  5DIE A;  4POJ A;  2OUZ A;  3BQD A;  3F7D A;  4OJ9 A;  5DSH A;  3DZY D;  2XYJ A;  3VRU A;  1GWX A;  1ZGY A;  5DIG A;  2J7Y A;  2P7Z A;  1P8D A;  1ZDT A;  1QKM A;  4OIU A;  5APJ A;  3LMP A;  1ZAF A;  4IA2 A;  4OJ4 A;  5G5W A;  5KRC A;  5IAW A;  2G0G A;  3VT4 A;  5GT4 A;  5HYK A;  2Q5S A;  1YMT A;  3AZ2 A;  1IE8 A;  2W8Y A;  3FEI A;  4OHA A;  1NQ7 A;  2VV1 A;  4KZM A;  4Q0A C;  2LBD A;  3B67 A;  1EXX A;  4OFR A;  4J5X C;  3DZY A;  2JJ3 A;  2BJ4 B;  1UOM A;  2QZO A;  5KRF A;  4NUF A;  1HG4 A;  2AXA A;  3VJH A;  1OVL B;  2GTK A;  5DUH A;  5DVC A;  3RLJ A;  1YYE A;  5DXP A;  2Q7K A;  3VI8 A;  3A9E A;  2NXX E;  4IWC A;  3WT7 A;  2J4A A;  5DKB A;  3GYT A;  1Y0S A;  2YJD A;  4ZNS A;  3U9Q A;  3HLV A;  2BJ4 A;  2ZXM A;  3GWS X;  3OMQ A;  4LNX A;  2AX6 A;  1TXI A;  1NUO A;  1OSV A;  1XZX X;  1R5K A;  3CQV A;  3H52 A;  3VJT A;  3VRV A;  3NOA A;  3W0G A;  3W5Q A;  5DWE A;  4E4K A;  5JJM A;  2QW4 A;  4S0S A;  2R40 D;  4ZNU A;  1X7E A;  3RLL A;  3WFG A;  5DY8 A;  4K6I A;  3M7R A;  2VSR A;  5DXE A;  5EHJ A;  5DXB A;  4N1Y A;  5EJV A;  5DKG A;  1HJ1 A;  3OZJ A;  4OEA A;  2QSE A;  5G45 A;  1ZH7 A;  3GZ9 A;  3W0C A;  3OMK A;  2R6Y A;  4DM6 A;  5AZT A;  4XUH A;  4FHI A;  1S9P A;  1I7I A;  3UU7 A;  3H0A A;  1M7W A;  1Y0X X;  3CJW A;  2P54 A;  1X7R A;  2AB2 A;  2Q60 A;  5FQV A;  5DZI A;  2FAI A;  1XVP B;  2P4Y A;  4TUZ B;  1YIM A;  2Q70 A;  3WFF A;  2ZKC A;  1RDT D;  3AUQ A;  3VJI A;  1P93 A;  4IVY A;  2XHS A;  3CDS A;  3K22 A;  4NB6 A;  4OIV A;  1NQ1 A;  2ZNQ A;  3ADW A;  1T5Z A;  1XVP A;  4IW8 A;  4PP6 A;  4RWV A;  5E1C A;  1T7M A;  2PIN A;  3MNE A;  4KZJ A;  5EI1 A;  4IA7 A;  3LBD A;  1G1U A;  4HEE X;  4PXM A;  5DK9 A;  5EGV A;  3L0J A;  3OSI A;  3OS8 A;  4UDB A;  4MGC A;  4QE6 A;  5DXR A;  3OKH A;  3D90 A;  5C4T A;  2YLQ A;  1ZUC A;  4J5W A;  2AMA A;  5AAV B;  5GIC A;  3WGP A;  1RDT A;  1E3G A;  3KWY A;  3JZB A;  2I4Z A;  4PF3 A;  4S15 A;  1MVC A;  3VT9 A;  2I0G A;  4ZO1 X;  1NQ2 A;  3VT3 A;  1YP0 A;  2OZ7 A;  3R8D A;  3K6P A;  4PPS A;  5G42 A;  4OAR A;  5DKE A;  4G1D A;  2PIX A;  3CWD A;  3TKM A;  3O1E A;  1KNU A;  1YOW A;  4PVU A;  5LGA A;  5KRH A;  4OEZ A;  5AAV A;  4WHF A;  1PQC A;  2ZK3 A;  4HLW A;  3V49 A;  1XLS E;  2HAR A;  2Q3Y A;  3VTC A;  2B1V A;  2Q8S A;  3OKI A;  3ADT A;  3ADV A;  2QTU A;  3IPS A;  2QNV A;  3W5P A;  1NYX A;  3K23 A;  5C4O A;  5DUE A;  3OSW A;  3KDT A;  1T79 A;  4G21 A;  1I7G A;  2ATH A;  1UHL A;  