3RY9A

Crystal structure of the resurrected ancestral glucocorticoid receptor 1 in complex with doc
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
249
structure length
243
Chain Sequence
PTMISILEAIEPDVIYAGYDSTLPDTTNRLLSSLNRLGGRQMISAVKWAKALPGFRNLHLDDQMTLLQYSWMSLMAFSLGWRSYQHTNGNMLYFAPDLIFNEERMQQSSMYELCKGMHKISLEFVRLQVSYEEYLCMKVLLLLSTVPKDGLKSQAAFDEIRMSYIKELGKAIVKRNWQRFYQLTKLLDSMHDLVGGLLQFCFYTFVESKTLSVEFPEMLVEIISNQLPKVMAGMAKPLLFHQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms for the evolution of a derived function in the ancestral glucocorticoid receptor.
pubmed doi rcsb
molecule keywords Ancestral Glucocorticoid Receptor 1
molecule tags Steroid binding protein
source organism Artificial gene
total genus 98
structure length 243
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3ry9A00
1X76A 1XNXA 4LBDA 1OT7A 1XQCA 4IWFA 2Z4BA 1Q4XA 2PIWA 5DXGA 4G2HA 1T63A 3WJ5A 1PK5A 4IA3A 3OOKA 4WHFA 5JJMB 1X78A 1FM6D 1T5ZA 1T74A 5AVIA 2P7ZA 2P54A 4HLWA 1P8DA 3ADVA 4CI5A 1SKXA 3A9EA 3G8IA 1K74D 3DZUD 2G5OA 2I4JA 2FSZA 1KNUA 3BC5A 4OEAA 3L1BA 4DM8A 1EXAA 2Q5GA 4F9MA 3A40X 2AA6A 1Z95A 3BQDA 3GN8A 1FCYA 3F5CA 4OZRU 4IV2A 4XAOA 5L7HA 5LWPA 3IPQA 1YJEA 2QZOA 4XHDA 1XPCA 5FQVA 3DZYD 3AURA 3OGTA 4O8FA 4Q50A 5HCVA 5KCDA 3HLVA 3V3EA 3IMYA 2HWQA 2GIUA 4RE8A 3B67A 3OMKA 5KRKA 4ZNWA 1N4HA 2Q60A 2Q7KA 3G9EA 5EC9A 4ZI1A 3R29A 5DXPA 3PO9A 3FXVA 2I4ZA 3R5NA 2PIVA 3ET0A 3UUCA 2POBA 4PP3A 4TV1A 3V4AA 3OS9A 4S0SA 3OLFA 2FAIA 2QNVA 3GZ9A 2Q6SA 4RMCA 2O4RA 5G46A 2POGA 2GPPA 3WJ4A 2ZK3A 5DWIA 4DQMA 3OMMA 3OMQA 1ZAFA 5DKGA 1FM9A 2VSTA 4LSJA 2OVMA 3B65A 1OVLB 5DZ1A 4IQRA 1ZDUA 3PCUA 3UP3A 2GWXA 3KMRA 5A86A 4MGBB 3B0WA 4OKWA 5L11A 3UU7A 5KRLA 1Y0SA 2FVJA 4XUMA 1I7IA 4IU7A 2QR9A 3VRVA 1XQ3A 3R2AA 2AO6A 1LBDA 2AA7A 3CDPA 3NSPA 4EMAA 4Q0AC 1QKNA 3UUAB 4FGYA 2G44A 3PEQA 1OSHA 4TUZB 5HJPA 4J24A 1FM6A 4IA1A 3B0RA 4DORA 2J4AA 5DXBB 1T73A 3W0IA 4ITEA 2GL8A 1DB1A 5F9BA 2PJLA 4A4VA 4ONIA 1K74A 2Q7IA 3OZ0A 5H1EA 3DZUA 4RZEA 3CLDA 3RY9A 2QTUA 3RUTA 1FCXA 4OEZA 2VSRA 2R6YA 3LBDA 4DMAA 5K13A 1YINA 2JF9A 3L0JA 1L2IA 2ZK5A 4RMEA 4RZGA 3ZR7A 4L96A 1S19A 1K4WA 5E1CA 4A4WA 2PIXA 3DZYA 4LTWA 1K7LA 1Y0XX 2GPUA 2BJ4B 3VJIA 3WT6A 5EI1A 2ZXNA 4FHHA 3H0AD 4G20A 3WFFA 1N46A 4OGHA 1XVPB 5DRMA 4JYHA 3IA6A 5DV3A 3VJHA 3W0HA 1RKGA 2Q70A 2VV4B 2P4YA 4MG9A 1OSVA 1XB7A 2P1VA 4RZFA 4RWVA 3B66A 5DIDA 5KROA 3SP6A 3VRWA 3UUDB 3PBAA 1WM0X 5DK9A 2NXXA 3IPSA 3R8AA 3W0JA 4OILA 3FUGA 4OH6A 1UHLB 2HWRA 4S15A 3VRUA 3VHUA 4BCRA 5KR9A 3OMOA 4POJA 5AZTA 1I7GA 4UDDA 3VT7A 4KZIA 3D90A 4E4KA 2J7XA 2P15A 4ITFA 2GP7A 3L3ZA 3GYUA 4OJBA 2J7YA 1U3QA 5HJSA 2ZK0A 2JFAA 1QKMA 5DKBA 3F7DA 1NRLA 3CTBA 4XI3A 1PZLA 4PLEA 1BSXA 4MG8B 2Q7LA 3AN4A 3Q95A 5G44A 3RLJA 1XV9A 1S0ZA 2HC4A 2PKLA 2BAWA 3OKIA 3ADSA 3VT5A 4MG7B 5C4SA 2YFEA 1ILHA 1T7FA 2HCDA 2Q1HA 4JGVA 5DP0A 4YT1A 2PRGA 5DX3A 4CSJA 3WGPA 1ILGA 5DMFA 3AN3A 2ZL9A 3KDUA 2QMVA 3KBAA 3CWDA 1Y9RA 3D5FA 3K6PA 4RMDA 3RVFA 1TFCA 2PIOA 3DCUA 4RUOX 5E0XA 4OJ4A 3OMPA 2NW4A 4IUIA 1YYEA 4OFRA 3D57A 1T65A 1YUCA 3VT4A 2AM9A 1DKFA 3V9YA 1IE8A 3UVVB 5L7GA 5DVCA 1GWXA 1ZDTA 2Q1VA 2QA8B 5EHJA 4ZN7A 3OLSA 2B1VA 3X1HA 3FEJA 4ZO1B 1SJ0A 3GYTA 3KFCA 1E3KA 1YA3A 4OHAA 3W5PA 5KRCA 5G3JA 2P7AA 4MGDB 3HZFA 3D6DA 4NB6A 4MG5A 3VN2A 3FC6B 3VT9A 1FBYA 1S9QA 3FALA 3H0AA 3VT6A 3ERDA 2H79A 4XLDA 4FHIA 2YLQA 2YJDA 4OJ9A 4OIUA 5G43A 3ET1A 2Q59A 4PP6A 1GWRA 4UDCA 5ETHA 2LBDA 5DL4A 2AYRA 4OZTE 2J14A 2QW4A 5AK2A 4PVUA 3W0CA 2AB2A 2HAMA 3ZRBA 3X36A 5FQSA 4WLBA 1XP9A 2JJ3A 2PIRA 4OZRE 2QA6A 2ZMIA 3KWYA 4N73A 4QL8A 4PXMA 1NDEA 2QGTA 2ZBSA 4MGAA 2HASA 2ZXMA 3K8SA 3SZ1A 2PNUA 3A9EB 5M96A 3TY0A 4APUA 1S9PA 2EWPA 1Z5XE 3B5RA 3CS6A 5AVLA 3F5CB 1M7WA 3W0YA 3GBKA 3VTBA 4ZNVA 4JYIA 2IOGA 2QZOB 1MV9A 3ET3A 3OZJA 1R5KA 2ZASA 1UPVA 2G0GA 4QE8A 3TX7B 2QE4A 3B0TA 2XHSA 3WT5A 5SYZA 4DK7A 5E14A 2QGWA 2ABIA 3IXPD 1HJ1A 1N83A 2Q5SA 3HO0A 1EXXA 5KCFA 4J5XA 1GWQA 2QXMA 4G1DA 2ZFXA 2ZKCA 1HG4A 3KDTA 3E94A 4ZJWA 3RLLA 2ZNPA 3ZQTA 4ZJRA 4TV1B 5G5WA 3IPUA 3V9VA 5B41A 4S0TA 5EITA 3W5TA 2V0VA 1R20D 4YNKA 5GICA 3VHWA 4KZMA 2OM9A 2AMBA 2ZK1A 5GIEA 5GIDA 3W0GA 3K22A 3KYTA 1A28A 5JY3A 2QPYA 2R40D 3ADTA 2PIPL 1NAXA 5AYGA 4PRGA 3NSQA 2ATHA 3X31A 2ZK4A 3ADXA 3P89A 3WFGA 4PP5A 2ZVTA 3L03A 5IAWA 5FQRA 1NQ2A 3R5MA 3UU7B 3KPZA 3M7RA 4R6SA 2VV2A 2NXXE 5DWGA 3JZBA 4OK1A 5DMCA 4R2UA 3A2HA 1ZUCA 4UDAA 4UDBA 3A2JA 2Q3YA 3CDSA 2ACLA 5DUHA 1ERRA 5G42A 5DV6A 5DIGA 3RUUA 5HJPB 1RDTD 2Q5PA 3AZ1A 2P7GA 2Q6JA 4OKXA 5EJVA 2Z4JA 2VV3A 4WVDA 2VV0A 5DZ0A 3BEJA 3JZCA 3QT0A 2VV1A 3GWXA 4RUJA 1M13A 2B50A 4B7WA 1YY4A 1EREA 3A78A 1LV2A 1PQ9A 5ACCA 2QXSA 4IA7A 2HB8A 3HODA 1L2JA 1NHZA 5APHA 5DWLA 2AA2A 5DTVA 1T7MA 1YP0A 3OAPA 1E3GA 4P6WA 2P1UA 3K23A 2YLOA 5DZHA 5AAVA 1G50A 4ZOMA 2IOKA 1U9EA 4NUFA 3IXPA 5DUGA 5ICKA 3B1MA 3WTQA 3AUQA 4YMQA 3N00A 4X1FA 5DI7A 3HM1A 4MG9B 1XZXX 1XDKA 2O4JA 5KYAA 5EGVA 2YLYA 3P88A 4G21A 3NOAA 3UP0A 3E00D 2Q61A 3R8IA 3KMZA 4OLMA 3HQ5A 4YPQA 5KRFA 1R20A 3A2IA 3DCTA 3KMGA 2I0GA 5DZIA 1RJKA 4XTAA 3ZRAA 1X7RA 2ZMJA 5LGAA 5DKEA 4J5WA 3VTDA 2R40A 1I37A 5DY8A 2OUZA 2GTKA 3E7CA 5DXKA 1X7BA 1XOWA 4J5XC 4K7AA 2JFAB 3MNOA 4KZJA 1NUOA 4NIEA 4Q13A 4QE6A 2OZ7A 4JYGA 4E2JA 5DSHA 4N8RA 4RFWA 4NQAB 4OKBA 5KRJA 3Q95B 4IWCA 3G8OA 1XV9B 1S0XA 4E4QA 1R6GA 1MZNA 3A3ZX 3LMPA 2ZNNA 5FQPA 3T03A 3U9QA 4FNEA 3OS8C 1UOMA 5DX3B 3D24A 3FLIA 2PIUA 3ERTA 5AWKA 2AA5A 5FQTA 5KCWA 4OFUA 4WPFA 5APJA 5DUEA 4M8HA 5AZVA 1RDTA 4IA2A 4FN9A 1QKUA 3DR1A 1MVCA 2NV7A 3VT8A 3FEIA 5KRIA 2HVCA 5E7VA 4JAZA 4R06A 5DWJA 2E2RA 5DXEA 2PIQA 5AWJA 4EM9A 5DLRA 4K4JA 5APKA 2HBHA 1DKFB 5E0WA 4OZTU 5G45A 5KD9A 4DM6A 3MNPA 5HYKA 1PQ6A 1RK3A 2HFPA 4Y29A 4QK4A 4OEDA 3L0LA 2B1ZA 3OSAA 3WMHA 3MNEA 2XYWA 2HARA 4J26A 1XLSE 1OVLA 3OOFA 4M8EA 3FALB 3TKCA 1YIMA 1NAVA 4MGBA 1QKTA 1NQ7A 5KYJA 4G1ZA 1Z5XU 1ZGYA 2AXAA 2AX7A 3L3XA 5DRJA 5GT4A 4OEYA 1XLSA 3VHVA 1G1UA 2Q59B 2IHQA 3E00A 3R8DA 2GPOA 3UUAA 4A2JA 1P93A 2AX8A 3B3KA 3V9TA 3VRTA 5DIEA 5KCTA 2XKWA 3L0EA 5DVVA 4TUZA 2NPAA 1U3SA 2PITA 5DU5A 4PF3A 3H52A 1T7TA 3HC5A 3ET2A 4S14A 4REEA 4MGAB 5DXBA 4DOSA 1XIUA 5DZ3A 1ZH7A 1T79A 3HC6A 2QSEA 4OH5A 1YMTA 2G0HA 1FD0A 2R6WA 3VSPA 2A3IA 3VJSA 4DK8A 3B68A 3OS8A 5DVSA 3W0AA 1R1KD 4MGCA 4P6XA 3VT3A 5AAUA 4MG6A 3GWSX 1SQNA 4N5GA 4IS8A 2BJ4A 5C4TA 4QJRA 2ZNOA 3EYBA 3O1DA 3VJTA 2AX6A 2YATA 1PCGA 2I0JA 3OKHA 4J5WC 2AMAA 4PWLA 5JI0D 2ZK2A 1XVPA 4OARA 5KRHA 4QM0A 3V49A 2VV4A 2Q8SA 4CI4A 3S9SA 1XNNA 3DT3A 4ZNSA 5IZ0A 3UUDA 4MDDA 4ZN9A 