3V4A A;  2G5O A;  2QMV A;  3HVL A;  3PBA A;  4LNW A;  4XLD A;  2P7G A;  2JF9 A;  4IQR A;  1PRG A;  5DXQ A;  1M13 A;  4OH5 A;  2OVM A;  2ZK1 A;  1XP9 A;  4XHD A;  2ZNN A;  5DI7 A;  5DVV A;  3OLL A;  5HJP B;  5DMC A;  4EMA A;  1FBY A;  1GS4 A;  2VV0 A;  2HAM A;  3VHV A;  1A52 A;  1N4H A;  5DP0 A;  3OZ0 A;  4EM9 A;  3RUU A;  2Q5P A;  4OLM A;  5DTV A;  4OC7 A;  5E14 A;  4N5G A;  2Q7J A;  5HZC A;  1R20 D;  5DU5 A;  3X1I A;  2ZK6 A;  2BAW A;  3SZ1 A;  2YLP A;  5LWP A;  3GBK A;  4PP3 A;  3W0J A;  5DL4 A;  4OKW A;  4F9M A;  2ZMJ A;  3AFR A;  2POB A;  1Y9R A;  2J7X A;  3TY0 A;  5DYD A;  4DK7 A;  4MG7 B;  3HZF A;  2YLO A;  2P7A A;  3E7C A;  3L1B A;  4QK4 A;  5APK A;  2ZMI A;  1T74 A;  3ADS A;  3CLD A;  3P88 A;  1XAP A;  2VV2 A;  2YJA B;  3FC6 A;  3UVV B;  2OM9 A;  3V9T A;  3G8I A;  3PCU A;  3PO9 A;  3KMZ A;  4ZOM A;  3WT6 A;  1R6G A;  5KYA A;  3IXP A;  3JZC A;  2GP7 A;  1EXA A;  4MG7 A;  3DY6 A;  5DKS A;  1K7L A;  1GWQ A;  5IXK A;  4WVD A;  5AVI A;  4ZJW A;  4OKX A;  2I4P A;  5DLR A;  3WMH A;  1MZN A;  2PRG A;  1T73 A;  4OFU A;  1KV6 A;  4J5X A;  4X1G A;  4MG8 B;  2XYW A;  5DXK A;  2JFA B;  3K8S A;  1X7B A;  1TFC A;  2ZK4 A;  5F9B A;  4RMD A;  1S19 A;  2ZXN A;  2AA2 A;  2OVH A;  1I38 A;  1K4W A;  2H79 A;  1PQ6 A;  5HJS A;  5JY3 A;  2GWX A;  1XQ3 A;  1QKT A;  4ITF A;  4R2U A;  4WHG A;  5KRJ A;  2I0J A;  3AZ3 A;  4OK1 A;  2AYR A;  3WJ4 A;  4MG8 A;  1Z95 A;  3HOD A;  3B5R A;  1SKX A;  1XOW A;  5DX3 B;  3FAL B;  2ZNP A;  1OVL A;  2AWH A;  3E00 D;  2Z4B A;  3FS1 A;  2P1T A;  4XUM A;  2ABI A;  4M8E A;  2ZMH A;  4IVW A;  1FM9 D;  2G0H A;  3HO0 A;  4XTA A;  5DID A;  5EC9 A;  1I37 A;  2ZAS A;  3UP3 A;  1NDE A;  2VV3 A;  3IPQ A;  2GPP A;  3GD2 A;  2NXX A;  4QL8 A;  1LBD A;  3V9V A;  2AX8 A;  2PIV A;  3FAL A;  3FLI A;  5I4V A;  1SR7 A;  5KRA A;  3RUT A;  4ZO1 B;  1M2Z A;  4JYH A;  3PRG A;  1A28 A;  4LSJ A;  1NHZ A;  3ET1 A;  3HQ5 A;  2AA7 A;  3L3Z A;  5KCT A;  5KCW A;  4UDA A;  4REE A;  2R40 A;  3KMR A;  1T7F A;  4N73 A;  4FN9 A;  3E94 A;  4Y29 A;  4P6X A;  3T03 A;  3FUG A;  5KYJ A;  3SP9 A;  4E4Q A;  5KRL A;  4BCR A;  5AK2 A;  1X76 A;  4JAZ A;  2ZK2 A;  4QE8 A;  1UPW A;  4L96 A;  2ACL B;  4RE8 A;  5DUG A;  3OLF A;  4OIL A;  2AAX A;  1NAX A;  4TUZ A;  2EWP A;  4DOS A;  2Q7I A;  3SP6 A;  1G50 A;  3F5C B;  2YAT A;  2AM9 A;  2B50 A;  1DKF B;  4B7W A;  5KCD A;  1K74 D;  1X7J A;  3OSA A;  2PNU A;  3VT7 A;  4DK8 A;  2QAB A;  5KRK A;  