2O9IA 1H9UA 4ZNHA 3W5RA 4X1GA 5HZCA 1NQ0A 3TKMA 4L98A 3AX8A 5IXKA 1I38A 1UHLA 4G1YA 2B23A 3V3QA 3CJWA 5HYRA 4WHGA 5DKSA 5E19A 3VTCA 5KCCA 1G2NA 2OVHA 2ZMHA 3CS8A 2ZLCA 4G2IA 4IVYA 2YLPA 2QABA 3AZ3A 2GPVA 2ZY0A 4PPPA 1U3RA 4XUHA 1VJBA 4HEEX 4OIVA 2W8YA 4ZO1X 5DYBA 5DV8A 4IW6A 5L7EA 1RKHA 2XYJA 2HB7A 5KRAA 3X1IA 4MG8A 1PRGA 2REWA 2AAXA 1T76A 2ZXZA 5DXRA 5E15A 5B5BA 5I4VA 1YOWA 4MG7A 4IW8A 2Q6RA 1ZEOA 2YHDA 3OSIA 3HVLA 3ADWA 4OC7A 4RUPA 1X7JA 3PRGA 2QH6A 2ZLAA 3B0QA 1XP1A 2V7CA 1PDUA 3AFRA 5C4UA 3VI8A 1UPWA 3W5QA 1NYXA 3PLZA 5KCUA 1XAPA 2ACLB 4PLDA 3WT7A 2P1TA 5CJ6A 2AWHA 2OAXA 1KV6A 3AUNA 1PQCA 2AX9A 2Q7JA 4WQPA 4JL4A 5DXMA 5C4OA 4K6IA 1XJ7A 3OSWA 4XT9A 3FS1A 1T7RA 2OCFA 5DWEA 3WWRA 3P8XA 4LNXA 1XP6A 3UVVA 1M2ZA 4IVWA 3DY6A 2PINA 2QA8A 2VV1B 3O1EA 5JJMA 4REFA 1R1KA 2ZNQA 5DYDA 1IE9A 1NQ1A 1GS4A 3SP9A 1ZKYA 1SR7A 2H77A 3CQVA 3FURA 3OLLA 4POHA 4LNWA 4OKTA 4NY9A 1KKQA 2F4BA 4IV4A 4MGDA 1YOKA 1FM9D 5DXQA 3FC6A 3VSOA 4RAKA 5KRMA 1TXIA 3GD2A 5AAVB 3AZ2A 2I4PA 3CS4A 4ZNTA 2YJAB 4N1YA 3G0WA 3P0UA 4PPSA 5KCEA 1A52A 1G5YA 3ILZA 4ZNUA 1X7EA 3ADUA 1XDKB 2XYXA 1FCZA 2ZK6A
chains in the Genus database with same CATH superfamily
1X76A 1XNXA 4LBDA 1OT7A 1XQCA 4IWFA 2Z4BA 1Q4XA 2PIWA 5DXGA 4G2HA 1T63A 3WJ5A 1PK5A 4IA3A 3OOKA 4WHFA 5JJMB 1X78A 1FM6D 1T5ZA 1T74A 5AVIA 2P7ZA 2P54A 4HLWA 1P8DA 3ADVA 4CI5A 1SKXA 3A9EA 3G8IA 1K74D 3DZUD 2G5OA 2I4JA 2FSZA 1KNUA 3BC5A 4OEAA 3L1BA 4DM8A 1EXAA 2Q5GA 4F9MA 3A40X 2AA6A 1Z95A 3BQDA 3GN8A 1FCYA 3F5CA 4OZRU 4IV2A 4XAOA 5L7HA 5LWPA 3IPQA 1YJEA 2QZOA 4XHDA 1XPCA 5FQVA 3DZYD 3AURA 3OGTA 4O8FA 4Q50A 5HCVA 5KCDA 3HLVA 3V3EA 3IMYA 2HWQA 2GIUA 4RE8A 3B67A 3OMKA 5KRKA 4ZNWA 1N4HA 2Q60A 2Q7KA 3G9EA 5EC9A 4ZI1A 3R29A 5DXPA 3PO9A 3FXVA 2I4ZA 3R5NA 2PIVA 3ET0A 3UUCA 2POBA 4PP3A 4TV1A 3V4AA 3OS9A 4S0SA 3OLFA 2FAIA 2QNVA 3GZ9A 2Q6SA 4RMCA 2O4RA 5G46A 2POGA 2GPPA 3WJ4A 2ZK3A 5DWIA 4DQMA 3OMMA 3OMQA 1ZAFA 5DKGA 1FM9A 2VSTA 4LSJA 2OVMA 3B65A 1OVLB 5DZ1A 4IQRA 1ZDUA 3PCUA 3UP3A 2GWXA 3KMRA 5A86A 4MGBB 3B0WA 4OKWA 5L11A 3UU7A 5KRLA 1Y0SA 2FVJA 4XUMA 1I7IA 4IU7A 2QR9A 3VRVA 1XQ3A 3R2AA 2AO6A 1LBDA 2AA7A 3CDPA 3NSPA 4EMAA 4Q0AC 1QKNA 3UUAB 4FGYA 2G44A 3PEQA 1OSHA 4TUZB 5HJPA 4J24A 1FM6A 4IA1A 3B0RA 4DORA 2J4AA 5DXBB 1T73A 3W0IA 4ITEA 2GL8A 1DB1A 5F9BA 2PJLA 4A4VA 4ONIA 1K74A 2Q7IA 3OZ0A 5H1EA 3DZUA 4RZEA 3CLDA 3RY9A 2QTUA 3RUTA 1FCXA 4OEZA 2VSRA 2R6YA 3LBDA 4DMAA 5K13A 1YINA 2JF9A 3L0JA 1L2IA 2ZK5A 4RMEA 4RZGA 3ZR7A 4L96A 1S19A 1K4WA 5E1CA 4A4WA 2PIXA 3DZYA 4LTWA 1K7LA 1Y0XX 2GPUA 2BJ4B 3VJIA 3WT6A 5EI1A 2ZXNA 4FHHA 3H0AD 4G20A 3WFFA 1N46A 4OGHA 1XVPB 5DRMA 4JYHA 3IA6A 5DV3A 3VJHA 3W0HA 1RKGA 2Q70A 2VV4B 2P4YA 4MG9A 1OSVA 1XB7A 2P1VA 4RZFA 4RWVA 3B66A 5DIDA 5KROA 3SP6A 3VRWA 3UUDB 3PBAA 1WM0X 5DK9A 2NXXA 3IPSA 3R8AA 3W0JA 4OILA 3FUGA 4OH6A 1UHLB 2HWRA 4S15A 3VRUA 3VHUA 4BCRA 5KR9A 3OMOA 4POJA 5AZTA 1I7GA 4UDDA 3VT7A 4KZIA 3D90A 4E4KA 2J7XA 2P15A 4ITFA 2GP7A 3L3ZA 3GYUA 4OJBA 2J7YA 1U3QA 5HJSA 2ZK0A 2JFAA 1QKMA 5DKBA 3F7DA 1NRLA 3CTBA 4XI3A 1PZLA 4PLEA 1BSXA 4MG8B 2Q7LA 3AN4A 3Q95A 5G44A 3RLJA 1XV9A 1S0ZA 2HC4A 2PKLA 2BAWA 3OKIA 3ADSA 3VT5A 4MG7B 5C4SA 2YFEA 1ILHA 1T7FA 2HCDA 2Q1HA 4JGVA 5DP0A 4YT1A 2PRGA 5DX3A 4CSJA 3WGPA 1ILGA 5DMFA 3AN3A 2ZL9A 3KDUA 2QMVA 3KBAA 3CWDA 1Y9RA 3D5FA 3K6PA 4RMDA 3RVFA 1TFCA 2PIOA 3DCUA 4RUOX 5E0XA 4OJ4A 3OMPA 2NW4A 4IUIA 1YYEA 4OFRA 3D57A 1T65A 1YUCA 3VT4A 2AM9A 1DKFA 3V9YA 1IE8A 3UVVB 5L7GA 5DVCA 1GWXA 1ZDTA 2Q1VA 2QA8B 5EHJA 4ZN7A 3OLSA 2B1VA 3X1HA 3FEJA 4ZO1B 1SJ0A 3GYTA 3KFCA 1E3KA 1YA3A 4OHAA 3W5PA 5KRCA 5G3JA 2P7AA 4MGDB 3HZFA 3D6DA 4NB6A 4MG5A 3VN2A 3FC6B 3VT9A 1FBYA 1S9QA 3FALA 3H0AA 3VT6A 3ERDA 2H79A 4XLDA 4FHIA 2YLQA 2YJDA 4OJ9A 4OIUA 5G43A 3ET1A 2Q59A 4PP6A 1GWRA 4UDCA 5ETHA 2LBDA 5DL4A 2AYRA 4OZTE 2J14A 2QW4A 5AK2A 4PVUA 3W0CA 2AB2A 2HAMA 3ZRBA 3X36A 5FQSA 4WLBA 1XP9A 2JJ3A 2PIRA 4OZRE 2QA6A 2ZMIA 3KWYA 4N73A 4QL8A 4PXMA 1NDEA 2QGTA 2ZBSA 4MGAA 2HASA 2ZXMA 3K8SA 3SZ1A 2PNUA 3A9EB 5M96A 3TY0A 4APUA 1S9PA 2EWPA 1Z5XE 3B5RA 3CS6A 5AVLA 3F5CB 1M7WA 3W0YA 3GBKA 3VTBA 4ZNVA 4JYIA 2IOGA 2QZOB 1MV9A 3ET3A 3OZJA 1R5KA 2ZASA 1UPVA 2G0GA 4QE8A 3TX7B 2QE4A 3B0TA 2XHSA 3WT5A 5SYZA 4DK7A 5E14A 2QGWA 2ABIA 3IXPD 1HJ1A 1N83A 2Q5SA 3HO0A 1EXXA 5KCFA 4J5XA 1GWQA 2QXMA 4G1DA 2ZFXA 2ZKCA 1HG4A 3KDTA 3E94A 4ZJWA 3RLLA 2ZNPA 3ZQTA 4ZJRA 4TV1B 5G5WA 3IPUA 3V9VA 5B41A 4S0TA 5EITA 3W5TA 2V0VA 1R20D 4YNKA 5GICA 3VHWA 4KZMA 2OM9A 2AMBA 2ZK1A 5GIEA 5GIDA 3W0GA 3K22A 3KYTA 1A28A 5JY3A 2QPYA 2R40D 3ADTA 2PIPL 1NAXA 5AYGA 4PRGA 3NSQA 2ATHA 3X31A 2ZK4A 3ADXA 3P89A 3WFGA 4PP5A 2ZVTA 3L03A 5IAWA 5FQRA 1NQ2A 3R5MA 3UU7B 3KPZA 3M7RA 4R6SA 2VV2A 2NXXE 5DWGA 3JZBA 4OK1A 5DMCA 4R2UA 3A2HA 1ZUCA 4UDAA 4UDBA 3A2JA 2Q3YA 3CDSA 2ACLA 5DUHA 1ERRA 5G42A 5DV6A 5DIGA 3RUUA 5HJPB 1RDTD 2Q5PA 3AZ1A 2P7GA 2Q6JA 4OKXA 5EJVA 2Z4JA 2VV3A 4WVDA 2VV0A 5DZ0A 3BEJA 3JZCA 3QT0A 2VV1A 3GWXA 4RUJA 1M13A 2B50A 4B7WA 1YY4A 1EREA 3A78A 1LV2A 1PQ9A 5ACCA 2QXSA 4IA7A 2HB8A 3HODA 1L2JA 1NHZA 5APHA 5DWLA 2AA2A 5DTVA 1T7MA 1YP0A 3OAPA 1E3GA 4P6WA 2P1UA 3K23A 2YLOA 5DZHA 5AAVA 1G50A 4ZOMA 2IOKA 1U9EA 4NUFA 3IXPA 5DUGA 5ICKA 3B1MA 3WTQA 3AUQA 4YMQA 3N00A 4X1FA 5DI7A 3HM1A 4MG9B 1XZXX 1XDKA 2O4JA 5KYAA 5EGVA 2YLYA 3P88A 4G21A 3NOAA 3UP0A 3E00D 2Q61A 3R8IA 3KMZA 4OLMA 3HQ5A 4YPQA 5KRFA 1R20A 3A2IA 3DCTA 3KMGA 2I0GA 5DZIA 1RJKA 4XTAA 3ZRAA 1X7RA 2ZMJA 5LGAA 5DKEA 4J5WA 3VTDA 2R40A 1I37A 5DY8A 2OUZA 2GTKA 3E7CA 5DXKA 1X7BA 1XOWA 4J5XC 4K7AA 2JFAB 3MNOA 4KZJA 1NUOA 4NIEA 4Q13A 4QE6A 2OZ7A 4JYGA 4E2JA 5DSHA 4N8RA 4RFWA 4NQAB 4OKBA 5KRJA 3Q95B 4IWCA 3G8OA 1XV9B 1S0XA 4E4QA 1R6GA 1MZNA 3A3ZX 3LMPA 2ZNNA 5FQPA 3T03A 3U9QA 4FNEA 3OS8C 1UOMA 5DX3B 3D24A 3FLIA 2PIUA 3ERTA 5AWKA 2AA5A 5FQTA 5KCWA 4OFUA 4WPFA 5APJA 5DUEA 4M8HA 5AZVA 1RDTA 4IA2A 4FN9A 1QKUA 3DR1A 1MVCA 2NV7A 3VT8A 3FEIA 5KRIA 2HVCA 5E7VA 4JAZA 4R06A 5DWJA 2E2RA 5DXEA 2PIQA 5AWJA 4EM9A 5DLRA 4K4JA 5APKA 2HBHA 1DKFB 5E0WA 4OZTU 5G45A 5KD9A 4DM6A 3MNPA 5HYKA 1PQ6A 1RK3A 2HFPA 4Y29A 4QK4A 4OEDA 3L0LA 2B1ZA 3OSAA 3WMHA 3MNEA 2XYWA 2HARA 4J26A 1XLSE 1OVLA 3OOFA 4M8EA 3FALB 3TKCA 1YIMA 1NAVA 4MGBA 1QKTA 1NQ7A 5KYJA 4G1ZA 1Z5XU 1ZGYA 2AXAA 2AX7A 3L3XA 5DRJA 5GT4A 4OEYA 1XLSA 3VHVA 1G1UA 2Q59B 2IHQA 3E00A 3R8DA 2GPOA 3UUAA 4A2JA 1P93A 2AX8A 3B3KA 3V9TA 3VRTA 5DIEA 5KCTA 2XKWA 3L0EA 5DVVA 4TUZA 2NPAA 1U3SA 2PITA 5DU5A 4PF3A 3H52A 1T7TA 3HC5A 3ET2A 4S14A 4REEA 4MGAB 5DXBA 4DOSA 1XIUA 5DZ3A 1ZH7A 1T79A 3HC6A 2QSEA 4OH5A 1YMTA 2G0HA 1FD0A 