3RVF A;  4LBD A;  4OKT A;  5CJ6 A;  4M8H A;  5EIT A;  4CSJ A;  3FXV A;  1ZEO A;  4R06 A;  5DWL A;  2ZK5 A;  3BC5 A;  1Q4X A;  3D24 A;  2VV4 B;  3WJ5 A;  2ZY0 A;  1DKF A;  2HAS A;  3PEQ A;  1OT7 A;  3X31 A;  2V7C A;  4MGA B;  3IA6 A;  5E0X A;  2QR9 A;  2G44 A;  5KRO A;  2J14 A;  2YFE A;  3ZRB A;  1K74 A;  4PWL A;  4UDC A;  3UUA B;  5L7E A;  4G2H A;  3ADU A;  4YPQ A;  2P1V A;  4S0T A;  3W5T A;  2PIR A;  4S14 A;  5JI0 D;  1ILH A;  2AMB A;  3L0L A;  3AX8 A;  5DV6 A;  4O8F A;  2O4J A;  1E3K A;  3A3Z X;  2HWQ A;  4KZI A;  3Q95 B;  1YY4 A;  1XLS A;  5DVS A;  5E15 A;  3W0Y A;  1N46 A;  2IOK A;  2OCF A;  3VT8 A;  2ZNO A;  2QGT A;  1FCY A;  4YT1 A;  4POH A;  4Q50 A;  3W0H A;  5G43 A;  4WLB A;  3KYT A;  2FSZ A;  5B41 A;  3N00 A;  4XAO A;  4JGV A;  3ADX A;  4A2J A;  3BEJ A;  3CTB A;  5B5B A;  5DWG A;  1PQ9 A;  2PIT A;  2HCD A;  3VHW A;  2AX9 A;  4REF A;  5KCC A;  1XDK B;  3ET0 A;  5A86 A;  3R8I A;  4PLD A;  4G2I A;  5HJP A;  5G3J A;  4XT9 A;  5AVL A;  5E7V A;  1S0X A;  1ERE A;  1GWR A;  1XPC A;  1G5Y A;  1R1K D;  2XKW A;  3UUC A;  1H9U A;  1WM0 X;  2HVC A;  2Q59 B;  5FQT A;  3FUR A;  2OAX A;  1N83 A;  3OOK A;  3R5M A;  4K7A A;  4XI3 A;  1ZKY A;  4WQP A;  3L0E A;  2QXM A;  2ZLA A;  4MG9 B;  5KD9 A;  3V9Y A;  4JYG A;  2PIW A;  1R20 A;  1S0Z A;  2P15 A;  4MGD B;  5KRM A;  4IS8 A;  1DB1 A;  4QJR A;  3GYU A;  3MNO A;  4RUJ A;  1XB7 A;  2A3I A;  5HYR A;  2AO6 A;  2E2R A;  5AWJ A;  1R1K A;  2ZVT A;  3UVV A;  2Z4J A;  2IHQ A;  1RKH A;  3HC6 A;  3W0I A;  4RUO X;  2VST A;  4YMQ A;  1YJE A;  1NAV A;  3OMM A;  2QH6 A;  2AA5 A;  3PLZ A;  5G44 A;  1FCZ A;  2PKL A;  1FM6 D;  3D5F A;  4IV4 A;  1PZL A;  4PRG A;  3B66 A;  4RZG A;  4CI5 A;  3AUN A;  5M96 A;  3UP0 A;  1XQC A;  4J24 A;  2I4J A;  5E0W A;  3KMG A;  4RUP A;  3VSP A;  2VV1 B;  3DCT A;  1U9E A;  1L2J A;  3DR1 A;  3B0Q A;  3CDP A;  4IUI A;  4NY9 A;  5C4S A;  2XYX A;  2QA6 A;  5FQS A;  2YHD A;  2QZO B;  2HB8 A;  2JFA A;  4Q13 A;  5DXG A;  5SYZ A;  4ZNT A;  2GIU A;  2NPA A;  3G9E A;  3RY9 A;  5DV3 A;  1XP6 A;  5C4U A;  1FM6 A;  2Q1V A;  3A9E B;  2GPV A;  2O9I A;  2HC4 A;  2R6W A;  3A78 A;  4J26 A;  4TV1 B;  5HCV A;  4E2J A;  5AZV A;  5FQP A;  2Q1H A;  4OGH A;  4RME A;  4ITE A;  3VSO A;  4K4J A;  5DZ1 A;  3A2I A;  4APU A;  2POG A;  4MGB B;  5AAU A;  4MG5 A;  2REW A;  5DX3 A;  5JJM B;  4DM8 A;  3DZU D;  4OH6 A;  4ZN9 A;  1MV9 A;  2ZFX A;  3KPZ A;  1QKN A;  3ILZ A;  3CS8 A;  4TV1 A;  3VTB