2R6WA 3VSPA 2A3IA 3VJSA 4DK8A 3B68A 3OS8A 5DVSA 3W0AA 1R1KD 4MGCA 4P6XA 3VT3A 5AAUA 4MG6A 3GWSX 1SQNA 4N5GA 4IS8A 2BJ4A 5C4TA 4QJRA 2ZNOA 3EYBA 3O1DA 3VJTA 2AX6A 2YATA 1PCGA 2I0JA 3OKHA 4J5WC 2AMAA 4PWLA 5JI0D 2ZK2A 1XVPA 4OARA 5KRHA 4QM0A 3V49A 2VV4A 2Q8SA 4CI4A 3S9SA 1XNNA 3DT3A 4ZNSA 5IZ0A 3UUDA 4MDDA 4ZN9A 2O9IA 1H9UA 4ZNHA 3W5RA 4X1GA 5HZCA 1NQ0A 3TKMA 4L98A 3AX8A 5IXKA 1I38A 1UHLA 4G1YA 2B23A 3V3QA 3CJWA 5HYRA 4WHGA 5DKSA 5E19A 3VTCA 5KCCA 1G2NA 2OVHA 2ZMHA 3CS8A 2ZLCA 4G2IA 4IVYA 2YLPA 2QABA 3AZ3A 2GPVA 2ZY0A 4PPPA 1U3RA 4XUHA 1VJBA 4HEEX 4OIVA 2W8YA 4ZO1X 5DYBA 5DV8A 4IW6A 5L7EA 1RKHA 2XYJA 2HB7A 5KRAA 3X1IA 4MG8A 1PRGA 2REWA 2AAXA 1T76A 2ZXZA 5DXRA 5E15A 5B5BA 5I4VA 1YOWA 4MG7A 4IW8A 2Q6RA 1ZEOA 2YHDA 3OSIA 3HVLA 3ADWA 4OC7A 4RUPA 1X7JA 3PRGA 2QH6A 2ZLAA 3B0QA 1XP1A 2V7CA 1PDUA 3AFRA 5C4UA 3VI8A 1UPWA 3W5QA 1NYXA 3PLZA 5KCUA 1XAPA 2ACLB 4PLDA 3WT7A 2P1TA 5CJ6A 2AWHA 2OAXA 1KV6A 3AUNA 1PQCA 2AX9A 2Q7JA 4WQPA 4JL4A 5DXMA 5C4OA 4K6IA 1XJ7A 3OSWA 4XT9A 3FS1A 1T7RA 2OCFA 5DWEA 3WWRA 3P8XA 4LNXA 1XP6A 3UVVA 1M2ZA 4IVWA 3DY6A 2PINA 2QA8A 2VV1B 3O1EA 5JJMA 4REFA 1R1KA 2ZNQA 5DYDA 1IE9A 1NQ1A 1GS4A 3SP9A 1ZKYA 1SR7A 2H77A 3CQVA 3FURA 3OLLA 4POHA 4LNWA 4OKTA 4NY9A 1KKQA 2F4BA 4IV4A 4MGDA 1YOKA 1FM9D 5DXQA 3FC6A 3VSOA 4RAKA 5KRMA 1TXIA 3GD2A 5AAVB 3AZ2A 2I4PA 3CS4A 4ZNTA 2YJAB 4N1YA 3G0WA 3P0UA 4PPSA 5KCEA 1A52A 1G5YA 3ILZA 4ZNUA 1X7EA 3ADUA 1XDKB 2XYXA 1FCZA 2ZK6A
chains in the Genus database with same CATH topology
1X76A 1XNXA 4LBDA 1OT7A 1XQCA 4IWFA 2Z4BA 1Q4XA 2PIWA 5DXGA 4G2HA 1T63A 3WJ5A 1PK5A 4IA3A 3OOKA 4WHFA 5JJMB 1X78A 1FM6D 1T5ZA 1T74A 5AVIA 2P7ZA 2P54A 4HLWA 1P8DA 3ADVA 4CI5A 1SKXA 3A9EA 3G8IA 1K74D 3DZUD 2G5OA 2I4JA 2FSZA 1KNUA 3BC5A 4OEAA 3L1BA 4DM8A 1EXAA 2Q5GA 4F9MA 3A40X 2AA6A 1Z95A 3BQDA 3GN8A 1FCYA 3F5CA 4OZRU 4IV2A 4XAOA 5L7HA 5LWPA 3IPQA 1YJEA 2QZOA 4XHDA 1XPCA 5FQVA 3DZYD 3AURA 3OGTA 4O8FA 4Q50A 5HCVA 5KCDA 3HLVA 3V3EA 3IMYA 2HWQA 2GIUA 4RE8A 3B67A 3OMKA 5KRKA 4ZNWA 1N4HA 2Q60A 2Q7KA 3G9EA 5EC9A 4ZI1A 3R29A 5DXPA 3PO9A 3FXVA 2I4ZA 3R5NA 2PIVA 3ET0A 3UUCA 2POBA 4PP3A 4TV1A 3V4AA 3OS9A 4S0SA 3OLFA 2FAIA 2QNVA 3GZ9A 2Q6SA 4RMCA 2O4RA 5G46A 2POGA 2GPPA 3WJ4A 2ZK3A 5DWIA 4DQMA 3OMMA 3OMQA 1ZAFA 5DKGA 1FM9A 2VSTA 4LSJA 2OVMA 3B65A 1OVLB 5DZ1A 4IQRA 1ZDUA 3PCUA 3UP3A 2GWXA 3KMRA 5A86A 4MGBB 3B0WA 4OKWA 5L11A 3UU7A 5KRLA 1Y0SA 2FVJA 4XUMA 1I7IA 4IU7A 2QR9A 3VRVA 1XQ3A 3R2AA 2AO6A 1LBDA 2AA7A 3CDPA 3NSPA 4EMAA 4Q0AC 1QKNA 3UUAB 4FGYA 2G44A 3PEQA 1OSHA 4TUZB 5HJPA 4J24A 1FM6A 4IA1A 3B0RA 4DORA 2J4AA 5DXBB 1T73A 3W0IA 4ITEA 2GL8A 1DB1A 5F9BA 2PJLA 4A4VA 4ONIA 1K74A 2Q7IA 3OZ0A 5H1EA 3DZUA 4RZEA 3CLDA 3RY9A 2QTUA 3RUTA 1FCXA 4OEZA 2VSRA 2R6YA 3LBDA 4DMAA 5K13A 1YINA 2JF9A 3L0JA 1L2IA 2ZK5A 4RMEA 4RZGA 3ZR7A 4L96A 1S19A 1K4WA 5E1CA 4A4WA 2PIXA 3DZYA 4LTWA 1K7LA 1Y0XX 2GPUA 2BJ4B 3VJIA 3WT6A 5EI1A 2ZXNA 4FHHA 3H0AD 4G20A 3WFFA 1N46A 4OGHA 1XVPB 5DRMA 4JYHA 3IA6A 5DV3A 3VJHA 3W0HA 1RKGA 2Q70A 2VV4B 2P4YA 4MG9A 1OSVA 1XB7A 2P1VA 4RZFA 4RWVA 3B66A 5DIDA 5KROA 3SP6A 3VRWA 3UUDB 3PBAA 1WM0X 5DK9A 2NXXA 3IPSA 3R8AA 3W0JA 4OILA 3FUGA 4OH6A 1UHLB 2HWRA 4S15A 3VRUA 3VHUA 4BCRA 5KR9A 3OMOA 4POJA 5AZTA 1I7GA 4UDDA 3VT7A 4KZIA 3D90A 4E4KA 2J7XA 2P15A 4ITFA 2GP7A 3L3ZA 3GYUA 4OJBA 2J7YA 1U3QA 5HJSA 2ZK0A 2JFAA 1QKMA 5DKBA 3F7DA 1NRLA 3CTBA 4XI3A 1PZLA 4PLEA 1BSXA 4MG8B 2Q7LA 3AN4A 3Q95A 5G44A 3RLJA 1XV9A 1S0ZA 2HC4A 2PKLA 2BAWA 3OKIA 3ADSA 3VT5A 4MG7B 5C4SA 2YFEA 1ILHA 1T7FA 2HCDA 2Q1HA 4JGVA 5DP0A 4YT1A 2PRGA 5DX3A 4CSJA 3WGPA 1ILGA 5DMFA 3AN3A 2ZL9A 3KDUA 2QMVA 3KBAA 3CWDA 1Y9RA 3D5FA 3K6PA 4RMDA 3RVFA 1TFCA 2PIOA 3DCUA 4RUOX 5E0XA 4OJ4A 3OMPA 2NW4A 4IUIA 1YYEA 4OFRA 3D57A 1T65A 1YUCA 3VT4A 2AM9A 1DKFA 3V9YA 1IE8A 3UVVB 5L7GA 5DVCA 1GWXA 1ZDTA 2Q1VA 2QA8B 5EHJA 4ZN7A 3OLSA 2B1VA 3X1HA 3FEJA 4ZO1B 1SJ0A 3GYTA 3KFCA 1E3KA 1YA3A 4OHAA 3W5PA 5KRCA 5G3JA 2P7AA 4MGDB 3HZFA 3D6DA 4NB6A 4MG5A 3VN2A 3FC6B 3VT9A 1FBYA 1S9QA 3FALA 3H0AA 3VT6A 3ERDA 2H79A 4XLDA 4FHIA 2YLQA 2YJDA 4OJ9A 4OIUA 5G43A 3ET1A 2Q59A 4PP6A 1GWRA 4UDCA 5ETHA 2LBDA 5DL4A 2AYRA 4OZTE 2J14A 2QW4A 5AK2A 4PVUA 3W0CA 2AB2A 2HAMA 3ZRBA 3X36A 5FQSA 4WLBA 1XP9A 2JJ3A 2PIRA 4OZRE 2QA6A 2ZMIA 3KWYA 4N73A 4QL8A 4PXMA 1NDEA 2QGTA 2ZBSA 4MGAA 2HASA 2ZXMA 3K8SA 3SZ1A 2PNUA 3A9EB 5M96A 3TY0A 4APUA 1S9PA 2EWPA 1Z5XE 3B5RA 3CS6A 5AVLA 3F5CB 1M7WA 3W0YA 3GBKA 3VTBA 4ZNVA 4JYIA 2IOGA 2QZOB 1MV9A 3ET3A 3OZJA 1R5KA 2ZASA 1UPVA 2G0GA 4QE8A 3TX7B 2QE4A 3B0TA 2XHSA 3WT5A 5SYZA 4DK7A 5E14A 2QGWA 2ABIA 3IXPD 1HJ1A 1N83A 2Q5SA 3HO0A 1EXXA 5KCFA 4J5XA 1GWQA 2QXMA 4G1DA 2ZFXA 2ZKCA 1HG4A 3KDTA 3E94A 4ZJWA 3RLLA 2ZNPA 3ZQTA 4ZJRA 4TV1B 5G5WA 3IPUA 3V9VA 5B41A 4S0TA 5EITA 3W5TA 2V0VA 1R20D 4YNKA 5GICA 3VHWA 4KZMA 2OM9A 2AMBA 2ZK1A 5GIEA 5GIDA 3W0GA 3K22A 3KYTA 1A28A 5JY3A 2QPYA 2R40D 3ADTA 2PIPL 1NAXA 5AYGA 4PRGA 3NSQA 2ATHA 3X31A 2ZK4A 3ADXA 3P89A 3WFGA 4PP5A 2ZVTA 3L03A 5IAWA 5FQRA 1NQ2A 3R5MA 3UU7B 3KPZA 3M7RA 4R6SA 2VV2A 2NXXE 5DWGA 3JZBA 4OK1A 5DMCA 4R2UA 3A2HA 1ZUCA 4UDAA 4UDBA 3A2JA 2Q3YA 3CDSA 2ACLA 5DUHA 1ERRA 5G42A 5DV6A 5DIGA 3RUUA 5HJPB 1RDTD 2Q5PA 3AZ1A 2P7GA 2Q6JA 4OKXA 5EJVA 2Z4JA 2VV3A 4WVDA 2VV0A 5DZ0A 3BEJA 3JZCA 3QT0A 2VV1A 3GWXA 4RUJA 1M13A 2B50A 4B7WA 1YY4A 1EREA 3A78A 1LV2A 1PQ9A 5ACCA 2QXSA 4IA7A 2HB8A 3HODA 1L2JA 1NHZA 5APHA 5DWLA 2AA2A 5DTVA 1T7MA 1YP0A 3OAPA 1E3GA 4P6WA 2P1UA 3K23A 2YLOA 5DZHA 5AAVA 1G50A 4ZOMA 2IOKA 1U9EA 4NUFA 3IXPA 5DUGA 5ICKA 3B1MA 3WTQA 3AUQA 4YMQA 3N00A 4X1FA 5DI7A 3HM1A 4MG9B 1XZXX 1XDKA 2O4JA 5KYAA 5EGVA 2YLYA 3P88A 4G21A 3NOAA 3UP0A 3E00D 2Q61A 3R8IA 3KMZA 4OLMA 3HQ5A 4YPQA 5KRFA 1R20A 3A2IA 3DCTA 3KMGA 2I0GA 5DZIA 1RJKA 4XTAA 3ZRAA 1X7RA 2ZMJA 5LGAA 5DKEA 4J5WA 3VTDA 2R40A 1I37A 5DY8A 2OUZA 2GTKA 3E7CA 5DXKA 1X7BA 1XOWA 4J5XC 4K7AA 2JFAB 3MNOA 4KZJA 1NUOA 4NIEA 4Q13A 4QE6A 2OZ7A 4JYGA 4E2JA 5DSHA 4N8RA 4RFWA 4NQAB 4OKBA 5KRJA 3Q95B 4IWCA 3G8OA 1XV9B 1S0XA 4E4QA 1R6GA 1MZNA 3A3ZX 3LMPA 2ZNNA 5FQPA 3T03A 3U9QA 4FNEA 3OS8C 1UOMA 5DX3B 3D24A 3FLIA 2PIUA 3ERTA 5AWKA 2AA5A 5FQTA 5KCWA 4OFUA 4WPFA 5APJA 5DUEA 4M8HA 5AZVA 1RDTA 4IA2A 4FN9A 1QKUA 3DR1A 1MVCA 2NV7A 3VT8A 3FEIA 5KRIA 2HVCA 5E7VA 4JAZA 4R06A 5DWJA 2E2RA 5DXEA 2PIQA 5AWJA 4EM9A 5DLRA 4K4JA 5APKA 2HBHA 1DKFB 5E0WA 4OZTU 5G45A 5KD9A 4DM6A 3MNPA 5HYKA 1PQ6A 1RK3A 2HFPA 4Y29A 4QK4A 4OEDA 3L0LA 2B1ZA 3OSAA 3WMHA 3MNEA 2XYWA 2HARA 4J26A 1XLSE 1OVLA 3OOFA 4M8EA 3FALB 3TKCA 1YIMA 1NAVA 4MGBA 1QKTA 1NQ7A 5KYJA 4G1ZA 1Z5XU 1ZGYA 2AXAA 2AX7A 3L3XA 5DRJA 5GT4A 4OEYA 1XLSA 3VHVA 1G1UA 2Q59B 2IHQA 3E00A 3R8DA 2GPOA 3UUAA 4A2JA 1P93A 2AX8A 3B3KA 3V9TA 3VRTA 5DIEA 5KCTA 2XKWA 3L0EA 5DVVA 4TUZA 2NPAA 1U3SA 2PITA 5DU5A 4PF3A 3H52A 1T7TA 3HC5A 3ET2A 4S14A 4REEA 4MGAB 5DXBA 4DOSA 1XIUA 5DZ3A 1ZH7A 1T79A 3HC6A 2QSEA 4OH5A 1YMTA 2G0HA 1FD0A 2R6WA 3VSPA 2A3IA 3VJSA 4DK8A 3B68A 3OS8A 5DVSA 3W0AA 1R1KD 4MGCA 4P6XA 3VT3A 5AAUA 4MG6A 3GWSX 1SQNA 4N5GA 4IS8A 2BJ4A 5C4TA 4QJRA 2ZNOA 3EYBA 3O1DA 3VJTA 2AX6A 2YATA 1PCGA 2I0JA 3OKHA 4J5WC 2AMAA 4PWLA 5JI0D 2ZK2A 1XVPA 4OARA 5KRHA 4QM0A 3V49A 2VV4A 2Q8SA 4CI4A 3S9SA 1XNNA 3DT3A 4ZNSA 5IZ0A 3UUDA 4MDDA 4ZN9A 2O9IA 1H9UA 4ZNHA 3W5RA 4X1GA 5HZCA 1NQ0A 3TKMA 4L98A 3AX8A 5IXKA 1I38A 1UHLA 4G1YA 2B23A 3V3QA 3CJWA 5HYRA 4WHGA 5DKSA 5E19A 3VTCA 5KCCA 1G2NA 2OVHA 2ZMHA 3CS8A 2ZLCA 4G2IA 4IVYA 2YLPA 2QABA 3AZ3A 2GPVA 2ZY0A 4PPPA 1U3RA 4XUHA 1VJBA 4HEEX 4OIVA 2W8YA 4ZO1X 5DYBA 5DV8A 4IW6A 5L7EA 1RKHA 2XYJA 2HB7A 5KRAA 3X1IA 4MG8A 1PRGA 2REWA 2AAXA 1T76A 2ZXZA 5DXRA 5E15A 5B5BA 5I4VA 1YOWA 4MG7A 4IW8A 2Q6RA 1ZEOA 2YHDA 3OSIA 3HVLA 3ADWA 4OC7A 4RUPA 1X7JA 3PRGA 2QH6A 2ZLAA 3B0QA 1XP1A 2V7CA 1PDUA 3AFRA 5C4UA 3VI8A 1UPWA 3W5QA 1NYXA 3PLZA 5KCUA 1XAPA 2ACLB 4PLDA 3WT7A 2P1TA 5CJ6A 2AWHA 2OAXA 1KV6A 3AUNA 1PQCA 2AX9A 2Q7JA 4WQPA 4JL4A 5DXMA 5C4OA 4K6IA 1XJ7A 3OSWA 4XT9A 3FS1A 1T7RA 2OCFA 5DWEA 3WWRA 3P8XA 4LNXA 1XP6A 3UVVA 1M2ZA 4IVWA 3DY6A 2PINA 2QA8A 2VV1B 3O1EA 5JJMA 4REFA 1R1KA 2ZNQA 5DYDA 1IE9A 1NQ1A 1GS4A 3SP9A 1ZKYA 1SR7A 2H77A 3CQVA 3FURA 3OLLA 4POHA 4LNWA 4OKTA 4NY9A 1KKQA 2F4BA 4IV4A 4MGDA 1YOKA 1FM9D 5DXQA 3FC6A 3VSOA 4RAKA 5KRMA 1TXIA 3GD2A 5AAVB 3AZ2A 2I4PA 3CS4A 4ZNTA 2YJAB 4N1YA 3G0WA 3P0UA 4PPSA 5KCEA 1A52A 1G5YA 3ILZA 4ZNUA 1X7EA 3ADUA 1XDKB 2XYXA 1FCZA 2ZK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X76 A;  1XNX A;  4LBD A;  1OT7 A;  1XQC A;  4IWF A;  2Z4B A;  1Q4X A;  2PIW A;  5DXG A;  4G2H A;  1T63 A;  3WJ5 A;  1PK5 A;  4IA3 A;  3OOK A;  4WHF A;  5JJM B;  1X78 A;  1FM6 D;  1T5Z A;  1T74 A;  5AVI A;  2P7Z A;  2P54 A;  4HLW A;  1P8D A;  3ADV A;  4CI5 A;  1SKX A;  3A9E A;  3G8I A;  1K74 D;  3DZU D;  2G5O A;  2I4J A;  2FSZ A;  1KNU A;  3BC5 A;  4OEA A;  3L1B A;  4DM8 A;  1EXA A;  2Q5G A;  4F9M A;  3A40 X;  2AA6 A;  1Z95 A;  3BQD A;  3GN8 A;  1FCY A;  3F5C A;  4OZR U;  4IV2 A;  4XAO A;  5L7H A;  5LWP A;  3IPQ A;  1YJE A;  2QZO A;  4XHD A;  1XPC A;  5FQV A;  3DZY D;  3AUR A;  3OGT A;  4O8F A;  4Q50 A;  5HCV A;  5KCD A;  3HLV A;  3V3E A;  3IMY A;  2HWQ A;  2GIU A;  4RE8 A;  3B67 A;  3OMK A;  5KRK A;  4ZNW A;  1N4H A;  2Q60 A;  2Q7K A;  3G9E A;  5EC9 A;  4ZI1 A;  3R29 A;  5DXP A;  3PO9 A;  3FXV A;  2I4Z A;  3R5N A;  2PIV A;  3ET0 A;  3UUC A;  2POB A;  4PP3 A;  4TV1 A;  3V4A A;  3OS9 A;  4S0S A;  3OLF A;  2FAI A;  2QNV A;  3GZ9 A;  2Q6S A;  4RMC A;  2O4R A;  5G46 A;  2POG A;  2GPP A;  3WJ4 A;  2ZK3 A;  5DWI A;  4DQM A;  3OMM A;  3OMQ A;  1ZAF A;  5DKG A;  1FM9 A;  2VST A;  4LSJ A;  2OVM A;  3B65 A;  1OVL B;  5DZ1 A;  4IQR A;  1ZDU A;  3PCU A;  3UP3 A;  2GWX A;  3KMR A;  5A86 A;  4MGB B;  3B0W A;  4OKW A;  5L11 A;  3UU7 A;  5KRL A;  1Y0S A;  2FVJ A;  4XUM A;  1I7I A;  4IU7 A;  2QR9 A;  3VRV A;  1XQ3 A;  3R2A A;  2AO6 A;  1LBD A;  2AA7 A;  3CDP A;  3NSP A;  4EMA A;  4Q0A C;  1QKN A;  3UUA B;  4FGY A;  2G44 A;  3PEQ A;  1OSH A;  4TUZ B;  5HJP A;  4J24 A;  1FM6 A;  4IA1 A;  3B0R A;  4DOR A;  2J4A A;  5DXB B;  1T73 A;  3W0I A;  4ITE A;  2GL8 A;  1DB1 A;  5F9B A;  2PJL A;  4A4V A;  4ONI A;  1K74 A;  2Q7I A;  3OZ0 A;  5H1E A;  3DZU A;  4RZE A;  3CLD A;  3RY9 A;  2QTU A;  3RUT A;  1FCX A;  4OEZ A;  2VSR A;  2R6Y A;  3LBD A;  4DMA A;  5K13 A;  1YIN A;  2JF9 A;  3L0J A;  1L2I A;  2ZK5 A;  4RME A;  4RZG A;  3ZR7 A;  4L96 A;  1S19 A;  1K4W A;  5E1C A;  4A4W A;  2PIX A;  3DZY A;  4LTW A;  1K7L A;  1Y0X X;  2GPU A;  2BJ4 B;  3VJI A;  3WT6 A;  5EI1 A;  2ZXN A;  4FHH A;  3H0A D;  4G20 A;  3WFF A;  1N46 A;  4OGH A;  1XVP B;  5DRM A;  4JYH A;  3IA6 A;  5DV3 A;  3VJH A;  3W0H A;  1RKG A;  2Q70 A;  2VV4 B;  2P4Y A;  4MG9 A;  1OSV A;  1XB7 A;  2P1V A;  4RZF A;  4RWV A;  3B66 A;  5DID A;  5KRO A;  3SP6 A;  3VRW A;  3UUD B;  3PBA A;  1WM0 X;  5DK9 A;  2NXX A;  3IPS A;  3R8A A;  3W0J A;  4OIL A;  3FUG A;  4OH6 A;  1UHL B;  2HWR A;  4S15 A;  3VRU A;  3VHU A;  4BCR A;  5KR9 A;  3OMO A;  4POJ A;  5AZT A;  1I7G A;  4UDD A;  3VT7 A;  4KZI A;  3D90 A;  4E4K A;  2J7X A;  2P15 A;  4ITF A;  2GP7 A;  3L3Z A;  3GYU A;  4OJB A;  2J7Y A;  1U3Q A;  5HJS A;  2ZK0 A;  2JFA A;  1QKM A;  5DKB A;  3F7D A;  1NRL A;  3CTB A;  4XI3 A;  1PZL A;  4PLE A;  1BSX A;  4MG8 B;  2Q7L A;  3AN4 A;  3Q95 A;  5G44 A;  3RLJ A;  1XV9 A;  1S0Z A;  2HC4 A;  2PKL A;  2BAW A;  3OKI A;  3ADS A;  3VT5 A;  4MG7 B;  5C4S A;  2YFE A;  1ILH A;  1T7F A;  2HCD A;  2Q1H A;  4JGV A;  5DP0 A;  4YT1 A;  2PRG A;  5DX3 A;  4CSJ A;  3WGP A;  1ILG A;  5DMF A;  3AN3 A;  2ZL9 A;  3KDU A;  2QMV A;  3KBA A;  3CWD A;  1Y9R A;  3D5F A;  3K6P A;  4RMD A;  3RVF A;  1TFC A;  2PIO A;  3DCU A;  4RUO X;  5E0X A;  4OJ4 A;  3OMP A;  2NW4 A;  4IUI A;  1YYE A;  4OFR A;  3D57 A;  1T65 A;  1YUC A;  3VT4 A;  2AM9 A;  1DKF A;  3V9Y A;  1IE8 A;  3UVV B;  5L7G A;  5DVC A;  1GWX A;  1ZDT A;  2Q1V A;  2QA8 B;  5EHJ A;  4ZN7 A;  3OLS A;  2B1V A;  3X1H A;  3FEJ A;  4ZO1 B;  1SJ0 A;  3GYT A;  3KFC A;  1E3K A;  1YA3 A;  4OHA A;  3W5P A;  5KRC A;  5G3J A;  2P7A A;  4MGD B;  3HZF A;  3D6D A;  4NB6 A;  4MG5 A;  3VN2 A;  3FC6 B;  3VT9 A;  1FBY A;  1S9Q A;  3FAL A;  3H0A A;  3VT6 A;  3ERD A;  2H79 A;  4XLD A;  4FHI A;  2YLQ A;  2YJD A;  4OJ9 A;  4OIU A;  5G43 A;  3ET1 A;  2Q59 A;  4PP6 A;  1GWR A;  4UDC A;  5ETH A;  2LBD A;  5DL4 A;  2AYR A;  4OZT E;  2J14 A;  2QW4 A;  5AK2 A;  4PVU A;  3W0C A;  2AB2 A;  2HAM A;  3ZRB A;  3X36 A;  5FQS A;  4WLB A;  1XP9 A;  2JJ3 A;  2PIR A;  4OZR E;  2QA6 A;  2ZMI A;  3KWY A;  4N73 A;  4QL8 A;  4PXM A;  1NDE A;  2QGT A;  2ZBS A;  4MGA A;  2HAS A;  2ZXM A;  3K8S A;  3SZ1 A;  2PNU A;  3A9E B;  5M96 A;  3TY0 A;  4APU A;  1S9P A;  2EWP A;  1Z5X E;  3B5R A;  3CS6 A;  5AVL A;  3F5C B;  1M7W A;  3W0Y A;  3GBK A;  3VTB A;  4ZNV A;  4JYI A;  2IOG A;  2QZO B;  1MV9 A;  3ET3 A;  3OZJ A;  1R5K A;  2ZAS A;  1UPV A;  2G0G A;  4QE8 A;  3TX7 B;  2QE4 A;  3B0T A;  2XHS A;  3WT5 A;  5SYZ A;  4DK7 A;  5E14 A;  2QGW A;  2ABI A;  3IXP D;  1HJ1 A;  1N83 A;  2Q5S A;  3HO0 A;  1EXX A;  5KCF A;  4J5X A;  1GWQ A;  2QXM A;  4G1D A;  