A;  2QPY A;  4ZNV A;  1OSH A;  3E00 A;  3DCU A;  3WT5 A;  4ZNW A;  2PJL A;  3AUR A;  4ZI1 A;  5DXB B;  3X1H A;  5DRM A;  3KDU A;  4ZN7 A;  1FM9 A;  5DMF A;  3H0A D;  4UDD A;  1KKQ A;  2NW4 A;  2GL8 A;  1XV9 B;  1XJ7 A;  1U3R A;  4X1F A;  3UU7 B;  4QM0 A;  3OAP A;  3W0A A;  3NSQ A;  1LV2 A;  1S9Q A;  4PPP A;  1YA3 A;  5DRJ A;  4ZJR A;  1T76 A;  3DZU A;  5KCF A;  3R8A A;  5DXM A;  4NQA B;  4MG6 A;  4IU7 A;  5H1E A;  2GPU A;  5KR9 A;  3B3K A;  1UPV A;  2Q7L A;  3ERD A;  3HM1 A;  3B68 A;  3D57 A;  4G20 A;  3VHU A;  1XV9 A;  3S9S A;  1ILG A;  4YNK A;  4MDD A;  2F4B A;  3D6D A;  4IV2 A;  3CS6 A;  5AWK A;  4DOR A;  3VT6 A;  5DZ3 A;  2P1U A;  5APH A;  1BSX A;  5AYG A;  1YIN A;  5IZ0 A;  5L7H A;  4CI4 A;  3MNP A;  3OMP A;  4A4W A;  2ACL A;  4OJB A;  1PCG A;  1T65 A;  3VRT A;  5E19 A;  1U3Q A;  2Q5G A;  3OMO A;  1SJ0 A;  2ZXZ A;  3EYB A;  3F5C A;  4ONI A;  2PIQ A;  1U3S A;  3IMY A;  4FNE A;  3NSP A;  4N8R A;  2V0V A;  3G8O A;  2ZBS A;  1Z5X E;  4RZF A;  3VN2 A;  3X36 A;  2HWR A;  3ERT A;  3TX7 B;  4JL4 A;  4ZNH A;  3W5R A;  4OKB A;  3QT0 A;  2Q6S A;  4MGB A;  3GWX A;  2YLY A;  4IWF A;  5DZ0 A;  3OS8 C;  2VV4 A;  3AN3 A;  3G0W A;  3L03 A;  3GN8 A;  3P8X A;  3WWR A;  4G1Z A;  1XIU A;  3AN4 A;  1PK5 A;  4J5W C;  4MGA A;  3P0U A;  4RFW A;  3WTQ A;  3R29 A;  1Z5X U;  4IW6 A;  1XNN A;  2GPO A;  1RK3 A;  2Q61 A;  3B65 A;  3KBA A;  2AX7 A;  4R6S A;  4RMC A;  1QKU A;  1G2N A;  2H77 A;  3A40 X;  3B0T A;  3KFC A;  3VTD A;  3HC5 A;  3R2A A;  2HFP A;  1FCX A;  3UUA A;  2PIP L;  3VT5 A;  4DQM A;  3ZR7 A;  2HB7 A;  4FGY A;  4IA3 A;  3V3Q A;  3ZRA A;  2PIO A;  2PIU A;  3OLS A;  4LTW A;  3ET2 A;  3OGT A;  4OED A;  5FQR A;  1UHL B;  5DZH A;  1RKG A;  3OOF A;  5ICK A;  5L7G A;  2ZL9 A;  5KRI A;  3CS4 A;  3ET3 A;  1ZDU A;  2QGW A;  5DWI A;  2ZLC A;  3P89 A;  3Q95 A;  2QA8 B;  3UUD B;  4FHH A;  1SQN A;  1T7R A;  5DYB A;  2QXS A;  5K13 A;  5KCU A;  4IA1 A;  4L98 A;  4DMA A;  4OEY A;  2FVJ A;  4G1Y A;  4NIE A;  4PP5 A;  3V3E A;  1ERR A;  5GIE A;  3VJS A;  3ZQT A;  4OZR E;  1T63 A;  1XP1 A;  3B0R A;  1VJB A;  2B1Z A; 
#chains in the Genus database with same CATH homology