2ZFX A;  2ZKC A;  1HG4 A;  3KDT A;  3E94 A;  4ZJW A;  3RLL A;  2ZNP A;  3ZQT A;  4ZJR A;  4TV1 B;  5G5W A;  3IPU A;  3V9V A;  5B41 A;  4S0T A;  5EIT A;  3W5T A;  2V0V A;  1R20 D;  4YNK A;  5GIC A;  3VHW A;  4KZM A;  2OM9 A;  2AMB A;  2ZK1 A;  5GIE A;  5GID A;  3W0G A;  3K22 A;  3KYT A;  1A28 A;  5JY3 A;  2QPY A;  2R40 D;  3ADT A;  2PIP L;  1NAX A;  5AYG A;  4PRG A;  3NSQ A;  2ATH A;  3X31 A;  2ZK4 A;  3ADX A;  3P89 A;  3WFG A;  4PP5 A;  2ZVT A;  3L03 A;  5IAW A;  5FQR A;  1NQ2 A;  3R5M A;  3UU7 B;  3KPZ A;  3M7R A;  4R6S A;  2VV2 A;  2NXX E;  5DWG A;  3JZB A;  4OK1 A;  5DMC A;  4R2U A;  3A2H A;  1ZUC A;  4UDA A;  4UDB A;  3A2J A;  2Q3Y A;  3CDS A;  2ACL A;  5DUH A;  1ERR A;  5G42 A;  5DV6 A;  5DIG A;  3RUU A;  5HJP B;  1RDT D;  2Q5P A;  3AZ1 A;  2P7G A;  2Q6J A;  4OKX A;  5EJV A;  2Z4J A;  2VV3 A;  4WVD A;  2VV0 A;  5DZ0 A;  3BEJ A;  3JZC A;  3QT0 A;  2VV1 A;  3GWX A;  4RUJ A;  1M13 A;  2B50 A;  4B7W A;  1YY4 A;  1ERE A;  3A78 A;  1LV2 A;  1PQ9 A;  5ACC A;  2QXS A;  4IA7 A;  2HB8 A;  3HOD A;  1L2J A;  1NHZ A;  5APH A;  5DWL A;  2AA2 A;  5DTV A;  1T7M A;  1YP0 A;  3OAP A;  1E3G A;  4P6W A;  2P1U A;  3K23 A;  2YLO A;  5DZH A;  5AAV A;  1G50 A;  4ZOM A;  2IOK A;  1U9E A;  4NUF A;  3IXP A;  5DUG A;  5ICK A;  3B1M A;  3WTQ A;  3AUQ A;  4YMQ A;  3N00 A;  4X1F A;  5DI7 A;  3HM1 A;  4MG9 B;  1XZX X;  1XDK A;  2O4J A;  5KYA A;  5EGV A;  2YLY A;  3P88 A;  4G21 A;  3NOA A;  3UP0 A;  3E00 D;  2Q61 A;  3R8I A;  3KMZ A;  4OLM A;  3HQ5 A;  4YPQ A;  5KRF A;  1R20 A;  3A2I A;  3DCT A;  3KMG A;  2I0G A;  5DZI A;  1RJK A;  4XTA A;  3ZRA A;  1X7R A;  2ZMJ A;  5LGA A;  5DKE A;  4J5W A;  3VTD A;  2R40 A;  1I37 A;  5DY8 A;  2OUZ A;  2GTK A;  3E7C A;  5DXK A;  1X7B A;  1XOW A;  4J5X C;  4K7A A;  2JFA B;  3MNO A;  4KZJ A;  1NUO A;  4NIE A;  4Q13 A;  4QE6 A;  2OZ7 A;  4JYG A;  4E2J A;  5DSH A;  4N8R A;  4RFW A;  4NQA B;  4OKB A;  5KRJ A;  3Q95 B;  4IWC A;  3G8O A;  1XV9 B;  1S0X A;  4E4Q A;  1R6G A;  1MZN A;  3A3Z X;  3LMP A;  2ZNN A;  5FQP A;  3T03 A;  3U9Q A;  4FNE A;  3OS8 C;  1UOM A;  5DX3 B;  3D24 A;  3FLI A;  2PIU A;  3ERT A;  5AWK A;  2AA5 A;  5FQT A;  5KCW A;  4OFU A;  4WPF A;  5APJ A;  5DUE A;  4M8H A;  5AZV A;  1RDT A;  4IA2 A;  4FN9 A;  1QKU A;  3DR1 A;  1MVC A;  2NV7 A;  3VT8 A;  3FEI A;  5KRI A;  2HVC A;  5E7V A;  4JAZ A;  4R06 A;  5DWJ A;  2E2R A;  5DXE A;  2PIQ A;  5AWJ A;  4EM9 A;  5DLR A;  4K4J A;  5APK A;  2HBH A;  1DKF B;  5E0W A;  4OZT U;  5G45 A;  5KD9 A;  4DM6 A;  3MNP A;  5HYK A;  1PQ6 A;  1RK3 A;  2HFP A;  4Y29 A;  4QK4 A;  4OED A;  3L0L A;  2B1Z A;  3OSA A;  3WMH A;  3MNE A;  2XYW A;  2HAR A;  4J26 A;  1XLS E;  1OVL A;  3OOF A;  4M8E A;  3FAL B;  3TKC A;  1YIM A;  1NAV A;  4MGB A;  1QKT A;  1NQ7 A;  5KYJ A;  4G1Z A;  1Z5X U;  1ZGY A;  2AXA A;  2AX7 A;  3L3X A;  5DRJ A;  5GT4 A;  4OEY A;  1XLS A;  3VHV A;  1G1U A;  2Q59 B;  2IHQ A;  3E00 A;  3R8D A;  2GPO A;  3UUA A;  4A2J A;  1P93 A;  2AX8 A;  3B3K A;  3V9T A;  3VRT A;  5DIE A;  5KCT A;  2XKW A;  3L0E A;  5DVV A;  4TUZ A;  2NPA A;  1U3S A;  2PIT A;  5DU5 A;  4PF3 A;  3H52 A;  1T7T A;  3HC5 A;  3ET2 A;  4S14 A;  4REE A;  4MGA B;  5DXB A;  4DOS A;  1XIU A;  5DZ3 A;  1ZH7 A;  1T79 A;  3HC6 A;  2QSE A;  4OH5 A;  1YMT A;  2G0H A;  1FD0 A;  2R6W A;  3VSP A;  2A3I A;  3VJS A;  4DK8 A;  3B68 A;  3OS8 A;  5DVS A;  3W0A A;  1R1K D;  4MGC A;  4P6X A;  3VT3 A;  5AAU A;  4MG6 A;  3GWS X;  1SQN A;  4N5G A;  4IS8 A;  2BJ4 A;  5C4T A;  4QJR A;  2ZNO A;  3EYB A;  3O1D A;  3VJT A;  2AX6 A;  2YAT A;  1PCG A;  2I0J A;  3OKH A;  4J5W C;  2AMA A;  4PWL A;  5JI0 D;  2ZK2 A;  1XVP A;  4OAR A;  5KRH A;  4QM0 A;  3V49 A;  2VV4 A;  2Q8S A;  4CI4 A;  3S9S A;  1XNN A;  3DT3 A;  4ZNS A;  5IZ0 A;  3UUD A;  4MDD A;  4ZN9 A;  2O9I A;  1H9U A;  4ZNH A;  3W5R A;  4X1G A;  5HZC A;  1NQ0 A;  3TKM A;  4L98 A;  3AX8 A;  5IXK A;  1I38 A;  1UHL A;  4G1Y A;  2B23 A;  3V3Q A;  3CJW A;  5HYR A;  4WHG A;  5DKS A;  5E19 A;  3VTC A;  5KCC A;  1G2N A;  2OVH A;  2ZMH A;  3CS8 A;  2ZLC A;  4G2I A;  4IVY A;  2YLP A;  2QAB A;  3AZ3 A;  2GPV A;  2ZY0 A;  4PPP A;  1U3R A;  4XUH A;  1VJB A;  4HEE X;  4OIV A;  2W8Y A;  4ZO1 X;  5DYB A;  5DV8 A;  4IW6 A;  5L7E A;  1RKH A;  2XYJ A;  2HB7 A;  5KRA A;  3X1I A;  4MG8 A;  1PRG A;  2REW A;  2AAX A;  1T76 A;  2ZXZ A;  5DXR A;  5E15 A;  5B5B A;  5I4V A;  1YOW A;  4MG7 A;  4IW8 A;  2Q6R A;  1ZEO A;  2YHD A;  3OSI A;  3HVL A;  3ADW A;  4OC7 A;  4RUP A;  1X7J A;  3PRG A;  2QH6 A;  2ZLA A;  3B0Q A;  1XP1 A;  2V7C A;  1PDU A;  3AFR A;  5C4U A;  3VI8 A;  1UPW A;  3W5Q A;  1NYX A;  3PLZ A;  5KCU A;  1XAP A;  2ACL B;  4PLD A;  3WT7 A;  2P1T A;  5CJ6 A;  2AWH A;  2OAX A;  1KV6 A;  3AUN A;  1PQC A;  2AX9 A;  2Q7J A;  4WQP A;  4JL4 A;  5DXM A;  5C4O A;  4K6I A;  1XJ7 A;  3OSW A;  4XT9 A;  3FS1 A;  1T7R A;  2OCF A;  5DWE A;  3WWR A;  3P8X A;  4LNX A;  1XP6 A;  3UVV A;  1M2Z A;  4IVW A;  3DY6 A;  2PIN A;  2QA8 A;  2VV1 B;  3O1E A;  5JJM A;  4REF A;  1R1K A;  2ZNQ A;  5DYD A;  1IE9 A;  1NQ1 A;  1GS4 A;  3SP9 A;  1ZKY A;  1SR7 A;  2H77 A;  3CQV A;  3FUR A;  3OLL A;  4POH A;  4LNW A;  4OKT A;  4NY9 A;  1KKQ A;  2F4B A;  4IV4 A;  4MGD A;  1YOK A;  1FM9 D;  5DXQ A;  3FC6 A;  3VSO A;  4RAK A;  5KRM A;  1TXI A;  3GD2 A;  5AAV B;  3AZ2 A;  2I4P A;  3CS4 A;  4ZNT A;  2YJA B;  4N1Y A;  3G0W A;  3P0U A;  4PPS A;  5KCE A;  1A52 A;  1G5Y A;  3ILZ A;  4ZNU A;  1X7E A;  3ADU A;  1XDK B;  2XYX A;  1FCZ A;  2ZK6 A; 
#chains in the Genus database with same CATH topology