 3UUD A;  2QA8 A;  5ETH A;  4WPF A;  2QE4 A;  4RAK A;  3OS9 A;  3R5N A;  3A2J A;  1IE9 A;  1NQ0 A;  2Q6R A;  1T7T A;  1PDU A;  1XDK A;  3B1M A;  5GID A;  1RJK A;  2NV7 A;  4OZT E;  4RZE A;  1XNX A;  4PLE A;  1YUC A;  5DWJ A;  4A4V A;  3AZ1 A;  2B23 A;  3A2H A;  3FEJ A;  3O1D A;  2Q59 A;  4OZR U;  5KCE A;  3DT3 A;  3IXP D;  3FC6 B;  2ZK0 A;  1L2I A;  5G46 A;  3VRW A;  3IPU A;  1X78 A;  5DV8 A;  4MG9 A;  1YOK A;  4P6W A;  1FD0 A;  4MGD A;  2AA6 A;  1NRL A;  4JYI A;  3B0W A;  2Q6J A;  3L3X A;  5ACC A;  5L11 A;  2IOG A;  4OZT U;  3TKC A;  2O4R A;  2HBH A;  5DIE A;  4POJ A;  2OUZ A;  3BQD A;  3F7D A;  4OJ9 A;  5DSH A;  3DZY D;  2XYJ A;  3VRU A;  1GWX A;  1ZGY A;  5DIG A;  2J7Y A;  2P7Z A;  1P8D A;  1ZDT A;  1QKM A;  4OIU A;  5APJ A;  3LMP A;  1ZAF A;  4IA2 A;  4OJ4 A;  5G5W A;  5KRC A;  5IAW A;  2G0G A;  3VT4 A;  5GT4 A;  5HYK A;  2Q5S A;  1YMT A;  3AZ2 A;  1IE8 A;  2W8Y A;  3FEI A;  4OHA A;  1NQ7 A;  2VV1 A;  4KZM A;  4Q0A C;  2LBD A;  3B67 A;  1EXX A;  4OFR A;  4J5X C;  3DZY A;  2JJ3 A;  2BJ4 B;  1UOM A;  2QZO A;  5KRF A;  4NUF A;  1HG4 A;  2AXA A;  3VJH A;  1OVL B;  2GTK A;  5DUH A;  5DVC A;  3RLJ A;  1YYE A;  5DXP A;  2Q7K A;  3VI8 A;  3A9E A;  2NXX E;  4IWC A;  3WT7 A;  2J4A A;  5DKB A;  3GYT A;  1Y0S A;  2YJD A;  4ZNS A;  3U9Q A;  3HLV A;  2BJ4 A;  2ZXM A;  3GWS X;  3OMQ A;  4LNX A;  2AX6 A;  1TXI A;  1NUO A;  1OSV A;  1XZX X;  1R5K A;  3CQV A;  3H52 A;  3VJT A;  3VRV A;  3NOA A;  3W0G A;  3W5Q A;  5DWE A;  4E4K A;  5JJM A;  2QW4 A;  4S0S A;  2R40 D;  4ZNU A;  1X7E A;  3RLL A;  3WFG A;  5DY8 A;  4K6I A;  3M7R A;  2VSR A;  5DXE A;  5EHJ A;  5DXB A;  4N1Y A;  5EJV A;  5DKG A;  1HJ1 A;  3OZJ A;  4OEA A;  2QSE A;  5G45 A;  1ZH7 A;  3GZ9 A;  3W0C A;  3OMK A;  2R6Y A;  4DM6 A;  5AZT A;  4XUH A;  4FHI A;  1S9P A;  1I7I A;  3UU7 A;  3H0A A;  1M7W A;  1Y0X X;  3CJW A;  2P54 A;  1X7R A;  2AB2 A;  2Q60 A;  5FQV A;  5DZI A;  2FAI A;  1XVP B;  2P4Y A;  4TUZ B;  1YIM A;  2Q70 A;  3WFF A;  2ZKC A;  1RDT D;  3AUQ A;  3VJI A;  1P93 A;  4IVY A;  2XHS A;  3CDS A;  3K22 A;  4NB6 A;  4OIV A;  1NQ1 A;  2ZNQ A;  3ADW A;  1T5Z A;  1XVP A;  4IW8 A;  4PP6 A;  4RWV A;  5E1C A;  1T7M A;  2PIN A;  3MNE A;  4KZJ A;  5EI1 A;  4IA7 A;  3LBD A;  1G1U A;  4HEE X;  4PXM A;  5DK9 A;  5EGV A;  3L0J A;  3OSI A;  3OS8 A;  4UDB A;  4MGC A;  4QE6 A;  5DXR A;  3OKH A;  3D90 A;  5C4T A;  2YLQ A;  1ZUC A;  4J5W A;  2AMA A;  5AAV B;  5GIC A;  3WGP A;  1RDT A;  1E3G A;  3KWY A;  3JZB A;  2I4Z A;  4PF3 A;  4S15 A;  1MVC A;  3VT9 A;  2I0G A;  4ZO1 X;  1NQ2 A;  3VT3 A;  1YP0 A;  2OZ7 A;  3R8D A;  3K6P A;  4PPS A;  5G42 A;  4OAR A;  5DKE A;  4G1D A;  2PIX A;  3CWD A;  3TKM A;  3O1E A;  1KNU A;  1YOW A;  4PVU A;  5LGA A;  5KRH A;  