 1X76 A;  1XNX A;  4LBD A;  1OT7 A;  1XQC A;  4IWF A;  2Z4B A;  1Q4X A;  2PIW A;  5DXG A;  4G2H A;  1T63 A;  3WJ5 A;  1PK5 A;  4IA3 A;  3OOK A;  4WHF A;  5JJM B;  1X78 A;  1FM6 D;  1T5Z A;  1T74 A;  5AVI A;  2P7Z A;  2P54 A;  4HLW A;  1P8D A;  3ADV A;  4CI5 A;  1SKX A;  3A9E A;  3G8I A;  1K74 D;  3DZU D;  2G5O A;  2I4J A;  2FSZ A;  1KNU A;  3BC5 A;  4OEA A;  3L1B A;  4DM8 A;  1EXA A;  2Q5G A;  4F9M A;  3A40 X;  2AA6 A;  1Z95 A;  3BQD A;  3GN8 A;  1FCY A;  3F5C A;  4OZR U;  4IV2 A;  4XAO A;  5L7H A;  5LWP A;  3IPQ A;  1YJE A;  2QZO A;  4XHD A;  1XPC A;  5FQV A;  3DZY D;  3AUR A;  3OGT A;  4O8F A;  4Q50 A;  5HCV A;  5KCD A;  3HLV A;  3V3E A;  3IMY A;  2HWQ A;  2GIU A;  4RE8 A;  3B67 A;  3OMK A;  5KRK A;  4ZNW A;  1N4H A;  2Q60 A;  2Q7K A;  3G9E A;  5EC9 A;  4ZI1 A;  3R29 A;  5DXP A;  3PO9 A;  3FXV A;  2I4Z A;  3R5N A;  2PIV A;  3ET0 A;  3UUC A;  2POB A;  4PP3 A;  4TV1 A;  3V4A A;  3OS9 A;  4S0S A;  3OLF A;  2FAI A;  2QNV A;  3GZ9 A;  2Q6S A;  4RMC A;  2O4R A;  5G46 A;  2POG A;  2GPP A;  3WJ4 A;  2ZK3 A;  5DWI A;  4DQM A;  3OMM A;  3OMQ A;  1ZAF A;  5DKG A;  1FM9 A;  2VST A;  4LSJ A;  2OVM A;  3B65 A;  1OVL B;  5DZ1 A;  4IQR A;  1ZDU A;  3PCU A;  3UP3 A;  2GWX A;  3KMR A;  5A86 A;  4MGB B;  3B0W A;  4OKW A;  5L11 A;  3UU7 A;  5KRL A;  1Y0S A;  2FVJ A;  4XUM A;  1I7I A;  4IU7 A;  2QR9 A;  3VRV A;  1XQ3 A;  3R2A A;  2AO6 A;  1LBD A;  2AA7 A;  3CDP A;  3NSP A;  4EMA A;  4Q0A C;  1QKN A;  3UUA B;  4FGY A;  2G44 A;  3PEQ A;  1OSH A;  4TUZ B;  5HJP A;  4J24 A;  1FM6 A;  4IA1 A;  3B0R A;  4DOR A;  2J4A A;  5DXB B;  1T73 A;  3W0I A;  4ITE A;  2GL8 A;  1DB1 A;  5F9B A;  2PJL A;  4A4V A;  4ONI A;  1K74 A;  2Q7I A;  3OZ0 A;  5H1E A;  3DZU A;  4RZE A;  3CLD A;  3RY9 A;  2QTU A;  3RUT A;  1FCX A;  4OEZ A;  2VSR A;  2R6Y A;  3LBD A;  4DMA A;  5K13 A;  1YIN A;  2JF9 A;  3L0J A;  1L2I A;  2ZK5 A;  4RME A;  4RZG A;  3ZR7 A;  4L96 A;  1S19 A;  1K4W A;  5E1C A;  4A4W A;  2PIX A;  3DZY A;  4LTW A;  1K7L A;  1Y0X X;  2GPU A;  2BJ4 B;  3VJI A;  3WT6 A;  5EI1 A;  2ZXN A;  4FHH A;  3H0A D;  4G20 A;  3WFF A;  1N46 A;  4OGH A;  1XVP B;  5DRM A;  4JYH A;  3IA6 A;  5DV3 A;  3VJH A;  3W0H A;  1RKG A;  2Q70 A;  2VV4 B;  2P4Y A;  4MG9 A;  1OSV A;  1XB7 A;  2P1V A;  4RZF A;  4RWV A;  3B66 A;  5DID A;  5KRO A;  3SP6 A;  3VRW A;  3UUD B;  3PBA A;  1WM0 X;  5DK9 A;  2NXX A;  3IPS A;  3R8A A;  3W0J A;  4OIL A;  3FUG A;  4OH6 A;  1UHL B;  2HWR A;  4S15 A;  3VRU A;  3VHU A;  4BCR A;  5KR9 A;  3OMO A;  4POJ A;  5AZT A;  1I7G A;  4UDD A;  3VT7 A;  4KZI A;  3D90 A;  4E4K A;  2J7X A;  2P15 A;  4ITF A;  2GP7 A;  3L3Z A;  3GYU A;  4OJB A;  2J7Y A;  1U3Q A;  5HJS A;  2ZK0 A;  2JFA A;  1QKM A;  5DKB A;  3F7D A;  1NRL A;  3CTB A;  4XI3 A;  1PZL A;  4PLE A;  1BSX A;  4MG8 B;  2Q7L A;  3AN4 A;  3Q95 A;  5G44 A;  3RLJ A;  1XV9 A;  1S0Z A;  2HC4 A;  2PKL A;  2BAW A;  3OKI A;  3ADS A;  3VT5 A;  4MG7 B;  5C4S A;  2YFE A;  1ILH A;  1T7F A;  2HCD A;  2Q1H A;  4JGV A;  5DP0 A;  4YT1 A;  2PRG A;  5DX3 A;  4CSJ A;  3WGP A;  1ILG A;  5DMF A;  3AN3 A;  2ZL9 A;  3KDU A;  2QMV A;  3KBA A;  3CWD A;  1Y9R A;  3D5F A;  3K6P A;  4RMD A;  3RVF A;  1TFC A;  2PIO A;  3DCU A;  4RUO X;  5E0X A;  4OJ4 A;  3OMP A;  2NW4 A;  4IUI A;  1YYE A;  4OFR A;  3D57 A;  1T65 A;  1YUC A;  3VT4 A;  2AM9 A;  1DKF A;  3V9Y A;  1IE8 A;  3UVV B;  5L7G A;  5DVC A;  1GWX A;  1ZDT A;  2Q1V A;  2QA8 B;  5EHJ A;  4ZN7 A;  3OLS A;  2B1V A;  3X1H A;  3FEJ A;  4ZO1 B;  1SJ0 A;  3GYT A;  3KFC A;  1E3K A;  1YA3 A;  4OHA A;  3W5P A;  5KRC A;  5G3J A;  2P7A A;  4MGD B;  3HZF A;  3D6D A;  4NB6 A;  4MG5 A;  3VN2 A;  3FC6 B;  3VT9 A;  1FBY A;  1S9Q A;  3FAL A;  3H0A A;  3VT6 A;  3ERD A;  2H79 A;  4XLD A;  4FHI A;  2YLQ A;  2YJD A;  4OJ9 A;  4OIU A;  5G43 A;  3ET1 A;  2Q59 A;  4PP6 A;  1GWR A;  4UDC A;  5ETH A;  2LBD A;  5DL4 A;  2AYR A;  4OZT E;  2J14 A;  2QW4 A;  5AK2 A;  4PVU A;  3W0C A;  2AB2 A;  2HAM A;  3ZRB A;  3X36 A;  5FQS A;  4WLB A;  1XP9 A;  2JJ3 A;  2PIR A;  4OZR E;  2QA6 A;  2ZMI A;  3KWY A;  4N73 A;  4QL8 A;  4PXM A;  1NDE A;  2QGT A;  2ZBS A;  4MGA A;  2HAS A;  2ZXM A;  3K8S A;  3SZ1 A;  2PNU A;  3A9E B;  5M96 A;  3TY0 A;  4APU A;  1S9P A;  2EWP A;  1Z5X E;  3B5R A;  3CS6 A;  5AVL A;  3F5C B;  1M7W A;  3W0Y A;  3GBK A;  3VTB A;  4ZNV A;  4JYI A;  2IOG A;  2QZO B;  1MV9 A;  3ET3 A;  3OZJ A;  1R5K A;  2ZAS A;  1UPV A;  2G0G A;  4QE8 A;  3TX7 B;  2QE4 A;  3B0T A;  2XHS A;  3WT5 A;  5SYZ A;  4DK7 A;  5E14 A;  2QGW A;  2ABI A;  3IXP D;  1HJ1 A;  1N83 A;  2Q5S A;  3HO0 A;  1EXX A;  5KCF A;  4J5X A;  1GWQ A;  2QXM A;  4G1D A;  2ZFX A;  2ZKC A;  1HG4 A;  3KDT A;  3E94 A;  4ZJW A;  3RLL A;  2ZNP A;  3ZQT A;  4ZJR A;  4TV1 B;  5G5W A;  3IPU A;  3V9V A;  5B41 A;  4S0T A;  5EIT A;  3W5T A;  2V0V A;  1R20 D;  4YNK A;  5GIC A;  3VHW A;  4KZM A;  2OM9 A;  2AMB A;  2ZK1 A;  5GIE A;  5GID A;  3W0G A;  3K22 A;  3KYT A;  1A28 A;  5JY3 A;  2QPY A;  2R40 D;  3ADT A;  2PIP L;  1NAX A;  5AYG A;  4PRG A;  3NSQ A;  2ATH A;  3X31 A;  2ZK4 A;  3ADX A;  3P89 A;  3WFG A;  4PP5 A;  2ZVT A;  3L03 A;  5IAW A;  5FQR A;  1NQ2 A;  3R5M A;  3UU7 B;  3KPZ A;  3M7R A;  4R6S A;  2VV2 A;  2NXX E;  5DWG A;  3JZB A;  4OK1 A;  5DMC A;  4R2U A;  3A2H A;  1ZUC A;  4UDA A;  4UDB A;  3A2J A;  2Q3Y A;  3CDS A;  2ACL A;  5DUH A;  1ERR A;  5G42 A;  5DV6 A;  5DIG A;  3RUU A;  5HJP B;  1RDT D;  2Q5P A;  3AZ1 A;  2P7G A;  2Q6J A;  4OKX A;  5EJV A;  2Z4J A;  2VV3 A;  4WVD A;  2VV0 A;  5DZ0 A;  3BEJ A;  3JZC A;  3QT0 A;  2VV1 A;  3GWX A;  4RUJ A;  1M13 A;  2B50 A;  4B7W A;  1YY4 A;  1ERE A;  3A78 A;  1LV2 A;  1PQ9 A;  5ACC A;  2QXS A;  4IA7 A;  2HB8 A;  3HOD A;  1L2J A;  1NHZ A;  5APH A;  5DWL A;  2AA2 A;  5DTV A;  1T7M A;  1YP0 A;  3OAP A;  1E3G A;  4P6W A;  2P1U A;  3K23 A;  2YLO A;  5DZH A;  5AAV A;  1G50 A;  4ZOM A;  2IOK A;  1U9E A;  4NUF A;  3IXP A;  5DUG A;  5ICK A;  3B1M A;  3WTQ A;  3AUQ A;  4YMQ A;  3N00 A;  4X1F A;  5DI7 A;  3HM1 A;  4MG9 B;  1XZX X;  1XDK A;  2O4J A;  5KYA A;  5EGV A;  2YLY A;  3P88 A;  4G21 A;  3NOA A;  3UP0 A;  3E00 D;  2Q61 A;  3R8I A;  3KMZ A;  4OLM A;  3HQ5 A;  4YPQ A;  5KRF A;  1R20 A;  3A2I A;  3DCT A;  3KMG A;  2I0G A;  5DZI A;  1RJK A;  4XTA A;  3ZRA A;  1X7R A;  2ZMJ A;  5LGA A;  5DKE A;  4J5W A;  3VTD A;  2R40 A;  1I37 A;  5DY8 A;  2OUZ A;  2GTK A;  3E7C A;  5DXK A;  1X7B A;  1XOW A;  4J5X C;  4K7A A;  2JFA B;  3MNO A;  4KZJ A;  1NUO A;  4NIE A;  4Q13 A;  4QE6 A;  2OZ7 A;  4JYG A;  4E2J A;  5DSH A;  4N8R A;  4RFW A;  4NQA B;  4OKB A;  5KRJ A;  3Q95 B;  4IWC A;  3G8O A;  1XV9 B;  1S0X A;  4E4Q A;  1R6G A;  1MZN A;  3A3Z X;  3LMP A;  2ZNN A;  5FQP A;  3T03 A;  3U9Q A;  4FNE A;  3OS8 C;  1UOM A;  5DX3 B;  3D24 A;  3FLI A;  2PIU A;  3ERT A;  5AWK A;  2AA5 A;  5FQT A;  5KCW A;  4OFU A;  4WPF A;  5APJ A;  5DUE A;  4M8H A;  5AZV A;  1RDT A;  4IA2 A;  4FN9 A;  1QKU A;  3DR1 A;  1MVC A;  2NV7 A;  3VT8 A;  3FEI A;  5KRI A;  2HVC A;  5E7V A;  4JAZ A;  4R06 A;  5DWJ A;  2E2R A;  5DXE A;  2PIQ A;  5AWJ A;  4EM9 A;  5DLR A;  4K4J A;  5APK A;  2HBH A;  1DKF B;  5E0W A;  4OZT U;  5G45 A;  5KD9 A;  4DM6 A;  3MNP A;  5HYK A;  1PQ6 A;  1RK3 A;  2HFP A;  4Y29 A;  4QK4 A;  4OED A;  3L0L A;  2B1Z A;  3OSA A;  3WMH A;  3MNE A;  2XYW A;  2HAR A;  4J26 A;  1XLS E;  1OVL A;  3OOF A;  4M8E A;  3FAL B;  3TKC A;  1YIM A;  1NAV A;  4MGB A;  1QKT A;  1NQ7 A;  5KYJ A;  4G1Z A;  1Z5X U;  1ZGY A;  2AXA A;  2AX7 A;  3L3X A;  5DRJ A;  5GT4 A;  4OEY A;  1XLS A;  3VHV A;  1G1U A;  2Q59 B;  2IHQ A;  3E00 A;  3R8D A;  2GPO A;  3UUA A;  4A2J A;  1P93 A;  2AX8 A;  3B3K A;  3V9T A;  3VRT A;  5DIE A;  5KCT A;  2XKW A;  3L0E A;  5DVV A;  4TUZ A;  2NPA A;  1U3S A;  2PIT A;  5DU5 A;  4PF3 A;  3H52 A;  1T7T A;  3HC5 A;  3ET2 A;  4S14 A;  4REE A;  4MGA B;  5DXB A;  4DOS A;  1XIU A;  5DZ3 A;  1ZH7 A;  1T79 A;  3HC6 A;  2QSE A;  4OH5 A;  1YMT A;  2G0H A;  1FD0 A;  2R6W A;  3VSP A;  2A3I A;  3VJS A;  4DK8 A;  3B68 A;  3OS8 A;  5DVS A;  3W0A A;  1R1K D;  4MGC A;  4P6X A;  3VT3 A;  5AAU A;  4MG6 A;  3GWS X;  1SQN A;  4N5G A;  4IS8 A;  2BJ4 A;  5C4T A;  4QJR A;  2ZNO A;  3EYB A;  3O1D A;  3VJT A;  2AX6 A;  2YAT A;  1PCG A;  2I0J A;  3OKH A;  4J5W C;  2AMA A;  4PWL A;  5JI0 D;  2ZK2 A;  1XVP A;  4OAR A;  5KRH A;  4QM0 A;  3V49 A;  2VV4 A;  2Q8S A;  4CI4 A;  3S9S A;  1XNN A;  3DT3 A;  4ZNS A;  5IZ0 A;  3UUD A;  4MDD A;  4ZN9 A;  2O9I A;  1H9U A;  4ZNH A;  3W5R A;  4X1G A;  5HZC A;  1NQ0 A;  3TKM A;  4L98 A;  3AX8 A;  5IXK A;  1I38 A;  1UHL A;  4G1Y A;  2B23 A;  3V3Q A;  3CJW A;  5HYR A;  4WHG A;  5DKS A;  5E19 A;  3VTC A;  5KCC A;  1G2N A;  2OVH A;  2ZMH A;  3CS8 A;  2ZLC A;  4G2I A;  4IVY A;  2YLP A;  2QAB A;  3AZ3 A;  2GPV A;  2ZY0 A;  4PPP A;  1U3R A;  4XUH A;  1VJB A;  4HEE X;  4OIV A;  2W8Y A;  4ZO1 X;  5DYB A;  5DV8 A;  4IW6 A;  5L7E A;  1RKH A;  2XYJ A;  2HB7 A;  5KRA A;  3X1I A;  4MG8 A;  1PRG A;  2REW A;  2AAX A;  1T76 A;  2ZXZ A;  5DXR A;  5E15 A;  5B5B A;  5I4V A;  1YOW A;  4MG7 A;  4IW8 A;  2Q6R A;  1ZEO A;  2YHD A;  3OSI A;  3HVL A;  3ADW A;  4OC7 A;  4RUP A;  1X7J A;  3PRG A;  2QH6 A;  2ZLA A;  3B0Q A;  1XP1 A;  2V7C A;  1PDU A;  3AFR A;  5C4U A;  3VI8 A;  1UPW A;  3W5Q A;  1NYX A;  3PLZ A;  5KCU A;  1XAP A;  2ACL B;  4PLD A;  3WT7 A;  2P1T A;  5CJ6 A;  2AWH A;  2OAX A;  1KV6 A;  3AUN A;  1PQC A;  2AX9 A;  2Q7J A;  4WQP A;  4JL4 A;  5DXM A;  5C4O A;  4K6I A;  1XJ7 A;  3OSW A;  4XT9 A;  3FS1 A;  1T7R A;  2OCF A;  5DWE A;  3WWR A;  3P8X A;  4LNX A;  1XP6 A;  3UVV A;  1M2Z A;  4IVW A;  3DY6 A;  2PIN A;  2QA8 A;  2VV1 B;  3O1E A;  5JJM A;  4REF A;  1R1K A;  2ZNQ A;  5DYD A;  1IE9 A;  1NQ1 A;  1GS4 A;  3SP9 A;  1ZKY A;  1SR7 A;  2H77 A;  3CQV A;  3FUR A;  3OLL A;  4POH A;  4LNW A;  4OKT A;  4NY9 A;  1KKQ A;  2F4B A;  4IV4 A;  4MGD A;  1YOK A;  1FM9 D;  5DXQ A;  3FC6 A;  3VSO A;  4RAK A;  5KRM A;  1TXI A;  3GD2 A;  5AAV B;  3AZ2 A;  2I4P A;  3CS4 A;  4ZNT A;  2YJA B;  4N1Y A;  3G0W A;  3P0U A;  4PPS A;  5KCE A;  1A52 A;  1G5Y A;  3ILZ A;  4ZNU A;  1X7E A;  3ADU A;  1XDK B;  2XYX A;  1FCZ A;  2ZK6 A; 
#chains in the Genus database with same CATH homology
 1X76 A;  1XNX A;  4LBD A;  1OT7 A;  1XQC A;  4IWF A;  2Z4B A;  1Q4X A;  2PIW A;  5DXG A;  4G2H A;  1T63 A;  3WJ5 A;  1PK5 A;  4IA3 A;  3OOK A;  4WHF A;  5JJM B;  1X78 A;  1FM6 D;  1T5Z A;  1T74 A;  5AVI A;  2P7Z A;  2P54 A;  4HLW A;  1P8D A;  3ADV A;  4CI5 A;  1SKX A;  3A9E A;  3G8I A;  1K74 D;  3DZU D;  2G5O A;  2I4J A;  2FSZ A;  1KNU A;  3BC5 A;  4OEA A;  3L1B A;  4DM8 A;  1EXA A;  2Q5G A;  4F9M A;  3A40 X;  2AA6 A;  1Z95 A;  3BQD A;  3GN8 A;  1FCY A;  3F5C A;  4OZR U;  4IV2 A;  4XAO A;  5L7H A;  5LWP A;  3IPQ A;  1YJE A;  2QZO A;  4XHD A;  1XPC A;  5FQV A;  3DZY D;  3AUR A;  3OGT A;  4O8F A;  4Q50 A;  5HCV A;  5KCD A;  3HLV A;  3V3E A;  3IMY A;  2HWQ A;  2GIU A;  4RE8 A;  3B67 A;  3OMK A;  5KRK A;  4ZNW A;  1N4H A;  2Q60 A;  2Q7K A;  3G9E A;  5EC9 A;  4ZI1 A;  3R29 A;  5DXP A;  3PO9 A;  3FXV A;  2I4Z A;  3R5N A;  2PIV A;  3ET0 A;  3UUC A;  2POB A;  4PP3 A;  4TV1 A;  3V4A A;  3OS9 A;  4S0S A;  3OLF A;  2FAI A;  2QNV A;  3GZ9 A;  2Q6S A;  4RMC A;  2O4R A;  5G46 A;  2POG A;  2GPP A;  3WJ4 A;  2ZK3 A;  5DWI A;  4DQM A;  3OMM A;  3OMQ A;  1ZAF A;  5DKG A;  1FM9 A;  2VST A;  4LSJ A;  2OVM A;  3B65 A;  1OVL B;  5DZ1 A;  4IQR A;  1ZDU A;  3PCU A;  3UP3 A;  2GWX A;  3KMR A;  5A86 A;  4MGB B;  3B0W A;  4OKW A;  5L11 A;  3UU7 A;  5KRL A;  1Y0S A;  2FVJ A;  4XUM A;  1I7I A;  4IU7 A;  2QR9 A;  3VRV A;  1XQ3 A;  3R2A A;  2AO6 A;  1LBD A;  2AA7 A;  3CDP A;  3NSP A;  4EMA A;  4Q0A C;  1QKN A;  3UUA B;  4FGY A;  2G44 A;  3PEQ A;  1OSH A;  4TUZ B;  5HJP A;  4J24 A;  1FM6 A;  4IA1 A;  3B0R A;  4DOR A;  2J4A A;  5DXB B;  1T73 A;  3W0I A;  4ITE A;  2GL8 A;  1DB1 A;  5F9B A;  2PJL A;  4A4V A;  4ONI A;  1K74 A;  2Q7I A;  3OZ0 A;  5H1E A;  3DZU A;  4RZE A;  3CLD A;  3RY9 A;  2QTU A;  3RUT A;  1FCX A;  4OEZ A;  2VSR A;  2R6Y A;  3LBD A;  4DMA A;  5K13 A;  1YIN A;  2JF9 A;  3L0J A;  1L2I A;  2ZK5 A;  4RME A;  4RZG A;  3ZR7 A;  4L96 A;  1S19 A;  1K4W A;  5E1C A;  4A4W A;  2PIX A;  3DZY A;  4LTW A;  1K7L A;  1Y0X X;  2GPU A;  2BJ4 B;  3VJI A;  3WT6 A;  5EI1 A;  2ZXN A;  4FHH A;  3H0A D;  4G20 A;  3WFF A;  1N46 A;  4OGH A;  1XVP B;  5DRM A;  4JYH A;  3IA6 A;  5DV3 A;  3VJH A;  3W0H A;  1RKG A;  2Q70 A;  2VV4 B;  2P4Y A;  4MG9 A;  1OSV A;  1XB7 A;  2P1V A;  4RZF A;  4RWV A;  3B66 A;  5DID A;  5KRO A;  3SP6 A;  3VRW A;  3UUD B;  3PBA A;  1WM0 X;  5DK9 A;  2NXX A;  3IPS A;  3R8A A;  3W0J A;  4OIL A;  3FUG A;  4OH6 A;  1UHL B;  2HWR A;  4S15 A;  3VRU A;  3VHU A;  4BCR A;  5KR9 A;  3OMO A;  4POJ A;  5AZT A;  1I7G A;  4UDD A;  3VT7 A;  4KZI A;  3D90 A;  4E4K A;  2J7X A;  2P15 A;  4ITF A;  2GP7 A;  3L3Z A;  3GYU A;  4OJB A;  2J7Y A;  1U3Q A;  5HJS A;  2ZK0 A;  2JFA A;  1QKM A;  5DKB A;  3F7D A;  1NRL A;  3CTB A;  4XI3 A;  1PZL A;  4PLE A;  1BSX A;  4MG8 B;  2Q7L A;  3AN4 A;  3Q95 A;  5G44 A;  3RLJ A;  1XV9 A;  1S0Z A;  2HC4 A;  2PKL A;  2BAW A;  3OKI A;  3ADS A;  3VT5 A;  4MG7 B;  5C4S A;  2YFE A;  1ILH A;  1T7F A;  2HCD A;  2Q1H A;  4JGV A;  5DP0 A;  4YT1 A;  2PRG A;  5DX3 A;  4CSJ A;  3WGP A;  1ILG A;  5DMF A;  3AN3 A;  2ZL9 A;  3KDU A;  2QMV A;  3KBA A;  3CWD A;  1Y9R A;  3D5F A;  3K6P A;  4RMD A;  3RVF A;  1TFC A;  2PIO A;  3DCU A;  4RUO X;  5E0X A;  4OJ4 A;  3OMP A;  2NW4 A;  4IUI A;  1YYE A;  4OFR A;  3D57 A;  1T65 A;  1YUC A;  3VT4 A;  2AM9 A;  1DKF A;  3V9Y A;  1IE8 A;  3UVV B;  5L7G A;  5DVC A;  1GWX A;  1ZDT A;  2Q1V A;  2QA8 B;  5EHJ A;  4ZN7 A;  3OLS A;  2B1V A;  3X1H A;  3FEJ A;  4ZO1 B;  1SJ0 A;  3GYT A;  3KFC A;  1E3K A;  1YA3 A;  4OHA A;  3W5P A;  5KRC A;  5G3J A;  2P7A A;  4MGD B;  3HZF A;  3D6D A;  4NB6 A;  4MG5 A;  3VN2 A;  3FC6 B;  3VT9 A;  1FBY A;  1S9Q A;  3FAL A;  