4OEZ A;  5AAV A;  4WHF A;  1PQC A;  2ZK3 A;  4HLW A;  3V49 A;  1XLS E;  2HAR A;  2Q3Y A;  3VTC A;  2B1V A;  2Q8S A;  3OKI A;  3ADT A;  3ADV A;  2QTU A;  3IPS A;  2QNV A;  3W5P A;  1NYX A;  3K23 A;  5C4O A;  5DUE A;  3OSW A;  3KDT A;  1T79 A;  4G21 A;  1I7G A;  2ATH A;  1UHL A;  3V4A A;  2G5O A;  2QMV A;  3HVL A;  3PBA A;  4LNW A;  4XLD A;  2P7G A;  2JF9 A;  4IQR A;  1PRG A;  5DXQ A;  1M13 A;  4OH5 A;  2OVM A;  2ZK1 A;  1XP9 A;  4XHD A;  2ZNN A;  5DI7 A;  5DVV A;  3OLL A;  5HJP B;  5DMC A;  4EMA A;  1FBY A;  1GS4 A;  2VV0 A;  2HAM A;  3VHV A;  1A52 A;  1N4H A;  5DP0 A;  3OZ0 A;  4EM9 A;  3RUU A;  2Q5P A;  4OLM A;  5DTV A;  4OC7 A;  5E14 A;  4N5G A;  2Q7J A;  5HZC A;  1R20 D;  5DU5 A;  3X1I A;  2ZK6 A;  2BAW A;  3SZ1 A;  2YLP A;  5LWP A;  3GBK A;  4PP3 A;  3W0J A;  5DL4 A;  4OKW A;  4F9M A;  2ZMJ A;  3AFR A;  2POB A;  1Y9R A;  2J7X A;  3TY0 A;  5DYD A;  4DK7 A;  4MG7 B;  3HZF A;  2YLO A;  2P7A A;  3E7C A;  3L1B A;  4QK4 A;  5APK A;  2ZMI A;  1T74 A;  3ADS A;  3CLD A;  3P88 A;  1XAP A;  2VV2 A;  2YJA B;  3FC6 A;  3UVV B;  2OM9 A;  3V9T A;  3G8I A;  3PCU A;  3PO9 A;  3KMZ A;  4ZOM A;  3WT6 A;  1R6G A;  5KYA A;  3IXP A;  3JZC A;  2GP7 A;  1EXA A;  4MG7 A;  3DY6 A;  5DKS A;  1K7L A;  1GWQ A;  5IXK A;  4WVD A;  5AVI A;  4ZJW A;  4OKX A;  2I4P A;  5DLR A;  3WMH A;  1MZN A;  2PRG A;  1T73 A;  4OFU A;  1KV6 A;  4J5X A;  4X1G A;  4MG8 B;  2XYW A;  5DXK A;  2JFA B;  3K8S A;  1X7B A;  1TFC A;  2ZK4 A;  5F9B A;  4RMD A;  1S19 A;  2ZXN A;  2AA2 A;  2OVH A;  1I38 A;  1K4W A;  2H79 A;  1PQ6 A;  5HJS A;  5JY3 A;  2GWX A;  1XQ3 A;  1QKT A;  4ITF A;  4R2U A;  4WHG A;  5KRJ A;  2I0J A;  3AZ3 A;  4OK1 A;  2AYR A;  3WJ4 A;  4MG8 A;  1Z95 A;  3HOD A;  3B5R A;  1SKX A;  1XOW A;  5DX3 B;  3FAL B;  2ZNP A;  1OVL A;  2AWH A;  3E00 D;  2Z4B A;  3FS1 A;  2P1T A;  4XUM A;  2ABI A;  4M8E A;  2ZMH A;  4IVW A;  1FM9 D;  2G0H A;  3HO0 A;  4XTA A;  5DID A;  5EC9 A;  1I37 A;  2ZAS A;  3UP3 A;  1NDE A;  2VV3 A;  3IPQ A;  2GPP A;  3GD2 A;  2NXX A;  4QL8 A;  1LBD A;  3V9V A;  2AX8 A;  2PIV A;  3FAL A;  3FLI A;  5I4V A;  1SR7 A;  5KRA A;  3RUT A;  4ZO1 B;  1M2Z A;  4JYH A;  3PRG A;  1A28 A;  4LSJ A;  1NHZ A;  3ET1 A;  3HQ5 A;  2AA7 A;  3L3Z A;  5KCT A;  5KCW A;  4UDA A;  4REE A;  2R40 A;  3KMR A;  1T7F A;  4N73 A;  4FN9 A;  3E94 A;  4Y29 A;  4P6X A;  3T03 A;  3FUG A;  5KYJ A;  3SP9 A;  4E4Q A;  5KRL A;  4BCR A;  5AK2 A;  1X76 A;  4JAZ A;  2ZK2 A;  4QE8 A;  1UPW A;  4L96 A;  2ACL B;  4RE8 A;  5DUG A;  3OLF A;  4OIL A;  2AAX A;  1NAX A;  4TUZ A;  2EWP A;  4DOS A;  2Q7I A;  3SP6 A;  1G50 A;  3F5C B;  2YAT A;  2AM9 A;  2B50 A;  1DKF B;  4B7W A;  5KCD A;  1K74 D;  1X7J A;  3OSA A;  2PNU A;  3VT7 A;  4DK8 A;  2QAB A;  5KRK A;  3RVF A;  4LBD A;  4OKT A;  5CJ6 A;  4M8H A;  5EIT A;  4CSJ A;  3FXV A;  1ZEO A;  4R06 A;  5DWL A;  2ZK5 A;  3BC5 A;  1Q4X A;  3D24 A;  2VV4 B;  3WJ5 A;  2ZY0 A;  1DKF A;  2HAS A;  3PEQ A;  1OT7 A;  3X31 A;  2V7C A;  4MGA B;  3IA6 A;  5E0X A;  2QR9 A;  2G44 A;  5KRO A;  2J14 A;  2YFE A;  3ZRB A;  1K74 A;  4PWL A;  4UDC A;  3UUA B;  5L7E A;  4G2H A;  3ADU A;  4YPQ A;  2P1V A;  4S0T A;  3W5T A;  2PIR A;  4S14 A;  5JI0 D;  1ILH A;  2AMB A;  3L0L A;  3AX8 A;  5DV6 A;  4O8F A;  2O4J A;  1E3K A;  3A3Z X;  2HWQ A;  4KZI A;  3Q95 B;  1YY4 A;  1XLS A;  5DVS A;  5E15 A;  3W0Y A;  1N46 A;  2IOK A;  2OCF A;  3VT8 A;  2ZNO A;  2QGT A;  1FCY A;  4YT1 A;  4POH A;  4Q50 A;  3W0H A;  5G43 A;  4WLB A;  3KYT A;  2FSZ A;  5B41 A;  3N00 A;  4XAO A;  4JGV A;  3ADX A;  4A2J A;  3BEJ A;  3CTB A;  5B5B A;  5DWG A;  1PQ9 A;  2PIT A;  2HCD A;  3VHW A;  2AX9 A;  4REF A;  5KCC A;  1XDK B;  3ET0 A;  5A86 A;  3R8I A;  4PLD A;  4G2I A;  5HJP A;  5G3J A;  4XT9 A;  5AVL A;  5E7V A;  1S0X A;  1ERE A;  1GWR A;  1XPC A;  1G5Y A;  1R1K D;  2XKW A;  3UUC A;  1H9U A;  1WM0 X;  2HVC A;  2Q59 B;  5FQT A;  3FUR A;  2OAX A;  1N83 A;  3OOK A;  3R5M A;  4K7A A;  4XI3 A;  1ZKY A;  4WQP A;  3L0E A;  2QXM A;  2ZLA A;  4MG9 B;  5KD9 A;  3V9Y A;  4JYG A;  2PIW A;  1R20 A;  1S0Z A;  2P15 A;  4MGD B;  5KRM A;  4IS8 A;  1DB1 A;  4QJR A;  3GYU A;  3MNO A;  4RUJ A;  1XB7 A;  2A3I A;  5HYR A;  2AO6 A;  2E2R A;  5AWJ A;  1R1K A;  2ZVT A;  3UVV A;  2Z4J A;  2IHQ A;  1RKH A;  3HC6 A;  3W0I A;  4RUO X;  2VST A;  4YMQ A;  1YJE A;  1NAV A;  3OMM A;  2QH6 A;  2AA5 A;  3PLZ A;  5G44 A;  1FCZ A;  2PKL A;  1FM6 D;  3D5F A;  4IV4 A;  1PZL A;  4PRG A;  3B66 A;  4RZG A;  4CI5 A;  3AUN A;  5M96 A;  3UP0 A;  1XQC A;  4J24 A;  2I4J A;  5E0W A;  3KMG A;  4RUP A;  3VSP A;  2VV1 B;  3DCT A;  1U9E A;  1L2J A;  3DR1 A;  3B0Q A;  3CDP A;  4IUI A;  4NY9 A;  5C4S A;  2XYX A;  2QA6 A;  5FQS A;  2YHD A;  2QZO B;  2HB8 A;  2JFA A;  4Q13 A;  5DXG A;  5SYZ A;  4ZNT A;  2GIU A;  2NPA A;  3G9E A;  3RY9 A;  5DV3 A;  1XP6 A;  5C4U A;  1FM6 A;  2Q1V A;  3A9E B;  2GPV A;  2O9I A;  2HC4 A;  2R6W A;  3A78 A;  4J26 A;  4TV1 B;  5HCV