3H0A A;  3VT6 A;  3ERD A;  2H79 A;  4XLD A;  4FHI A;  2YLQ A;  2YJD A;  4OJ9 A;  4OIU A;  5G43 A;  3ET1 A;  2Q59 A;  4PP6 A;  1GWR A;  4UDC A;  5ETH A;  2LBD A;  5DL4 A;  2AYR A;  4OZT E;  2J14 A;  2QW4 A;  5AK2 A;  4PVU A;  3W0C A;  2AB2 A;  2HAM A;  3ZRB A;  3X36 A;  5FQS A;  4WLB A;  1XP9 A;  2JJ3 A;  2PIR A;  4OZR E;  2QA6 A;  2ZMI A;  3KWY A;  4N73 A;  4QL8 A;  4PXM A;  1NDE A;  2QGT A;  2ZBS A;  4MGA A;  2HAS A;  2ZXM A;  3K8S A;  3SZ1 A;  2PNU A;  3A9E B;  5M96 A;  3TY0 A;  4APU A;  1S9P A;  2EWP A;  1Z5X E;  3B5R A;  3CS6 A;  5AVL A;  3F5C B;  1M7W A;  3W0Y A;  3GBK A;  3VTB A;  4ZNV A;  4JYI A;  2IOG A;  2QZO B;  1MV9 A;  3ET3 A;  3OZJ A;  1R5K A;  2ZAS A;  1UPV A;  2G0G A;  4QE8 A;  3TX7 B;  2QE4 A;  3B0T A;  2XHS A;  3WT5 A;  5SYZ A;  4DK7 A;  5E14 A;  2QGW A;  2ABI A;  3IXP D;  1HJ1 A;  1N83 A;  2Q5S A;  3HO0 A;  1EXX A;  5KCF A;  4J5X A;  1GWQ A;  2QXM A;  4G1D A;  2ZFX A;  2ZKC A;  1HG4 A;  3KDT A;  3E94 A;  4ZJW A;  3RLL A;  2ZNP A;  3ZQT A;  4ZJR A;  4TV1 B;  5G5W A;  3IPU A;  3V9V A;  5B41 A;  4S0T A;  5EIT A;  3W5T A;  2V0V A;  1R20 D;  4YNK A;  5GIC A;  3VHW A;  4KZM A;  2OM9 A;  2AMB A;  2ZK1 A;  5GIE A;  5GID A;  3W0G A;  3K22 A;  3KYT A;  1A28 A;  5JY3 A;  2QPY A;  2R40 D;  3ADT A;  2PIP L;  1NAX A;  5AYG A;  4PRG A;  3NSQ A;  2ATH A;  3X31 A;  2ZK4 A;  3ADX A;  3P89 A;  3WFG A;  4PP5 A;  2ZVT A;  3L03 A;  5IAW A;  5FQR A;  1NQ2 A;  3R5M A;  3UU7 B;  3KPZ A;  3M7R A;  4R6S A;  2VV2 A;  2NXX E;  5DWG A;  3JZB A;  4OK1 A;  5DMC A;  4R2U A;  3A2H A;  1ZUC A;  4UDA A;  4UDB A;  3A2J A;  2Q3Y A;  3CDS A;  2ACL A;  5DUH A;  1ERR A;  5G42 A;  5DV6 A;  5DIG A;  3RUU A;  5HJP B;  1RDT D;  2Q5P A;  3AZ1 A;  2P7G A;  2Q6J A;  4OKX A;  5EJV A;  2Z4J A;  2VV3 A;  4WVD A;  2VV0 A;  5DZ0 A;  3BEJ A;  3JZC A;  3QT0 A;  2VV1 A;  3GWX A;  4RUJ A;  1M13 A;  2B50 A;  4B7W A;  1YY4 A;  1ERE A;  3A78 A;  1LV2 A;  1PQ9 A;  5ACC A;  2QXS A;  4IA7 A;  2HB8 A;  3HOD A;  1L2J A;  1NHZ A;  5APH A;  5DWL A;  2AA2 A;  5DTV A;  1T7M A;  1YP0 A;  3OAP A;  1E3G A;  4P6W A;  2P1U A;  3K23 A;  2YLO A;  5DZH A;  5AAV A;  1G50 A;  4ZOM A;  2IOK A;  1U9E A;  4NUF A;  3IXP A;  5DUG A;  5ICK A;  3B1M A;  3WTQ A;  3AUQ A;  4YMQ A;  3N00 A;  4X1F A;  5DI7 A;  3HM1 A;  4MG9 B;  1XZX X;  1XDK A;  2O4J A;  5KYA A;  5EGV A;  2YLY A;  3P88 A;  4G21 A;  3NOA A;  3UP0 A;  3E00 D;  2Q61 A;  3R8I A;  3KMZ A;  4OLM A;  3HQ5 A;  4YPQ A;  5KRF A;  1R20 A;  3A2I A;  3DCT A;  3KMG A;  2I0G A;  5DZI A;  1RJK A;  4XTA A;  3ZRA A;  1X7R A;  2ZMJ A;  5LGA A;  5DKE A;  4J5W A;  3VTD A;  2R40 A;  1I37 A;  5DY8 A;  2OUZ A;  2GTK A;  3E7C A;  5DXK A;  1X7B A;  1XOW A;  4J5X C;  4K7A A;  2JFA B;  3MNO A;  4KZJ A;  1NUO A;  4NIE A;  4Q13 A;  4QE6 A;  2OZ7 A;  4JYG A;  4E2J A;  5DSH A;  4N8R A;  4RFW A;  4NQA B;  4OKB A;  5KRJ A;  3Q95 B;  4IWC A;  3G8O A;  1XV9 B;  1S0X A;  4E4Q A;  1R6G A;  1MZN A;  3A3Z X;  3LMP A;  2ZNN A;  5FQP A;  3T03 A;  3U9Q A;  4FNE A;  3OS8 C;  1UOM A;  5DX3 B;  3D24 A;  3FLI A;  2PIU A;  3ERT A;  5AWK A;  2AA5 A;  5FQT A;  5KCW A;  4OFU A;  4WPF A;  5APJ A;  5DUE A;  4M8H A;  5AZV A;  1RDT A;  4IA2 A;  4FN9 A;  1QKU A;  3DR1 A;  1MVC A;  2NV7 A;  3VT8 A;  3FEI A;  5KRI A;  2HVC A;  5E7V A;  4JAZ A;  4R06 A;  5DWJ A;  2E2R A;  5DXE A;  2PIQ A;  5AWJ A;  4EM9 A;  5DLR A;  4K4J A;  5APK A;  2HBH A;  1DKF B;  5E0W A;  4OZT U;  5G45 A;  5KD9 A;  4DM6 A;  3MNP A;  5HYK A;  1PQ6 A;  1RK3 A;  2HFP A;  4Y29 A;  4QK4 A;  4OED A;  3L0L A;  2B1Z A;  3OSA A;  3WMH A;  3MNE A;  2XYW A;  2HAR A;  4J26 A;  1XLS E;  1OVL A;  3OOF A;  4M8E A;  3FAL B;  3TKC A;  1YIM A;  1NAV A;  4MGB A;  1QKT A;  1NQ7 A;  5KYJ A;  4G1Z A;  1Z5X U;  1ZGY A;  2AXA A;  2AX7 A;  3L3X A;  5DRJ A;  5GT4 A;  4OEY A;  1XLS A;  3VHV A;  1G1U A;  2Q59 B;  2IHQ A;  3E00 A;  3R8D A;  2GPO A;  3UUA A;  4A2J A;  1P93 A;  2AX8 A;  3B3K A;  3V9T A;  3VRT A;  5DIE A;  5KCT A;  2XKW A;  3L0E A;  5DVV A;  4TUZ A;  2NPA A;  1U3S A;  2PIT A;  5DU5 A;  4PF3 A;  3H52 A;  1T7T A;  3HC5 A;  3ET2 A;  4S14 A;  4REE A;  4MGA B;  5DXB A;  4DOS A;  1XIU A;  5DZ3 A;  1ZH7 A;  1T79 A;  3HC6 A;  2QSE A;  4OH5 A;  1YMT A;  2G0H A;  1FD0 A;  2R6W A;  3VSP A;  2A3I A;  3VJS A;  4DK8 A;  3B68 A;  3OS8 A;  5DVS A;  3W0A A;  1R1K D;  4MGC A;  4P6X A;  3VT3 A;  5AAU A;  4MG6 A;  3GWS X;  1SQN A;  4N5G A;  4IS8 A;  2BJ4 A;  5C4T A;  4QJR A;  2ZNO A;  3EYB A;  3O1D A;  3VJT A;  2AX6 A;  2YAT A;  1PCG A;  2I0J A;  3OKH A;  4J5W C;  2AMA A;  4PWL A;  5JI0 D;  2ZK2 A;  1XVP A;  4OAR A;  5KRH A;  4QM0 A;  3V49 A;  2VV4 A;  2Q8S A;  4CI4 A;  3S9S A;  1XNN A;  3DT3 A;  4ZNS A;  5IZ0 A;  3UUD A;  4MDD A;  4ZN9 A;  2O9I A;  1H9U A;  4ZNH A;  3W5R A;  4X1G A;  5HZC A;  1NQ0 A;  3TKM A;  4L98 A;  3AX8 A;  5IXK A;  1I38 A;  1UHL A;  4G1Y A;  2B23 A;  3V3Q A;  3CJW A;  5HYR A;  4WHG A;  5DKS A;  5E19 A;  3VTC A;  5KCC A;  1G2N A;  2OVH A;  2ZMH A;  3CS8 A;  2ZLC A;  4G2I A;  4IVY A;  2YLP A;  2QAB A;  3AZ3 A;  2GPV A;  2ZY0 A;  4PPP A;  1U3R A;  4XUH A;  1VJB A;  4HEE X;  4OIV A;  2W8Y A;  4ZO1 X;  5DYB A;  5DV8 A;  4IW6 A;  5L7E A;  1RKH A;  2XYJ A;  2HB7 A;  5KRA A;  3X1I A;  4MG8 A;  1PRG A;  2REW A;  2AAX A;  1T76 A;  2ZXZ A;  5DXR A;  5E15 A;  5B5B A;  5I4V A;  1YOW A;  4MG7 A;  4IW8 A;  2Q6R A;  1ZEO A;  2YHD A;  3OSI A;  3HVL A;  3ADW A;  4OC7 A;  4RUP A;  1X7J A;  3PRG A;  2QH6 A;  2ZLA A;  3B0Q A;  1XP1 A;  2V7C A;  1PDU A;  3AFR A;  5C4U A;  3VI8 A;  1UPW A;  3W5Q A;  1NYX A;  3PLZ A;  5KCU A;  1XAP A;  2ACL B;  4PLD A;  3WT7 A;  2P1T A;  5CJ6 A;  2AWH A;  2OAX A;  1KV6 A;  3AUN A;  1PQC A;  2AX9 A;  2Q7J A;  4WQP A;  4JL4 A;  5DXM A;  5C4O A;  4K6I A;  1XJ7 A;  3OSW A;  4XT9 A;  3FS1 A;  1T7R A;  2OCF A;  5DWE A;  3WWR A;  3P8X A;  4LNX A;  1XP6 A;  3UVV A;  1M2Z A;  4IVW A;  3DY6 A;  2PIN A;  2QA8 A;  2VV1 B;  3O1E A;  5JJM A;  4REF A;  1R1K A;  2ZNQ A;  5DYD A;  1IE9 A;  1NQ1 A;  1GS4 A;  3SP9 A;  1ZKY A;  1SR7 A;  2H77 A;  3CQV A;  3FUR A;  3OLL A;  4POH A;  4LNW A;  4OKT A;  4NY9 A;  1KKQ A;  2F4B A;  4IV4 A;  4MGD A;  1YOK A;  1FM9 D;  5DXQ A;  3FC6 A;  3VSO A;  4RAK A;  5KRM A;  1TXI A;  3GD2 A;  5AAV B;  3AZ2 A;  2I4P A;  3CS4 A;  4ZNT A;  2YJA B;  4N1Y A;  3G0W A;  3P0U A;  4PPS A;  5KCE A;  1A52 A;  1G5Y A;  3ILZ A;  4ZNU A;  1X7E A;  3ADU A;  1XDK B;  2XYX A;  1FCZ A;  2ZK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...