A;  4E2J A;  5AZV A;  5FQP A;  2Q1H A;  4OGH A;  4RME A;  4ITE A;  3VSO A;  4K4J A;  5DZ1 A;  3A2I A;  4APU A;  2POG A;  4MGB B;  5AAU A;  4MG5 A;  2REW A;  5DX3 A;  5JJM B;  4DM8 A;  3DZU D;  4OH6 A;  4ZN9 A;  1MV9 A;  2ZFX A;  3KPZ A;  1QKN A;  3ILZ A;  3CS8 A;  4TV1 A;  3VTB A;  2QPY A;  4ZNV A;  1OSH A;  3E00 A;  3DCU A;  3WT5 A;  4ZNW A;  2PJL A;  3AUR A;  4ZI1 A;  5DXB B;  3X1H A;  5DRM A;  3KDU A;  4ZN7 A;  1FM9 A;  5DMF A;  3H0A D;  4UDD A;  1KKQ A;  2NW4 A;  2GL8 A;  1XV9 B;  1XJ7 A;  1U3R A;  4X1F A;  3UU7 B;  4QM0 A;  3OAP A;  3W0A A;  3NSQ A;  1LV2 A;  1S9Q A;  4PPP A;  1YA3 A;  5DRJ A;  4ZJR A;  1T76 A;  3DZU A;  5KCF A;  3R8A A;  5DXM A;  4NQA B;  4MG6 A;  4IU7 A;  5H1E A;  2GPU A;  5KR9 A;  3B3K A;  1UPV A;  2Q7L A;  3ERD A;  3HM1 A;  3B68 A;  3D57 A;  4G20 A;  3VHU A;  1XV9 A;  3S9S A;  1ILG A;  4YNK A;  4MDD A;  2F4B A;  3D6D A;  4IV2 A;  3CS6 A;  5AWK A;  4DOR A;  3VT6 A;  5DZ3 A;  2P1U A;  5APH A;  1BSX A;  5AYG A;  1YIN A;  5IZ0 A;  5L7H A;  4CI4 A;  3MNP A;  3OMP A;  4A4W A;  2ACL A;  4OJB A;  1PCG A;  1T65 A;  3VRT A;  5E19 A;  1U3Q A;  2Q5G A;  3OMO A;  1SJ0 A;  2ZXZ A;  3EYB A;  3F5C A;  4ONI A;  2PIQ A;  1U3S A;  3IMY A;  4FNE A;  3NSP A;  4N8R A;  2V0V A;  3G8O A;  2ZBS A;  1Z5X E;  4RZF A;  3VN2 A;  3X36 A;  2HWR A;  3ERT A;  3TX7 B;  4JL4 A;  4ZNH A;  3W5R A;  4OKB A;  3QT0 A;  2Q6S A;  4MGB A;  3GWX A;  2YLY A;  4IWF A;  5DZ0 A;  3OS8 C;  2VV4 A;  3AN3 A;  3G0W A;  3L03 A;  3GN8 A;  3P8X A;  3WWR A;  4G1Z A;  1XIU A;  3AN4 A;  1PK5 A;  4J5W C;  4MGA A;  3P0U A;  4RFW A;  3WTQ A;  3R29 A;  1Z5X U;  4IW6 A;  1XNN A;  2GPO A;  1RK3 A;  2Q61 A;  3B65 A;  3KBA A;  2AX7 A;  4R6S A;  4RMC A;  1QKU A;  1G2N A;  2H77 A;  3A40 X;  3B0T A;  3KFC A;  3VTD A;  3HC5 A;  3R2A A;  2HFP A;  1FCX A;  3UUA A;  2PIP L;  3VT5 A;  4DQM A;  3ZR7 A;  2HB7 A;  4FGY A;  4IA3 A;  3V3Q A;  3ZRA A;  2PIO A;  2PIU A;  3OLS A;  4LTW A;  3ET2 A;  3OGT A;  4OED A;  5FQR A;  1UHL B;  5DZH A;  1RKG A;  3OOF A;  5ICK A;  5L7G A;  2ZL9 A;  5KRI A;  3CS4 A;  3ET3 A;  1ZDU A;  2QGW A;  5DWI A;  2ZLC A;  3P89 A;  3Q95 A;  2QA8 B;  3UUD B;  4FHH A;  1SQN A;  1T7R A;  5DYB A;  2QXS A;  5K13 A;  5KCU A;  4IA1 A;  4L98 A;  4DMA A;  4OEY A;  2FVJ A;  4G1Y A;  4NIE A;  4PP5 A;  3V3E A;  1ERR A;  5GIE A;  3VJS A;  3ZQT A;  4OZR E;  1T63 A;  1XP1 A;  3B0R A;  1VJB A;  2B1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...